3AJ3A

Crystal structure of selenomethionine substituted 4-pyridoxolactonase from mesorhizobium loti
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
273
structure length
273
Chain Sequence
SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 4-pyridoxolactonase
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
total genus 86
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2010-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3aj3A00
5ACVA 5IQKA 3I13A 5K4MA 2Y87A 4EYFA 3ZR9A 2YNVB 4FSBA 4UWOB 4D1TA 5A0TA 5LE1A 3KNRA 2BFKA 4CHLA 4AWZA 2DOOA 2XF4A 1QH5A 4KEQA 2OHIA 2YNTB 4Z67A 5AYAA 4UWSB 3BV6A 5LCFA 2UYXA 3DH8A 2BG8B 2R2DA 1WUPA 3P2UA 3RKKA 4UWRB 2HB9A 5EV6A 5ACRA 4U4LA 3SW3A 2QDTA 2WHGA 3AF5A 4RM5A 2OHJA 3DHAA 5LS3A 5DPXA 2GFJA 4C09A 4EFZA 4TZ9A 4LE6A 3VQZA 1WW1A 4F6HA 4TZBA 3IEMA 1ZNBA 3IELA 4C1EA 5EVKA 4HKYA 3ZQ4A 4ZNBA 2BMIA 4PVOA 5A5ZA 2P4ZA 5ACUA 5A87A 3I14A 5AEBA 2Q9UA 2YNTA 1A7TA 1P9EA 2P97A 5EVDA 3IDZA 1WUOA 1VMEA 3I15A 2QINA 2NYPA 4EYLA 2BC2A 3JXPA 4F6ZA 5LMCA 1KO3A 1MQOA 1BC2A 1HLKA 5FQCA 2FU9A 4AD9A 2BTNA 4V0HA 1ZKPA 3DHCA 2ZO4A 4C1FA 5ACWA 3BK1A 2Y8BA 1JJTA 1DXKA 4HL1A 3SFPA 3IE2A 3IOFA 4Z7RA 3SBLA 2YCBA 4J5HA 1M2XA 2AIOA 3Q6VA 3ZWFA 5AHRA 2Q0IA 5EV8A 2BG2A 2ZWRA 2BG6A 3AJ3A 2ZNBA 3F9OA 4D1VA 4PVTA 1QH3A 5LLDA 2I7TA 4TZEA 2OHHA 4J5FA 5EHTA 2FU7A 4RAMA 4XWTA 3T3OA 2QDSA 3I0VA 4AWYB 4Z6XA 2YNUA 4C1CA 3X2ZA 3T9MA 3ADRA 4ZO3A 4NQ2A 2NZFA 5LCHA 1YCHA 4WD6A 4Z5YA 2BG7A 1K07A 3SD9A 4YSBA 2FU6A 5HIOA 2WYMC 4ZO2A 4KEPA 4XWWA 1VGNA 4GYUA 2CBNA 1X8IA 3PG4A 2WYLA 4D1WA 4B87A 3L6NA 4RAWA 5ACTA 1WRAA 3KNSA 2WRSA 4EXYA 5AXRA 4DILA 5AHOA 1DDKA 1A8TA 4EYBA 2GCUA 4Z60A 2Q0JA 1JT1A 4H0DA 4GCWA 3FAIA 1SMLA 4NQ6A 4HL2A 5EW0A 2NXAA 4RL0A 5EVBA 1KR3A 2WYMA 4D1UA 4EY2A 5KILA 3MD7A 3AF6A 2BIBA 4TYTA 1X8HA 4O98A 2E7YA 4C1DA 1E5DA 2QJSA 4TZFA 4UA4A 2NZEA 5EH9A 3I11A 4GYQA 5HH4A 2BFLA 5LM6A 5ACPA 5K0WA 2BFZB 3PY6A 5HIPA 4BP0A 5FQAA 2P1EA 1YCGA 5B3RA 2BR6A 4YSKA 3FCZA 2M5CA 5ACQA 3ZNBA 5ACXA 4UBQA 2FU8A 3RKJA 3TP9A 1XM8A 4NQ4A 4BZ3A 1X8GA 2H6AA 3SPUA 4C1HA 5KIKA 4Z5ZA 4YSLA 3H3EA 3R2UA 5AXOA 3QH8A 4UAMA 3IE1A 4JO0A 2BFZA 2FHXB 2I7XA 3PY5A 3BK2A 5EWAA 4RBSA 3WXCA 3DHBA 2A7MA 2DKFA 3S0ZA 5B1UA 2GKLA 2VW8A 1YCFA 3LVZA 4NQ5A 5K4NA 3IE0A 4XUKA 1VJNA 3VPEA 2GMNA 5HH5A 2YNVA 4DIKA 5K4KA 4P62A 5HISA 2QEDA 2BGAA 4AX0B 2M5DA 1XTOA 1BMCA 3BC2A 3KL7A 5HH6A 3ESHA 4AX1B 2YNWA 4EXSA 2YZ3A 2Y8AA 1ZTCA 2FHXA 3G1PA 4C1GA 2BG8A 4RL2A 2I7VA 2AZ4A 3IEKA 5A0VA 5FQBA 2ZZIA 4D02A 5LCAA 1JJEA 1BVTA 3X2YA 3T3NA 1L9YA 2FM6A 2XR1A 2P18A 5ACSA 4UWPB 3X2XA 3IOGA 4FEKA 1DD6A 3A4YA 2GFKA 2Q42A 3SRXA 5B15A 4ZEJA 4FR7A 3RPCA 5LSCA 5HIQA 1Y44A 2FK6A 4TYFA 3X30A 1KO2A
chains in the Genus database with same CATH superfamily
5ACVA 5IQKA 3I13A 5K4MA 2Y87A 4EYFA 3ZR9A 2YNVB 4FSBA 4UWOB 4D1TA 5A0TA 5LE1A 3KNRA 2BFKA 4CHLA 4AWZA 2DOOA 2XF4A 1QH5A 4KEQA 2OHIA 2YNTB 4Z67A 5AYAA 4UWSB 3BV6A 5LCFA 2UYXA 3DH8A 2BG8B 2R2DA 1WUPA 3P2UA 3RKKA 4UWRB 2HB9A 5EV6A 5ACRA 4U4LA 3SW3A 2QDTA 2WHGA 3AF5A 4RM5A 2OHJA 3DHAA 5LS3A 5DPXA 2GFJA 4C09A 4EFZA 4TZ9A 4LE6A 3VQZA 1WW1A 4F6HA 4TZBA 3IEMA 1ZNBA 3IELA 4C1EA 5EVKA 4HKYA 3ZQ4A 4ZNBA 2BMIA 4PVOA 5A5ZA 2P4ZA 5ACUA 5A87A 3I14A 5AEBA 2Q9UA 2YNTA 1A7TA 1P9EA 2P97A 5EVDA 3IDZA 1WUOA 4AV7A 1VMEA 3I15A 2QINA 2NYPA 4EYLA 2BC2A 3JXPA 4F6ZA 5LMCA 1KO3A 1MQOA 1BC2A 1HLKA 5FQCA 2FU9A 4AD9A 2BTNA 4V0HA 1ZKPA 3DHCA 2ZO4A 2CG2A 4C1FA 5ACWA 3BK1A 2Y8BA 1JJTA 1DXKA 4HL1A 3SFPA 3IE2A 3IOFA 4Z7RA 3SBLA 2YCBA 4J5HA 1M2XA 2AIOA 3Q6VA 3ZWFA 5AHRA 2CG3A 2Q0IA 5EV8A 2BG2A 2ZWRA 2BG6A 3AJ3A 2ZNBA 3F9OA 4D1VA 4PVTA 4NURA 1QH3A 5LLDA 2I7TA 4TZEA 2OHHA 4J5FA 5EHTA 2FU7A 4RAMA 4XWTA 3T3OA 2QDSA 3I0VA 4AWYB 4Z6XA 2YNUA 4C1CA 3X2ZA 3T9MA 3ADRA 4ZO3A 4NQ2A 2NZFA 5AJLA 5LCHA 1YCHA 4WD6A 4Z5YA 2BG7A 1K07A 3SD9A 4YSBA 2FU6A 5HIOA 2WYMC 2YHEA 4ZO2A 4KEPA 4XWWA 1VGNA 4GYUA 2CBNA 1X8IA 3PG4A 2WYLA 4D1WA 4B87A 3L6NA 4RAWA 5ACTA 1WRAA 3KNSA 2WRSA 4EXYA 5AXRA 4DILA 2CFZA 5AHOA 2CFUA 1DDKA 1A8TA 4EYBA 2GCUA 4Z60A 2Q0JA 1JT1A 4H0DA 4GCWA 3FAIA 1SMLA 5AIJA 4NQ6A 4HL2A 5EW0A 2NXAA 4RL0A 5EVBA 1KR3A 2WYMA 4D1UA 4EY2A 5KILA 3MD7A 3AF6A 2BIBA 4TYTA 1X8HA 4O98A 2E7YA 4C1DA 1E5DA 2QJSA 4TZFA 4UA4A 2NZEA 5EH9A 3I11A 4GYQA 5HH4A 2BFLA 5LM6A 5ACPA 5K0WA 2BFZB 3PY6A 5HIPA 4BP0A 5FQAA 2P1EA 1YCGA 5B3RA 2BR6A 4YSKA 3FCZA 2M5CA 5ACQA 3ZNBA 5ACXA 4UBQA 2FU8A 3RKJA 3TP9A 1XM8A 4NQ4A 4BZ3A 1X8GA 2H6AA 3SPUA 4C1HA 5KIKA 4Z5ZA 4YSLA 3H3EA 3R2UA 5AXOA 3QH8A 4UAMA 3IE1A 4JO0A 2BFZA 2FHXB 2I7XA 3PY5A 3BK2A 5EWAA 4RBSA 3WXCA 3DHBA 2A7MA 2DKFA 3S0ZA 5B1UA 2GKLA 2VW8A 1YCFA 3LVZA 4NQ5A 5K4NA 3IE0A 4XUKA 1VJNA 3VPEA 2GMNA 5HH5A 2YNVA 4DIKA 5K4KA 4P62A 5HISA 2QEDA 2BGAA 4AX0B 2M5DA 1XTOA 1BMCA 3BC2A 3KL7A 5HH6A 3ESHA 4AX1B 2YNWA 4EXSA 2YZ3A 2Y8AA 1ZTCA 2FHXA 4AXHA 3G1PA 4C1GA 2BG8A 4RL2A 2I7VA 2AZ4A 3IEKA 5A0VA 5FQBA 2ZZIA 4D02A 5LCAA 1JJEA 1BVTA 3X2YA 3T3NA 1L9YA 2FM6A 4PDXA 2XR1A 2P18A 5ACSA 4UWPB 3X2XA 3IOGA 4FEKA 1DD6A 3A4YA 2GFKA 2Q42A 3SRXA 5B15A 4ZEJA 4FR7A 3RPCA 5LSCA 5HIQA 1Y44A 5A23A 2FK6A 4TYFA 3X30A 1KO2A
chains in the Genus database with same CATH topology
5ACVA 5IQKA 3I13A 5K4MA 2Y87A 4EYFA 3ZR9A 2YNVB 4FSBA 4UWOB 4D1TA 5A0TA 5LE1A 3KNRA 2BFKA 4CHLA 4AWZA 2DOOA 2XF4A 1QH5A 4KEQA 2OHIA 2YNTB 4Z67A 5AYAA 4UWSB 3BV6A 5LCFA 2UYXA 3DH8A 2BG8B 2R2DA 1WUPA 3P2UA 3RKKA 4UWRB 2HB9A 5EV6A 5ACRA 4U4LA 3SW3A 2QDTA 2WHGA 3AF5A 4RM5A 2OHJA 3DHAA 5LS3A 5DPXA 2GFJA 4C09A 4EFZA 4TZ9A 4LE6A 3VQZA 1WW1A 4F6HA 4TZBA 3IEMA 1ZNBA 3IELA 4C1EA 5EVKA 4HKYA 3ZQ4A 4ZNBA 2BMIA 4PVOA 5A5ZA 2P4ZA 5ACUA 5A87A 3I14A 5AEBA 2Q9UA 2YNTA 1A7TA 1P9EA 2P97A 5EVDA 3IDZA 1WUOA 1VMEA 3I15A 2QINA 2NYPA 4EYLA 2BC2A 3JXPA 4F6ZA 5LMCA 1KO3A 1MQOA 1BC2A 1HLKA 5FQCA 2FU9A 4AD9A 2BTNA 4V0HA 1ZKPA 3DHCA 2ZO4A 4C1FA 5ACWA 3BK1A 2Y8BA 1JJTA 1DXKA 4HL1A 3SFPA 3IE2A 3IOFA 4Z7RA 3SBLA 2YCBA 4J5HA 1M2XA 2AIOA 3Q6VA 3ZWFA 5AHRA 2Q0IA 5EV8A 2BG2A 2ZWRA 2BG6A 3AJ3A 2ZNBA 3F9OA 4D1VA 4PVTA 1QH3A 5LLDA 2I7TA 4TZEA 2OHHA 4J5FA 5EHTA 2FU7A 4RAMA 4XWTA 3T3OA 2QDSA 3I0VA 4AWYB 4Z6XA 2YNUA 4C1CA 3X2ZA 3T9MA 3ADRA 4ZO3A 4NQ2A 2NZFA 5LCHA 1YCHA 4WD6A 4Z5YA 2BG7A 1K07A 3SD9A 4YSBA 2FU6A 5HIOA 2WYMC 4ZO2A 4KEPA 4XWWA 1VGNA 4GYUA 2CBNA 1X8IA 3PG4A 2WYLA 4D1WA 4B87A 3L6NA 4RAWA 5ACTA 1WRAA 3KNSA 2WRSA 4EXYA 5AXRA 4DILA 5AHOA 1DDKA 1A8TA 4EYBA 2GCUA 4Z60A 2Q0JA 1JT1A 4H0DA 4GCWA 3FAIA 1SMLA 4NQ6A 4HL2A 5EW0A 2NXAA 4RL0A 5EVBA 1KR3A 2WYMA 4D1UA 4EY2A 5KILA 3MD7A 3AF6A 2BIBA 4TYTA 1X8HA 4O98A 2E7YA 4C1DA 1E5DA 2QJSA 4TZFA 4UA4A 2NZEA 5EH9A 3I11A 4GYQA 5HH4A 2BFLA 5LM6A 5ACPA 5K0WA 2BFZB 3PY6A 5HIPA 4BP0A 5FQAA 2P1EA 1YCGA 5B3RA 2BR6A 4YSKA 3FCZA 2M5CA 5ACQA 3ZNBA 5ACXA 4UBQA 2FU8A 3RKJA 3TP9A 1XM8A 4NQ4A 4BZ3A 1X8GA 2H6AA 3SPUA 4C1HA 5KIKA 4Z5ZA 4YSLA 3H3EA 3R2UA 5AXOA 3QH8A 4UAMA 3IE1A 4JO0A 2BFZA 2FHXB 2I7XA 3PY5A 3BK2A 5EWAA 4RBSA 3WXCA 3DHBA 2A7MA 2DKFA 3S0ZA 5B1UA 2GKLA 2VW8A 1YCFA 3LVZA 4NQ5A 5K4NA 3IE0A 4XUKA 1VJNA 3VPEA 2GMNA 5HH5A 2YNVA 4DIKA 5K4KA 4P62A 5HISA 2QEDA 2BGAA 4AX0B 2M5DA 1XTOA 1BMCA 3BC2A 3KL7A 5HH6A 3ESHA 4AX1B 2YNWA 4EXSA 2YZ3A 2Y8AA 1ZTCA 2FHXA 3G1PA 4C1GA 2BG8A 4RL2A 2I7VA 2AZ4A 3IEKA 5A0VA 5FQBA 2ZZIA 4D02A 5LCAA 1JJEA 1BVTA 3X2YA 3T3NA 1L9YA 2FM6A 2XR1A 2P18A 5ACSA 4UWPB 3X2XA 3IOGA 4FEKA 1DD6A 3A4YA 2GFKA 2Q42A 3SRXA 5B15A 4ZEJA 4FR7A 3RPCA 5LSCA 5HIQA 1Y44A 2FK6A 4TYFA 3X30A 1KO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ACV A;  5IQK A;  3I13 A;  5K4M A;  2Y87 A;  4EYF A;  3ZR9 A;  2YNV B;  4FSB A;  4UWO B;  4D1T A;  5A0T A;  5LE1 A;  3KNR A;  2BFK A;  4CHL A;  4AWZ A;  2DOO A;  2XF4 A;  1QH5 A;  4KEQ A;  2OHI A;  2YNT B;  4Z67 A;  5AYA A;  4UWS B;  3BV6 A;  5LCF A;  2UYX A;  3DH8 A;  2BG8 B;  2R2D A;  1WUP A;  3P2U A;  3RKK A;  4UWR B;  2HB9 A;  5EV6 A;  5ACR A;  4U4L A;  3SW3 A;  2QDT A;  2WHG A;  3AF5 A;  4RM5 A;  2OHJ A;  3DHA A;  5LS3 A;  5DPX A;  2GFJ A;  4C09 A;  4EFZ A;  4TZ9 A;  4LE6 A;  3VQZ A;  1WW1 A;  4F6H A;  4TZB A;  3IEM A;  1ZNB A;  3IEL A;  4C1E A;  5EVK A;  4HKY A;  3ZQ4 A;  4ZNB A;  2BMI A;  4PVO A;  5A5Z A;  2P4Z A;  5ACU A;  5A87 A;  3I14 A;  5AEB A;  2Q9U A;  2YNT A;  1A7T A;  1P9E A;  2P97 A;  5EVD A;  3IDZ A;  1WUO A;  1VME A;  3I15 A;  2QIN A;  2NYP A;  4EYL A;  2BC2 A;  3JXP A;  4F6Z A;  5LMC A;  1KO3 A;  1MQO A;  1BC2 A;  1HLK A;  5FQC A;  2FU9 A;  4AD9 A;  2BTN A;  4V0H A;  1ZKP A;  3DHC A;  2ZO4 A;  4C1F A;  5ACW A;  3BK1 A;  2Y8B A;  1JJT A;  1DXK A;  4HL1 A;  3SFP A;  3IE2 A;  3IOF A;  4Z7R A;  3SBL A;  2YCB A;  4J5H A;  1M2X A;  2AIO A;  3Q6V A;  3ZWF A;  5AHR A;  2Q0I A;  5EV8 A;  2BG2 A;  2ZWR A;  2BG6 A;  3AJ3 A;  2ZNB A;  3F9O A;  4D1V A;  4PVT A;  1QH3 A;  5LLD A;  2I7T A;  4TZE A;  2OHH A;  4J5F A;  5EHT A;  2FU7 A;  4RAM A;  4XWT A;  3T3O A;  2QDS A;  3I0V A;  4AWY B;  4Z6X A;  2YNU A;  4C1C A;  3X2Z A;  3T9M A;  3ADR A;  4ZO3 A;  4NQ2 A;  2NZF A;  5LCH A;  1YCH A;  4WD6 A;  4Z5Y A;  2BG7 A;  1K07 A;  3SD9 A;  4YSB A;  2FU6 A;  5HIO A;  2WYM C;  4ZO2 A;  4KEP A;  4XWW A;  1VGN A;  4GYU A;  2CBN A;  1X8I A;  3PG4 A;  2WYL A;  4D1W A;  4B87 A;  3L6N A;  4RAW A;  5ACT A;  1WRA A;  3KNS A;  2WRS A;  4EXY A;  5AXR A;  4DIL A;  5AHO A;  1DDK A;  1A8T A;  4EYB A;  2GCU A;  4Z60 A;  2Q0J A;  1JT1 A;  4H0D A;  4GCW A;  3FAI A;  1SML A;  4NQ6 A;  4HL2 A;  5EW0 A;  2NXA A;  4RL0 A;  5EVB A;  1KR3 A;  2WYM A;  4D1U A;  4EY2 A;  5KIL A;  3MD7 A;  3AF6 A;  2BIB A;  4TYT A;  1X8H A;  4O98 A;  2E7Y A;  4C1D A;  1E5D A;  2QJS A;  4TZF A;  4UA4 A;  2NZE A;  5EH9 A;  3I11 A;  4GYQ A;  5HH4 A;  2BFL A;  5LM6 A;  5ACP A;  5K0W A;  2BFZ B;  3PY6 A;  5HIP A;  4BP0 A;  5FQA A;  2P1E A;  1YCG A;  5B3R A;  2BR6 A;  4YSK A;  3FCZ A;  2M5C A;  5ACQ A;  3ZNB A;  5ACX A;  4UBQ A;  2FU8 A;  3RKJ A;  3TP9 A;  1XM8 A;  4NQ4 A;  4BZ3 A;  1X8G A;  2H6A A;  3SPU A;  4C1H A;  5KIK A;  4Z5Z A;  4YSL A;  3H3E A;  3R2U A;  5AXO A;  3QH8 A;  4UAM A;  3IE1 A;  4JO0 A;  2BFZ A;  2FHX B;  2I7X A;  3PY5 A;  3BK2 A;  5EWA A;  4RBS A;  3WXC A;  3DHB A;  2A7M A;  2DKF A;  3S0Z A;  5B1U A;  2GKL A;  2VW8 A;  1YCF A;  3LVZ A;  4NQ5 A;  5K4N A;  3IE0 A;  4XUK A;  1VJN A;  3VPE A;  2GMN A;  5HH5 A;  2YNV A;  4DIK A;  5K4K A;  4P62 A;  5HIS A;  2QED A;  2BGA A;  4AX0 B;  2M5D A;  1XTO A;  1BMC A;  3BC2 A;  3KL7 A;  5HH6 A;  3ESH A;  4AX1 B;  2YNW A;  4EXS A;  2YZ3 A;  2Y8A A;  1ZTC A;  2FHX A;  3G1P A;  4C1G A;  2BG8 A;  4RL2 A;  2I7V A;  2AZ4 A;  3IEK A;  5A0V A;  5FQB A;  2ZZI A;  4D02 A;  5LCA A;  1JJE A;  1BVT A;  3X2Y A;  3T3N A;  1L9Y A;  2FM6 A;  2XR1 A;  2P18 A;  5ACS A;  4UWP B;  3X2X A;  3IOG A;  4FEK A;  1DD6 A;  3A4Y A;  2GFK A;  2Q42 A;  3SRX A;  5B15 A;  4ZEJ A;  4FR7 A;  3RPC A;  5LSC A;  5HIQ A;  1Y44 A;  2FK6 A;  4TYF A;  3X30 A;  1KO2 A; 
#chains in the Genus database with same CATH topology
 5ACV A;  5IQK A;  3I13 A;  5K4M A;  2Y87 A;  4EYF A;  3ZR9 A;  2YNV B;  4FSB A;  4UWO B;  4D1T A;  5A0T A;  5LE1 A;  3KNR A;  2BFK A;  4CHL A;  4AWZ A;  2DOO A;  2XF4 A;  1QH5 A;  4KEQ A;  2OHI A;  2YNT B;  4Z67 A;  5AYA A;  4UWS B;  3BV6 A;  5LCF A;  2UYX A;  3DH8 A;  2BG8 B;  2R2D A;  1WUP A;  3P2U A;  3RKK A;  4UWR B;  2HB9 A;  5EV6 A;  5ACR A;  4U4L A;  3SW3 A;  2QDT A;  2WHG A;  3AF5 A;  4RM5 A;  2OHJ A;  3DHA A;  5LS3 A;  5DPX A;  2GFJ A;  4C09 A;  4EFZ A;  4TZ9 A;  4LE6 A;  3VQZ A;  1WW1 A;  4F6H A;  4TZB A;  3IEM A;  1ZNB A;  3IEL A;  4C1E A;  5EVK A;  4HKY A;  3ZQ4 A;  4ZNB A;  2BMI A;  4PVO A;  5A5Z A;  2P4Z A;  5ACU A;  5A87 A;  3I14 A;  5AEB A;  2Q9U A;  2YNT A;  1A7T A;  1P9E A;  2P97 A;  5EVD A;  3IDZ A;  1WUO A;  4AV7 A;  1VME A;  3I15 A;  2QIN A;  2NYP A;  4EYL A;  2BC2 A;  3JXP A;  4F6Z A;  5LMC A;  1KO3 A;  1MQO A;  1BC2 A;  1HLK A;  5FQC A;  2FU9 A;  4AD9 A;  2BTN A;  4V0H A;  1ZKP A;  3DHC A;  2ZO4 A;  2CG2 A;  4C1F A;  5ACW A;  3BK1 A;  2Y8B A;  1JJT A;  1DXK A;  4HL1 A;  3SFP A;  3IE2 A;  3IOF A;  4Z7R A;  3SBL A;  2YCB A;  4J5H A;  1M2X A;  2AIO A;  3Q6V A;  3ZWF A;  5AHR A;  2CG3 A;  2Q0I A;  5EV8 A;  2BG2 A;  2ZWR A;  2BG6 A;  3AJ3 A;  2ZNB A;  3F9O A;  4D1V A;  4PVT A;  4NUR A;  1QH3 A;  5LLD A;  2I7T A;  4TZE A;  2OHH A;  4J5F A;  5EHT A;  2FU7 A;  4RAM A;  4XWT A;  3T3O A;  2QDS A;  3I0V A;  4AWY B;  4Z6X A;  2YNU A;  4C1C A;  3X2Z A;  3T9M A;  3ADR A;  4ZO3 A;  4NQ2 A;  2NZF A;  5AJL A;  5LCH A;  1YCH A;  4WD6 A;  4Z5Y A;  2BG7 A;  1K07 A;  3SD9 A;  4YSB A;  2FU6 A;  5HIO A;  2WYM C;  2YHE A;  4ZO2 A;  4KEP A;  4XWW A;  1VGN A;  4GYU A;  2CBN A;  1X8I A;  3PG4 A;  2WYL A;  4D1W A;  4B87 A;  3L6N A;  4RAW A;  5ACT A;  1WRA A;  3KNS A;  2WRS A;  4EXY A;  5AXR A;  4DIL A;  2CFZ A;  5AHO A;  2CFU A;  1DDK A;  1A8T A;  4EYB A;  2GCU A;  4Z60 A;  2Q0J A;  1JT1 A;  4H0D A;  4GCW A;  3FAI A;  1SML A;  5AIJ A;  4NQ6 A;  4HL2 A;  5EW0 A;  2NXA A;  4RL0 A;  5EVB A;  1KR3 A;  2WYM A;  4D1U A;  4EY2 A;  5KIL A;  3MD7 A;  3AF6 A;  2BIB A;  4TYT A;  1X8H A;  4O98 A;  2E7Y A;  4C1D A;  1E5D A;  2QJS A;  4TZF A;  4UA4 A;  2NZE A;  5EH9 A;  3I11 A;  4GYQ A;  5HH4 A;  2BFL A;  5LM6 A;  5ACP A;  5K0W A;  2BFZ B;  3PY6 A;  5HIP A;  4BP0 A;  5FQA A;  2P1E A;  1YCG A;  5B3R A;  2BR6 A;  4YSK A;  3FCZ A;  2M5C A;  5ACQ A;  3ZNB A;  5ACX A;  4UBQ A;  2FU8 A;  3RKJ A;  3TP9 A;  1XM8 A;  4NQ4 A;  4BZ3 A;  1X8G A;  2H6A A;  3SPU A;  4C1H A;  5KIK A;  4Z5Z A;  4YSL A;  3H3E A;  3R2U A;  5AXO A;  3QH8 A;  4UAM A;  3IE1 A;  4JO0 A;  2BFZ A;  2FHX B;  2I7X A;  3PY5 A;  3BK2 A;  5EWA A;  4RBS A;  3WXC A;  3DHB A;  2A7M A;  2DKF A;  3S0Z A;  5B1U A;  2GKL A;  2VW8 A;  1YCF A;  3LVZ A;  4NQ5 A;  5K4N A;  3IE0 A;  4XUK A;  1VJN A;  3VPE A;  2GMN A;  5HH5 A;  2YNV A;  4DIK A;  5K4K A;  4P62 A;  5HIS A;  2QED A;  2BGA A;  4AX0 B;  2M5D A;  1XTO A;  1BMC A;  3BC2 A;  3KL7 A;  5HH6 A;  3ESH A;  4AX1 B;  2YNW A;  4EXS A;  2YZ3 A;  2Y8A A;  1ZTC A;  2FHX A;  4AXH A;  3G1P A;  4C1G A;  2BG8 A;  4RL2 A;  2I7V A;  2AZ4 A;  3IEK A;  5A0V A;  5FQB A;  2ZZI A;  4D02 A;  5LCA A;  1JJE A;  1BVT A;  3X2Y A;  3T3N A;  1L9Y A;  2FM6 A;  4PDX A;  2XR1 A;  2P18 A;  5ACS A;  4UWP B;  3X2X A;  3IOG A;  4FEK A;  1DD6 A;  3A4Y A;  2GFK A;  2Q42 A;  3SRX A;  5B15 A;  4ZEJ A;  4FR7 A;  3RPC A;  5LSC A;  5HIQ A;  1Y44 A;  5A23 A;  2FK6 A;  4TYF A;  3X30 A;  1KO2 A; 
#chains in the Genus database with same CATH homology
 5ACV A;  5IQK A;  3I13 A;  5K4M A;  2Y87 A;  4EYF A;  3ZR9 A;  2YNV B;  4FSB A;  4UWO B;  4D1T A;  5A0T A;  5LE1 A;  3KNR A;  2BFK A;  4CHL A;  4AWZ A;  2DOO A;  2XF4 A;  1QH5 A;  4KEQ A;  2OHI A;  2YNT B;  4Z67 A;  5AYA A;  4UWS B;  3BV6 A;  5LCF A;  2UYX A;  3DH8 A;  2BG8 B;  2R2D A;  1WUP A;  3P2U A;  3RKK A;  4UWR B;  2HB9 A;  5EV6 A;  5ACR A;  4U4L A;  3SW3 A;  2QDT A;  2WHG A;  3AF5 A;  4RM5 A;  2OHJ A;  3DHA A;  5LS3 A;  5DPX A;  2GFJ A;  4C09 A;  4EFZ A;  4TZ9 A;  4LE6 A;  3VQZ A;  1WW1 A;  4F6H A;  4TZB A;  3IEM A;  1ZNB A;  3IEL A;  4C1E A;  5EVK A;  4HKY A;  3ZQ4 A;  4ZNB A;  2BMI A;  4PVO A;  5A5Z A;  2P4Z A;  5ACU A;  5A87 A;  3I14 A;  5AEB A;  2Q9U A;  2YNT A;  1A7T A;  1P9E A;  2P97 A;  5EVD A;  3IDZ A;  1WUO A;  1VME A;  3I15 A;  2QIN A;  2NYP A;  4EYL A;  2BC2 A;  3JXP A;  4F6Z A;  5LMC A;  1KO3 A;  1MQO A;  1BC2 A;  1HLK A;  5FQC A;  2FU9 A;  4AD9 A;  2BTN A;  4V0H A;  1ZKP A;  3DHC A;  2ZO4 A;  4C1F A;  5ACW A;  3BK1 A;  2Y8B A;  1JJT A;  1DXK A;  4HL1 A;  3SFP A;  3IE2 A;  3IOF A;  4Z7R A;  3SBL A;  2YCB A;  4J5H A;  1M2X A;  2AIO A;  3Q6V A;  3ZWF A;  5AHR A;  2Q0I A;  5EV8 A;  2BG2 A;  2ZWR A;  2BG6 A;  3AJ3 A;  2ZNB A;  3F9O A;  4D1V A;  4PVT A;  1QH3 A;  5LLD A;  2I7T A;  4TZE A;  2OHH A;  4J5F A;  5EHT A;  2FU7 A;  4RAM A;  4XWT A;  3T3O A;  2QDS A;  3I0V A;  4AWY B;  4Z6X A;  2YNU A;  4C1C A;  3X2Z A;  3T9M A;  3ADR A;  4ZO3 A;  4NQ2 A;  2NZF A;  5LCH A;  1YCH A;  4WD6 A;  4Z5Y A;  2BG7 A;  1K07 A;  3SD9 A;  4YSB A;  2FU6 A;  5HIO A;  2WYM C;  4ZO2 A;  4KEP A;  4XWW A;  1VGN A;  4GYU A;  2CBN A;  1X8I A;  3PG4 A;  2WYL A;  4D1W A;  4B87 A;  3L6N A;  4RAW A;  5ACT A;  1WRA A;  3KNS A;  2WRS A;  4EXY A;  5AXR A;  4DIL A;  5AHO A;  1DDK A;  1A8T A;  4EYB A;  2GCU A;  4Z60 A;  2Q0J A;  1JT1 A;  4H0D A;  4GCW A;  3FAI A;  1SML A;  4NQ6 A;  4HL2 A;  5EW0 A;  2NXA A;  4RL0 A;  5EVB A;  1KR3 A;  2WYM A;  4D1U A;  4EY2 A;  5KIL A;  3MD7 A;  3AF6 A;  2BIB A;  4TYT A;  1X8H A;  4O98 A;  2E7Y A;  4C1D A;  1E5D A;  2QJS A;  4TZF A;  4UA4 A;  2NZE A;  5EH9 A;  3I11 A;  4GYQ A;  5HH4 A;  2BFL A;  5LM6 A;  5ACP A;  5K0W A;  2BFZ B;  3PY6 A;  5HIP A;  4BP0 A;  5FQA A;  2P1E A;  1YCG A;  5B3R A;  2BR6 A;  4YSK A;  3FCZ A;  2M5C A;  5ACQ A;  3ZNB A;  5ACX A;  4UBQ A;  2FU8 A;  3RKJ A;  3TP9 A;  1XM8 A;  4NQ4 A;  4BZ3 A;  1X8G A;  2H6A A;  3SPU A;  4C1H A;  5KIK A;  4Z5Z A;  4YSL A;  3H3E A;  3R2U A;  5AXO A;  3QH8 A;  4UAM A;  3IE1 A;  4JO0 A;  2BFZ A;  2FHX B;  2I7X A;  3PY5 A;  3BK2 A;  5EWA A;  4RBS A;  3WXC A;  3DHB A;  2A7M A;  2DKF A;  3S0Z A;  5B1U A;  2GKL A;  2VW8 A;  1YCF A;  3LVZ A;  4NQ5 A;  5K4N A;  3IE0 A;  4XUK A;  1VJN A;  3VPE A;  2GMN A;  5HH5 A;  2YNV A;  4DIK A;  5K4K A;  4P62 A;  5HIS A;  2QED A;  2BGA A;  4AX0 B;  2M5D A;  1XTO A;  1BMC A;  3BC2 A;  3KL7 A;  5HH6 A;  3ESH A;  4AX1 B;  2YNW A;  4EXS A;  2YZ3 A;  2Y8A A;  1ZTC A;  2FHX A;  3G1P A;  4C1G A;  2BG8 A;  4RL2 A;  2I7V A;  2AZ4 A;  3IEK A;  5A0V A;  5FQB A;  2ZZI A;  4D02 A;  5LCA A;  1JJE A;  1BVT A;  3X2Y A;  3T3N A;  1L9Y A;  2FM6 A;  2XR1 A;  2P18 A;  5ACS A;  4UWP B;  3X2X A;  3IOG A;  4FEK A;  1DD6 A;  3A4Y A;  2GFK A;  2Q42 A;  3SRX A;  5B15 A;  4ZEJ A;  4FR7 A;  3RPC A;  5LSC A;  5HIQ A;  1Y44 A;  2FK6 A;  4TYF A;  3X30 A;  1KO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...