3AJ3A

Crystal structure of selenomethionine substituted 4-pyridoxolactonase from mesorhizobium loti
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
273
Chain Sequence
SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-pyridoxolactonase
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
molecule tags Hydrolase
total genus 86
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3aj3A00
1X8HA 4Z6XA 4PVTA 4C1HA 3LVZA 3DHBA 3IEMA 2GCUA 2HB9A 3IOGA 2NYPA 2YNUA 3A4YA 5B1UA 5K0WA 3SFPA 2CBNA 4C1DA 3KNSA 3X2YA 5EV6A 2Q0IA 2I7XA 4XUKA 5AYAA 5ACRA 1X8IA 3IELA 2FHXA 2FU6A 4EFZA 2FU9A 3QH8A 3IDZA 4Z7RA 2P1EA 3PY6A 3BV6A 5LM6A 2ZNBA 1MQOA 4C1EA 1JT1A 1ZKPA 4Z5ZA 5FQAA 4U4LA 5A87A 1BC2A 4PVOA 5ACXA 4HKYA 4D1VA 4RAMA 2Q0JA 2BFLA 2M5DA 2QEDA 4GYUA 1WUPA 2BFZA 5LMCA 2NXAA 5ACQA 1WW1A 3T3OA 4RBSA 2WYMA 3FAIA 1L9YA 4C1FA 4F6ZA 1A8TA 4GCWA 1YCFA 1WRAA 3KNRA 4ZO3A 4ZEJA 4TZEA 4P62A 5FQBA 2XR1A 3FCZA 1YCGA 3ZNBA 4B87A 4HL1A 4NQ4A 4Z67A 3VQZA 3T3NA 2BR6A 3P2UA 4ZNBA 1P9EA 5ACUA 4J5FA 5EHTA 4AWZA 4D1WA 2BG8B 2FHXB 2AIOA 3F9OA 3I13A 2WRSA 4RM5A 2WYMC 3BK2A 4AD9A 4UWOB 4TZFA 4RL0A 4NQ6A 4UBQA 5HH6A 2BFKA 2YZ3A 4EYLA 4V0HA 2ZWRA 4EXSA 5LE1A 2WHGA 5ACPA 2Y8BA 4YSBA 1A7TA 4AX0B 2YNTA 3BC2A 2BG2A 5EWAA 4UWSB 2Y87A 2AZ4A 3I11A 2GMNA 5AXRA 2BG7A 2QDTA 2GFKA 3I0VA 3BK1A 4YSKA 2Q9UA 4J5HA 4C1GA 1M2XA 2BG6A 1XM8A 1JJEA 4O98A 4XWTA 2BTNA 5B3RA 3ZQ4A 3DH8A 2GFJA 2NZEA 5LCHA 3SPUA 4HL2A 3AJ3A 5AHRA 4UWRB 1KR3A 1VGNA 2BIBA 2QINA 1DXKA 4D1UA 5DPXA 5HH4A 4EYFA 3ZWFA 2BGAA 5EVBA 3PY5A 2YNVA 2FU8A 5ACVA 3IE0A 3RPCA 3TP9A 4FSBA 4UAMA 5AEBA 1VJNA 3PG4A 3L6NA 3S0ZA 1BVTA 4BP0A 4ZO2A 5HH5A 5AHOA 5B15A 4EYBA 5LSCA 4DILA 3SBLA 5FQCA 2YNTB 3H3EA 2VW8A 4Z60A 1VMEA 4CHLA 3X2XA 5HISA 3G1PA 1ZTCA 4D02A 2DOOA 4C1CA 2NZFA 4KEPA 3X2ZA 3AF5A 2P97A 4C09A 3SW3A 3MD7A 2ZZIA 4RAWA 4JO0A 5IQKA 3DHCA 1KO2A 5LS3A 2OHJA 4AWYB 3KL7A 2BFZB 4XWWA 2M5CA 1X8GA 4UA4A 2GKLA 5K4KA 4D1TA 4WD6A 3I14A 2R2DA 2QJSA 5EH9A 3R2UA 3JXPA 4FEKA 2BC2A 3WXCA 5A0TA 3Q6VA 2Y8AA 4BZ3A 5ACWA 2BG8A 5EV8A 2YNVB 4KEQA 4NQ5A 1QH3A 3ESHA 5ACSA 3RKKA 1QH5A 4TZBA 5AXOA 2E7YA 1Y44A 5EW0A 1K07A 3ADRA 4TYTA 4TZ9A 5EVDA 5LLDA 4UWPB 2H6AA 5HIQA 2UYXA 1WUOA 4F6HA 1DD6A 4DIKA 2DKFA 1SMLA 5LCFA 3SD9A 3X30A 2FK6A 2ZO4A 2Q42A 4RL2A 3T9MA 3AF6A 4Z5YA 2QDSA 5K4NA 1ZNBA 2I7TA 2YNWA 5HIPA 3IE2A 4H0DA 4AX1B 1DDKA 2BMIA 4TYFA 3DHAA 4EY2A 4NQ2A 2A7MA 2FM6A 1JJTA 5EVKA 3VPEA 1KO3A 4EXYA 2P18A 2OHIA 3ZR9A 5K4MA 5KIKA 1BMCA 5KILA 2YCBA 2P4ZA 5A5ZA 5HIOA 2FU7A 1YCHA 5LCAA 4LE6A 2WYLA 3IOFA 3I15A 1XTOA 3IEKA 3SRXA 5ACTA 2I7VA 5A0VA 1E5DA 4GYQA 2OHHA 4YSLA 3IE1A 1HLKA 3RKJA 2XF4A 4FR7A
chains in the Genus database with same CATH superfamily
1X8HA 4Z6XA 4PVTA 4C1HA 3LVZA 3DHBA 3IEMA 2GCUA 2HB9A 3IOGA 2NYPA 2YNUA 3A4YA 5B1UA 5K0WA 3SFPA 2CBNA 4C1DA 3KNSA 3X2YA 5EV6A 2Q0IA 2I7XA 4XUKA 5AYAA 5ACRA 1X8IA 3IELA 2FHXA 2FU6A 4EFZA 2FU9A 3QH8A 3IDZA 4Z7RA 2P1EA 3PY6A 3BV6A 5LM6A 2ZNBA 1MQOA 4C1EA 1JT1A 1ZKPA 4Z5ZA 5FQAA 4U4LA 5A87A 1BC2A 4PVOA 5ACXA 4HKYA 4D1VA 4RAMA 2Q0JA 2BFLA 2M5DA 2QEDA 4GYUA 1WUPA 2BFZA 5LMCA 2NXAA 5ACQA 1WW1A 3T3OA 4NURA 4RBSA 2WYMA 3FAIA 1L9YA 4C1FA 4F6ZA 1A8TA 4GCWA 1YCFA 1WRAA 3KNRA 4ZO3A 2CFUA 4ZEJA 4TZEA 4P62A 5FQBA 2XR1A 4AXHA 3FCZA 1YCGA 3ZNBA 4B87A 4HL1A 4NQ4A 4Z67A 3VQZA 3T3NA 2BR6A 3P2UA 4ZNBA 4PDXA 1P9EA 5ACUA 4J5FA 5EHTA 4AWZA 4D1WA 2BG8B 2FHXB 2AIOA 3F9OA 3I13A 2WRSA 4RM5A 2WYMC 3BK2A 4AD9A 4UWOB 4TZFA 5AIJA 4RL0A 4NQ6A 4UBQA 5HH6A 2BFKA 2YZ3A 4EYLA 4V0HA 2ZWRA 4EXSA 5LE1A 2WHGA 5ACPA 2Y8BA 4YSBA 1A7TA 4AX0B 2YNTA 3BC2A 2BG2A 5EWAA 5A23A 4UWSB 2Y87A 2AZ4A 3I11A 2GMNA 5AXRA 2BG7A 2QDTA 2GFKA 3I0VA 3BK1A 4YSKA 2Q9UA 2CG3A 4J5HA 4C1GA 1M2XA 2BG6A 1XM8A 1JJEA 4O98A 4XWTA 4AV7A 2BTNA 5B3RA 3ZQ4A 3DH8A 2GFJA 2NZEA 5LCHA 3SPUA 4HL2A 3AJ3A 5AHRA 4UWRB 1KR3A 1VGNA 2BIBA 2QINA 1DXKA 4D1UA 5AJLA 5DPXA 5HH4A 4EYFA 3ZWFA 2BGAA 5EVBA 3PY5A 2YNVA 2FU8A 5ACVA 3IE0A 3RPCA 3TP9A 4FSBA 4UAMA 5AEBA 1VJNA 3PG4A 3L6NA 3S0ZA 1BVTA 4BP0A 4ZO2A 5HH5A 5AHOA 5B15A 4EYBA 5LSCA 4DILA 3SBLA 5FQCA 2YNTB 3H3EA 2VW8A 4Z60A 1VMEA 4CHLA 3X2XA 5HISA 3G1PA 1ZTCA 4D02A 2DOOA 4C1CA 2NZFA 4KEPA 3X2ZA 3AF5A 2P97A 4C09A 3SW3A 3MD7A 2ZZIA 4RAWA 4JO0A 5IQKA 3DHCA 1KO2A 5LS3A 2OHJA 4AWYB 3KL7A 2BFZB 2CFZA 4XWWA 2M5CA 1X8GA 4UA4A 2GKLA 5K4KA 4D1TA 4WD6A 3I14A 2R2DA 2QJSA 5EH9A 3R2UA 3JXPA 4FEKA 2BC2A 3WXCA 5A0TA 3Q6VA 2Y8AA 4BZ3A 5ACWA 2BG8A 5EV8A 2YNVB 4KEQA 4NQ5A 1QH3A 3ESHA 5ACSA 3RKKA 1QH5A 4TZBA 5AXOA 2E7YA 1Y44A 5EW0A 1K07A 3ADRA 4TYTA 4TZ9A 5EVDA 5LLDA 4UWPB 2YHEA 2H6AA 5HIQA 2UYXA 1WUOA 4F6HA 1DD6A 4DIKA 2DKFA 1SMLA 2CG2A 5LCFA 3SD9A 3X30A 2FK6A 2ZO4A 2Q42A 4RL2A 3T9MA 3AF6A 4Z5YA 2QDSA 5K4NA 1ZNBA 2I7TA 2YNWA 5HIPA 3IE2A 4H0DA 4AX1B 1DDKA 2BMIA 4TYFA 3DHAA 4EY2A 4NQ2A 2A7MA 2FM6A 1JJTA 5EVKA 3VPEA 1KO3A 4EXYA 2P18A 2OHIA 3ZR9A 5K4MA 5KIKA 1BMCA 5KILA 2YCBA 2P4ZA 5A5ZA 5HIOA 2FU7A 1YCHA 5LCAA 4LE6A 2WYLA 3IOFA 3I15A 1XTOA 3IEKA 3SRXA 5ACTA 2I7VA 5A0VA 1E5DA 4GYQA 2OHHA 4YSLA 3IE1A 1HLKA 3RKJA 2XF4A 4FR7A
chains in the Genus database with same CATH topology
1X8HA 4Z6XA 4PVTA 4C1HA 3LVZA 3DHBA 3IEMA 2GCUA 2HB9A 3IOGA 2NYPA 2YNUA 3A4YA 5B1UA 5K0WA 3SFPA 2CBNA 4C1DA 3KNSA 3X2YA 5EV6A 2Q0IA 2I7XA 4XUKA 5AYAA 5ACRA 1X8IA 3IELA 2FHXA 2FU6A 4EFZA 2FU9A 3QH8A 3IDZA 4Z7RA 2P1EA 3PY6A 3BV6A 5LM6A 2ZNBA 1MQOA 4C1EA 1JT1A 1ZKPA 4Z5ZA 5FQAA 4U4LA 5A87A 1BC2A 4PVOA 5ACXA 4HKYA 4D1VA 4RAMA 2Q0JA 2BFLA 2M5DA 2QEDA 4GYUA 1WUPA 2BFZA 5LMCA 2NXAA 5ACQA 1WW1A 3T3OA 4RBSA 2WYMA 3FAIA 1L9YA 4C1FA 4F6ZA 1A8TA 4GCWA 1YCFA 1WRAA 3KNRA 4ZO3A 4ZEJA 4TZEA 4P62A 5FQBA 2XR1A 3FCZA 1YCGA 3ZNBA 4B87A 4HL1A 4NQ4A 4Z67A 3VQZA 3T3NA 2BR6A 3P2UA 4ZNBA 1P9EA 5ACUA 4J5FA 5EHTA 4AWZA 4D1WA 2BG8B 2FHXB 2AIOA 3F9OA 3I13A 2WRSA 4RM5A 2WYMC 3BK2A 4AD9A 4UWOB 4TZFA 4RL0A 4NQ6A 4UBQA 5HH6A 2BFKA 2YZ3A 4EYLA 4V0HA 2ZWRA 4EXSA 5LE1A 2WHGA 5ACPA 2Y8BA 4YSBA 1A7TA 4AX0B 2YNTA 3BC2A 2BG2A 5EWAA 4UWSB 2Y87A 2AZ4A 3I11A 2GMNA 5AXRA 2BG7A 2QDTA 2GFKA 3I0VA 3BK1A 4YSKA 2Q9UA 4J5HA 4C1GA 1M2XA 2BG6A 1XM8A 1JJEA 4O98A 4XWTA 2BTNA 5B3RA 3ZQ4A 3DH8A 2GFJA 2NZEA 5LCHA 3SPUA 4HL2A 3AJ3A 5AHRA 4UWRB 1KR3A 1VGNA 2BIBA 2QINA 1DXKA 4D1UA 5DPXA 5HH4A 4EYFA 3ZWFA 2BGAA 5EVBA 3PY5A 2YNVA 2FU8A 5ACVA 3IE0A 3RPCA 3TP9A 4FSBA 4UAMA 5AEBA 1VJNA 3PG4A 3L6NA 3S0ZA 1BVTA 4BP0A 4ZO2A 5HH5A 5AHOA 5B15A 4EYBA 5LSCA 4DILA 3SBLA 5FQCA 2YNTB 3H3EA 2VW8A 4Z60A 1VMEA 4CHLA 3X2XA 5HISA 3G1PA 1ZTCA 4D02A 2DOOA 4C1CA 2NZFA 4KEPA 3X2ZA 3AF5A 2P97A 4C09A 3SW3A 3MD7A 2ZZIA 4RAWA 4JO0A 5IQKA 3DHCA 1KO2A 5LS3A 2OHJA 4AWYB 3KL7A 2BFZB 4XWWA 2M5CA 1X8GA 4UA4A 2GKLA 5K4KA 4D1TA 4WD6A 3I14A 2R2DA 2QJSA 5EH9A 3R2UA 3JXPA 4FEKA 2BC2A 3WXCA 5A0TA 3Q6VA 2Y8AA 4BZ3A 5ACWA 2BG8A 5EV8A 2YNVB 4KEQA 4NQ5A 1QH3A 3ESHA 5ACSA 3RKKA 1QH5A 4TZBA 5AXOA 2E7YA 1Y44A 5EW0A 1K07A 3ADRA 4TYTA 4TZ9A 5EVDA 5LLDA 4UWPB 2H6AA 5HIQA 2UYXA 1WUOA 4F6HA 1DD6A 4DIKA 2DKFA 1SMLA 5LCFA 3SD9A 3X30A 2FK6A 2ZO4A 2Q42A 4RL2A 3T9MA 3AF6A 4Z5YA 2QDSA 5K4NA 1ZNBA 2I7TA 2YNWA 5HIPA 3IE2A 4H0DA 4AX1B 1DDKA 2BMIA 4TYFA 3DHAA 4EY2A 4NQ2A 2A7MA 2FM6A 1JJTA 5EVKA 3VPEA 1KO3A 4EXYA 2P18A 2OHIA 3ZR9A 5K4MA 5KIKA 1BMCA 5KILA 2YCBA 2P4ZA 5A5ZA 5HIOA 2FU7A 1YCHA 5LCAA 4LE6A 2WYLA 3IOFA 3I15A 1XTOA 3IEKA 3SRXA 5ACTA 2I7VA 5A0VA 1E5DA 4GYQA 2OHHA 4YSLA 3IE1A 1HLKA 3RKJA 2XF4A 4FR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8H A;  4Z6X A;  4PVT A;  4C1H A;  3LVZ A;  3DHB A;  3IEM A;  2GCU A;  2HB9 A;  3IOG A;  2NYP A;  2YNU A;  3A4Y A;  5B1U A;  5K0W A;  3SFP A;  2CBN A;  4C1D A;  3KNS A;  3X2Y A;  5EV6 A;  2Q0I A;  2I7X A;  4XUK A;  5AYA A;  5ACR A;  1X8I A;  3IEL A;  2FHX A;  2FU6 A;  4EFZ A;  2FU9 A;  3QH8 A;  3IDZ A;  4Z7R A;  2P1E A;  3PY6 A;  3BV6 A;  5LM6 A;  2ZNB A;  1MQO A;  4C1E A;  1JT1 A;  1ZKP A;  4Z5Z A;  5FQA A;  4U4L A;  5A87 A;  1BC2 A;  4PVO A;  5ACX A;  4HKY A;  4D1V A;  4RAM A;  2Q0J A;  2BFL A;  2M5D A;  2QED A;  4GYU A;  1WUP A;  2BFZ A;  5LMC A;  2NXA A;  5ACQ A;  1WW1 A;  3T3O A;  4RBS A;  2WYM A;  3FAI A;  1L9Y A;  4C1F A;  4F6Z A;  1A8T A;  4GCW A;  1YCF A;  1WRA A;  3KNR A;  4ZO3 A;  4ZEJ A;  4TZE A;  4P62 A;  5FQB A;  2XR1 A;  3FCZ A;  1YCG A;  3ZNB A;  4B87 A;  4HL1 A;  4NQ4 A;  4Z67 A;  3VQZ A;  3T3N A;  2BR6 A;  3P2U A;  4ZNB A;  1P9E A;  5ACU A;  4J5F A;  5EHT A;  4AWZ A;  4D1W A;  2BG8 B;  2FHX B;  2AIO A;  3F9O A;  3I13 A;  2WRS A;  4RM5 A;  2WYM C;  3BK2 A;  4AD9 A;  4UWO B;  4TZF A;  4RL0 A;  4NQ6 A;  4UBQ A;  5HH6 A;  2BFK A;  2YZ3 A;  4EYL A;  4V0H A;  2ZWR A;  4EXS A;  5LE1 A;  2WHG A;  5ACP A;  2Y8B A;  4YSB A;  1A7T A;  4AX0 B;  2YNT A;  3BC2 A;  2BG2 A;  5EWA A;  4UWS B;  2Y87 A;  2AZ4 A;  3I11 A;  2GMN A;  5AXR A;  2BG7 A;  2QDT A;  2GFK A;  3I0V A;  3BK1 A;  4YSK A;  2Q9U A;  4J5H A;  4C1G A;  1M2X A;  2BG6 A;  1XM8 A;  1JJE A;  4O98 A;  4XWT A;  2BTN A;  5B3R A;  3ZQ4 A;  3DH8 A;  2GFJ A;  2NZE A;  5LCH A;  3SPU A;  4HL2 A;  3AJ3 A;  5AHR A;  4UWR B;  1KR3 A;  1VGN A;  2BIB A;  2QIN A;  1DXK A;  4D1U A;  5DPX A;  5HH4 A;  4EYF A;  3ZWF A;  2BGA A;  5EVB A;  3PY5 A;  2YNV A;  2FU8 A;  5ACV A;  3IE0 A;  3RPC A;  3TP9 A;  4FSB A;  4UAM A;  5AEB A;  1VJN A;  3PG4 A;  3L6N A;  3S0Z A;  1BVT A;  4BP0 A;  4ZO2 A;  5HH5 A;  5AHO A;  5B15 A;  4EYB A;  5LSC A;  4DIL A;  3SBL A;  5FQC A;  2YNT B;  3H3E A;  2VW8 A;  4Z60 A;  1VME A;  4CHL A;  3X2X A;  5HIS A;  3G1P A;  1ZTC A;  4D02 A;  2DOO A;  4C1C A;  2NZF A;  4KEP A;  3X2Z A;  3AF5 A;  2P97 A;  4C09 A;  3SW3 A;  3MD7 A;  2ZZI A;  4RAW A;  4JO0 A;  5IQK A;  3DHC A;  1KO2 A;  5LS3 A;  2OHJ A;  4AWY B;  3KL7 A;  2BFZ B;  4XWW A;  2M5C A;  1X8G A;  4UA4 A;  2GKL A;  5K4K A;  4D1T A;  4WD6 A;  3I14 A;  2R2D A;  2QJS A;  5EH9 A;  3R2U A;  3JXP A;  4FEK A;  2BC2 A;  3WXC A;  5A0T A;  3Q6V A;  2Y8A A;  4BZ3 A;  5ACW A;  2BG8 A;  5EV8 A;  2YNV B;  4KEQ A;  4NQ5 A;  1QH3 A;  3ESH A;  5ACS A;  3RKK A;  1QH5 A;  4TZB A;  5AXO A;  2E7Y A;  1Y44 A;  5EW0 A;  1K07 A;  3ADR A;  4TYT A;  4TZ9 A;  5EVD A;  5LLD A;  4UWP B;  2H6A A;  5HIQ A;  2UYX A;  1WUO A;  4F6H A;  1DD6 A;  4DIK A;  2DKF A;  1SML A;  5LCF A;  3SD9 A;  3X30 A;  2FK6 A;  2ZO4 A;  2Q42 A;  4RL2 A;  3T9M A;  3AF6 A;  4Z5Y A;  2QDS A;  5K4N A;  1ZNB A;  2I7T A;  2YNW A;  5HIP A;  3IE2 A;  4H0D A;  4AX1 B;  1DDK A;  2BMI A;  4TYF A;  3DHA A;  4EY2 A;  4NQ2 A;  2A7M A;  2FM6 A;  1JJT A;  5EVK A;  3VPE A;  1KO3 A;  4EXY A;  2P18 A;  2OHI A;  3ZR9 A;  5K4M A;  5KIK A;  1BMC A;  5KIL A;  2YCB A;  2P4Z A;  5A5Z A;  5HIO A;  2FU7 A;  1YCH A;  5LCA A;  4LE6 A;  2WYL A;  3IOF A;  3I15 A;  1XTO A;  3IEK A;  3SRX A;  5ACT A;  2I7V A;  5A0V A;  1E5D A;  4GYQ A;  2OHH A;  4YSL A;  3IE1 A;  1HLK A;  3RKJ A;  2XF4 A;  4FR7 A; 
#chains in the Genus database with same CATH topology
 1X8H A;  4Z6X A;  4PVT A;  4C1H A;  3LVZ A;  3DHB A;  3IEM A;  2GCU A;  2HB9 A;  3IOG A;  2NYP A;  2YNU A;  3A4Y A;  5B1U A;  5K0W A;  3SFP A;  2CBN A;  4C1D A;  3KNS A;  3X2Y A;  5EV6 A;  2Q0I A;  2I7X A;  4XUK A;  5AYA A;  5ACR A;  1X8I A;  3IEL A;  2FHX A;  2FU6 A;  4EFZ A;  2FU9 A;  3QH8 A;  3IDZ A;  4Z7R A;  2P1E A;  3PY6 A;  3BV6 A;  5LM6 A;  2ZNB A;  1MQO A;  4C1E A;  1JT1 A;  1ZKP A;  4Z5Z A;  5FQA A;  4U4L A;  5A87 A;  1BC2 A;  4PVO A;  5ACX A;  4HKY A;  4D1V A;  4RAM A;  2Q0J A;  2BFL A;  2M5D A;  2QED A;  4GYU A;  1WUP A;  2BFZ A;  5LMC A;  2NXA A;  5ACQ A;  1WW1 A;  3T3O A;  4NUR A;  4RBS A;  2WYM A;  3FAI A;  1L9Y A;  4C1F A;  4F6Z A;  1A8T A;  4GCW A;  1YCF A;  1WRA A;  3KNR A;  4ZO3 A;  2CFU A;  4ZEJ A;  4TZE A;  4P62 A;  5FQB A;  2XR1 A;  4AXH A;  3FCZ A;  1YCG A;  3ZNB A;  4B87 A;  4HL1 A;  4NQ4 A;  4Z67 A;  3VQZ A;  3T3N A;  2BR6 A;  3P2U A;  4ZNB A;  4PDX A;  1P9E A;  5ACU A;  4J5F A;  5EHT A;  4AWZ A;  4D1W A;  2BG8 B;  2FHX B;  2AIO A;  3F9O A;  3I13 A;  2WRS A;  4RM5 A;  2WYM C;  3BK2 A;  4AD9 A;  4UWO B;  4TZF A;  5AIJ A;  4RL0 A;  4NQ6 A;  4UBQ A;  5HH6 A;  2BFK A;  2YZ3 A;  4EYL A;  4V0H A;  2ZWR A;  4EXS A;  5LE1 A;  2WHG A;  5ACP A;  2Y8B A;  4YSB A;  1A7T A;  4AX0 B;  2YNT A;  3BC2 A;  2BG2 A;  5EWA A;  5A23 A;  4UWS B;  2Y87 A;  2AZ4 A;  3I11 A;  2GMN A;  5AXR A;  2BG7 A;  2QDT A;  2GFK A;  3I0V A;  3BK1 A;  4YSK A;  2Q9U A;  2CG3 A;  4J5H A;  4C1G A;  1M2X A;  2BG6 A;  1XM8 A;  1JJE A;  4O98 A;  4XWT A;  4AV7 A;  2BTN A;  5B3R A;  3ZQ4 A;  3DH8 A;  2GFJ A;  2NZE A;  5LCH A;  3SPU A;  4HL2 A;  3AJ3 A;  5AHR A;  4UWR B;  1KR3 A;  1VGN A;  2BIB A;  2QIN A;  1DXK A;  4D1U A;  5AJL A;  5DPX A;  5HH4 A;  4EYF A;  3ZWF A;  2BGA A;  5EVB A;  3PY5 A;  2YNV A;  2FU8 A;  5ACV A;  3IE0 A;  3RPC A;  3TP9 A;  4FSB A;  4UAM A;  5AEB A;  1VJN A;  3PG4 A;  3L6N A;  3S0Z A;  1BVT A;  4BP0 A;  4ZO2 A;  5HH5 A;  5AHO A;  5B15 A;  4EYB A;  5LSC A;  4DIL A;  3SBL A;  5FQC A;  2YNT B;  3H3E A;  2VW8 A;  4Z60 A;  1VME A;  4CHL A;  3X2X A;  5HIS A;  3G1P A;  1ZTC A;  4D02 A;  2DOO A;  4C1C A;  2NZF A;  4KEP A;  3X2Z A;  3AF5 A;  2P97 A;  4C09 A;  3SW3 A;  3MD7 A;  2ZZI A;  4RAW A;  4JO0 A;  5IQK A;  3DHC A;  1KO2 A;  5LS3 A;  2OHJ A;  4AWY B;  3KL7 A;  2BFZ B;  2CFZ A;  4XWW A;  2M5C A;  1X8G A;  4UA4 A;  2GKL A;  5K4K A;  4D1T A;  4WD6 A;  3I14 A;  2R2D A;  2QJS A;  5EH9 A;  3R2U A;  3JXP A;  4FEK A;  2BC2 A;  3WXC A;  5A0T A;  3Q6V A;  2Y8A A;  4BZ3 A;  5ACW A;  2BG8 A;  5EV8 A;  2YNV B;  4KEQ A;  4NQ5 A;  1QH3 A;  3ESH A;  5ACS A;  3RKK A;  1QH5 A;  4TZB A;  5AXO A;  2E7Y A;  1Y44 A;  5EW0 A;  1K07 A;  3ADR A;  4TYT A;  4TZ9 A;  5EVD A;  5LLD A;  4UWP B;  2YHE A;  2H6A A;  5HIQ A;  2UYX A;  1WUO A;  4F6H A;  1DD6 A;  4DIK A;  2DKF A;  1SML A;  2CG2 A;  5LCF A;  3SD9 A;  3X30 A;  2FK6 A;  2ZO4 A;  2Q42 A;  4RL2 A;  3T9M A;  3AF6 A;  4Z5Y A;  2QDS A;  5K4N A;  1ZNB A;  2I7T A;  2YNW A;  5HIP A;  3IE2 A;  4H0D A;  4AX1 B;  1DDK A;  2BMI A;  4TYF A;  3DHA A;  4EY2 A;  4NQ2 A;  2A7M A;  2FM6 A;  1JJT A;  5EVK A;  3VPE A;  1KO3 A;  4EXY A;  2P18 A;  2OHI A;  3ZR9 A;  5K4M A;  5KIK A;  1BMC A;  5KIL A;  2YCB A;  2P4Z A;  5A5Z A;  5HIO A;  2FU7 A;  1YCH A;  5LCA A;  4LE6 A;  2WYL A;  3IOF A;  3I15 A;  1XTO A;  3IEK A;  3SRX A;  5ACT A;  2I7V A;  5A0V A;  1E5D A;  4GYQ A;  2OHH A;  4YSL A;  3IE1 A;  1HLK A;  3RKJ A;  2XF4 A;  4FR7 A; 
#chains in the Genus database with same CATH homology
 1X8H A;  4Z6X A;  4PVT A;  4C1H A;  3LVZ A;  3DHB A;  3IEM A;  2GCU A;  2HB9 A;  3IOG A;  2NYP A;  2YNU A;  3A4Y A;  5B1U A;  5K0W A;  3SFP A;  2CBN A;  4C1D A;  3KNS A;  3X2Y A;  5EV6 A;  2Q0I A;  2I7X A;  4XUK A;  5AYA A;  5ACR A;  1X8I A;  3IEL A;  2FHX A;  2FU6 A;  4EFZ A;  2FU9 A;  3QH8 A;  3IDZ A;  4Z7R A;  2P1E A;  3PY6 A;  3BV6 A;  5LM6 A;  2ZNB A;  1MQO A;  4C1E A;  1JT1 A;  1ZKP A;  4Z5Z A;  5FQA A;  4U4L A;  5A87 A;  1BC2 A;  4PVO A;  5ACX A;  4HKY A;  4D1V A;  4RAM A;  2Q0J A;  2BFL A;  2M5D A;  2QED A;  4GYU A;  1WUP A;  2BFZ A;  5LMC A;  2NXA A;  5ACQ A;  1WW1 A;  3T3O A;  4RBS A;  2WYM A;  3FAI A;  1L9Y A;  4C1F A;  4F6Z A;  1A8T A;  4GCW A;  1YCF A;  1WRA A;  3KNR A;  4ZO3 A;  4ZEJ A;  4TZE A;  4P62 A;  5FQB A;  2XR1 A;  3FCZ A;  1YCG A;  3ZNB A;  4B87 A;  4HL1 A;  4NQ4 A;  4Z67 A;  3VQZ A;  3T3N A;  2BR6 A;  3P2U A;  4ZNB A;  1P9E A;  5ACU A;  4J5F A;  5EHT A;  4AWZ A;  4D1W A;  2BG8 B;  2FHX B;  2AIO A;  3F9O A;  3I13 A;  2WRS A;  4RM5 A;  2WYM C;  3BK2 A;  4AD9 A;  4UWO B;  4TZF A;  4RL0 A;  4NQ6 A;  4UBQ A;  5HH6 A;  2BFK A;  2YZ3 A;  4EYL A;  4V0H A;  2ZWR A;  4EXS A;  5LE1 A;  2WHG A;  5ACP A;  2Y8B A;  4YSB A;  1A7T A;  4AX0 B;  2YNT A;  3BC2 A;  2BG2 A;  5EWA A;  4UWS B;  2Y87 A;  2AZ4 A;  3I11 A;  2GMN A;  5AXR A;  2BG7 A;  2QDT A;  2GFK A;  3I0V A;  3BK1 A;  4YSK A;  2Q9U A;  4J5H A;  4C1G A;  1M2X A;  2BG6 A;  1XM8 A;  1JJE A;  4O98 A;  4XWT A;  2BTN A;  5B3R A;  3ZQ4 A;  3DH8 A;  2GFJ A;  2NZE A;  5LCH A;  3SPU A;  4HL2 A;  3AJ3 A;  5AHR A;  4UWR B;  1KR3 A;  1VGN A;  2BIB A;  2QIN A;  1DXK A;  4D1U A;  5DPX A;  5HH4 A;  4EYF A;  3ZWF A;  2BGA A;  5EVB A;  3PY5 A;  2YNV A;  2FU8 A;  5ACV A;  3IE0 A;  3RPC A;  3TP9 A;  4FSB A;  4UAM A;  5AEB A;  1VJN A;  3PG4 A;  3L6N A;  3S0Z A;  1BVT A;  4BP0 A;  4ZO2 A;  5HH5 A;  5AHO A;  5B15 A;  4EYB A;  5LSC A;  4DIL A;  3SBL A;  5FQC A;  2YNT B;  3H3E A;  2VW8 A;  4Z60 A;  1VME A;  4CHL A;  3X2X A;  5HIS A;  3G1P A;  1ZTC A;  4D02 A;  2DOO A;  4C1C A;  2NZF A;  4KEP A;  3X2Z A;  3AF5 A;  2P97 A;  4C09 A;  3SW3 A;  3MD7 A;  2ZZI A;  4RAW A;  4JO0 A;  5IQK A;  3DHC A;  1KO2 A;  5LS3 A;  2OHJ A;  4AWY B;  3KL7 A;  2BFZ B;  4XWW A;  2M5C A;  1X8G A;  4UA4 A;  2GKL A;  5K4K A;  4D1T A;  4WD6 A;  3I14 A;  2R2D A;  2QJS A;  5EH9 A;  3R2U A;  3JXP A;  4FEK A;  2BC2 A;  3WXC A;  5A0T A;  3Q6V A;  2Y8A A;  4BZ3 A;  5ACW A;  2BG8 A;  5EV8 A;  2YNV B;  4KEQ A;  4NQ5 A;  1QH3 A;  3ESH A;  5ACS A;  3RKK A;  1QH5 A;  4TZB A;  5AXO A;  2E7Y A;  1Y44 A;  5EW0 A;  1K07 A;  3ADR A;  4TYT A;  4TZ9 A;  5EVD A;  5LLD A;  4UWP B;  2H6A A;  5HIQ A;  2UYX A;  1WUO A;  4F6H A;  1DD6 A;  4DIK A;  2DKF A;  1SML A;  5LCF A;  3SD9 A;  3X30 A;  2FK6 A;  2ZO4 A;  2Q42 A;  4RL2 A;  3T9M A;  3AF6 A;  4Z5Y A;  2QDS A;  5K4N A;  1ZNB A;  2I7T A;  2YNW A;  5HIP A;  3IE2 A;  4H0D A;  4AX1 B;  1DDK A;  2BMI A;  4TYF A;  3DHA A;  4EY2 A;  4NQ2 A;  2A7M A;  2FM6 A;  1JJT A;  5EVK A;  3VPE A;  1KO3 A;  4EXY A;  2P18 A;  2OHI A;  3ZR9 A;  5K4M A;  5KIK A;  1BMC A;  5KIL A;  2YCB A;  2P4Z A;  5A5Z A;  5HIO A;  2FU7 A;  1YCH A;  5LCA A;  4LE6 A;  2WYL A;  3IOF A;  3I15 A;  1XTO A;  3IEK A;  3SRX A;  5ACT A;  2I7V A;  5A0V A;  1E5D A;  4GYQ A;  2OHH A;  4YSL A;  3IE1 A;  1HLK A;  3RKJ A;  2XF4 A;  4FR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...