4AD9A

Crystal structure of human lactb2.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
288
structure length
288
Chain Sequence
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE-LIKE PROTEIN 2
total genus 86
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF17778 BLACT_WH Beta-lactamase associated winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ad9A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4ad9A01
2VE8A 4HKYA 1YLFA 3R6SA 4EJWA 4QWQA 1FYLA 2XVCA 3RKJA 1YFHA 1U2WA 3IDZA 5BMZA 2ESNA 4D1VA 1W7PB 1I27A 1MJBA 1TLHB 1X8HA 2P7VB 5DV5A 2ZO4A 1R23A 5LCFA 1ZHFA 5B15A 1YS7A 3KEQA 2PMHA 3MFKA 4ZO3A 2ZCWA 2A69F 5JVTA 5HIQA 2FRHA 1R58A 1J59A 2NYPA 3REOA 3ZQ4A 2BG8A 4EJTA 3HRSA 4D1TA 1ON2A 4KFCA 3ZMUA 3ERED 2OZ6A 4H0EA 2F5EA 1IN7A 4UVBA 3CUQB 2BTNA 3BWGA 3C7JA 4CYDA 4FR7A 3W6JB 2IPQX 5EEGA 1OYWA 4DNCA 3I14A 3CUQC 3DEUA 2I7TA 1IN4A 4OOIA 2RKHA 3IOGA 1K78A 2YNTB 1WRJA 2QEDA 3ML6A 1IUYA 3RIRA 4KN7X 3Q9VA 3VFZA 2K02A 4TZ9A 3Q9SA 1B9MA 3F3XA 2KJBA 2Z33A 4D1UA 1SMLA 3PG4A 3IC7A 4G8XA 3HSFA 2FHXA 1Z6TA 5CYVA 1ULYA 1SFUA 1KU2A 3M9AA 4A5MA 4PVOA 1ZRFA 1FBQA 4XRFA 1IXCA 4GYIA 4NQ2A 1KU7A 1ZGAA 4MEXF 1ODDA 3IL2A 2QQ9A 4PZJA 3TOAA 2YCBA 4GYQA 3ZMSA 2P5VA 3H3UA 2QINA 1IN6A 5E1WA 3F72A 2JZYA 3D5LA 4XSZF 1XD7A 4U0YA 1JJTA 4MEYF 3KP7A 5F64A 5DYMA 2HR3A 1ZLKA 4HF2A 1YW8A 5HLGA 2L4AA 2W25A 4A0XA 2I7VA 5E1XA 2M87A 2RQPA 1F5TA 5EW0A 2FU6A 4EXYA 1T39A 5E18F 2DTRA 3N97A 4OIPF 4WXHA 1R5GA 1YYVA 4N0BA 2DO7A 2OAZA 1ZRCA 2STWA 3J81K 3E6CC 5ERIA 1BOAA 4BAYA 1STZA 1ZNBA 5E20A 2AZ4A 3ABTA 3E6MA 4LG0A 5LHIA 1OYIA 2BR6A 2M5WA 5HDNA 5LCHA 2G7HA 2ELHA 2IA0A 2H6AA 2YNTA 4UBQA 1WSUA 5L3GA 1BJAA 2TDXA 4PDKA 4MTEA 5D6FA 4HDUA 2L3DA 4Y17A 2BFZA 5FQCA 1HSTA 5HLHA 1DPUA 2JTVA 2KIMA 1LVAA 1DPRA 2A7MA 4IF4A 3CUQA 1TW2A 3I11A 1KYZA 1BIAA 5AIQA 4IRIA 3E5QA 3X2ZA 4ZNBA 1L0OC 4JK1X 2Y87A 3F9OA 4LB6B 4RAMA 5L3CA 4YIFA 4R8HA 5JR3A 3DHAA 4JBAA 2YNVB 2DOOA 3K1NA 2Z5UA 1MDMB 3LVZA 1XGOA 5EV8A 5ILUA 5DPXA 3I59B 4CO8A 1ZTCA 5ACXA 3CO7C 2O03A 4BP0A 5EWAA 2ZMEA 2EA2A 1USTA 3QAHA 3SBLA 4EVIA 4C09A 4U88A 1BBYA 3L9FA 3LQRA 4M72A 2A6HF 2VT3A 3HUGA 3PY5A 4WCGA 5JHUA 4IRGA 1R22A 5K4NA 4UAMA 1T0FA 2BFKA 2HQRA 4GXOA 3I13A 4D1WA 3V4GA 4M6XA 2CSOA 4L0YB 5LLDA 3QPTA 1QGPA 4YSKA 2XASA 2GKLA 1B1BA 2PBIA 2LDUA 1WKMA 2K27A 2ZZIA 3I4PA 2L01A 1BI2A 1MJAA 4ASNA 2YU3A 4BH9A 3TQNA 1XGSA 5LGUA 1G4DA 1X3UA 3F8BA 1HXDA 1G3SA 3GFIA 2JSCA 3I64A 2R3SA 2G7UA 4HF0A 3JSOA 2X0LA 1IZ1A 4BYYA 5K1YA 1BMCA 3E97A 3X2YA 1S29A 4P55A 5J6XA 2XHKA 4G6QA 4UHTA 1XSVA 3GYHX 2R7DA 2E7XA 3MZYA 4RAZA 4MTDA 3AJ3A 3RJPA 2J5PA 4OIRF 2XR1A 3IRRA 1JXSA 4P62A 5FB2A 1OR7A 4RAYA 2HYGD 3HRTA 1S8NA 3IE1A 3IWZA 1OPCA 4A6DA 5BS6A 1U6GA 5JFRA 1BC8C 1WW1A 3KE2A 3DFGA 2M45A 1ZRDA 3F8FA 3M8FA 4RBSA 4HZFA 4AWZA 1MD0A 4EJOA 2C6YA 2P5LC 2HOEA 3VPEA 2Z99A 3OOPA 2MC3A 1Z6RA 5HS8A 1PP7U 2GZWA 3A4YA 3BPXA 3PQJA 1YO5C 2D45A 2ACJA 2NXAA 2FSWA 2AIOA 2OBPA 2F5CA 3FMSA 4A0YA 1PUEE 1O3RA 4OMYA 4BQAA 4RB1A 4KIFA 3DQVC 2YR2A 1TTYA 4RB0A 5DUIA 2QVOA 3KP5A 1W4MA 2EFWA 4RB2C 1BN5A 3KP6A 4LMYA 5A0VA 5H6RA 1XSXA 4JQFA 2Q2EA 3H92A 2UXNA 4LJZF 2RN7A 5F6FA 1KA8A 4F6HA 2PEXA 5JI6A 1Z91A 4ENJA 5CLSA 2QUFA 1Z9CA 4GYUA 3CJNA 2FOKA 3V7CA 4TZEA 3J80Z 1I1GA 2HZTA 2ESHA 3F6VA 1LDDA 3X2XA 4V0HA 1FLIA 3K1PA 2EV6A 3VOEA 3FHZA 2V9VA 5KIKA 1C0WA 2I7XA 4HOBA 1U78A 4CXFA 3HYIA 5AXOA 1ZH5A 2STTA 5LS3A 1DP7P 1YTYA 5BOXA 2GA2A 5HIPA 4MGRA 5ICEA 3GEZA 3RKXA 1B6AA 4M71A 3VEPA 2P7CB 3PY6A 5ICFA 3KP4A 1SFXA 1F4KA 3EETA 3GZ5A 2MH2A 1Y0UA 3SRXA 1P4WA 5D8LB 3R60A 2QYOA 3T9MA 5ED4A 2XIGA 1BVTA 3BK1A 4BHPA 1HSJA 3G3ZA 3TO9A 4ZEJA 4KA4A 4G6DA 3TP9A 2FBHA 5FFZA 4KMUX 3VB2A 3TDZC 3U9GA 4KT5C 5CVVA 2DQLA 3O3KA 2CYYA 5TJJA 2GMNA 4M9XA 2BG6A 4M73A 1XGMA 3V7SA 2GAUA 2FBKA 5L3DA 4ON0A 1D8KA 2JT1A 3WU1B 1Q1HA 4NQ4A 3F8CA 3G73A 4RGSA 4GGGA 1RUNA 1VJNA 1VGNA 4BHCA 3WE2A 1ZAOA 2XAJA 3M7GA 1MJ9A 1IW7F 2DBBA 3CUOA 3GXOA 3GZ6A 3K9TA 5D5WB 4WXCA 2FMLA 3T0YA 5ICGA 4PCQA 3LA7A 3ZWFA 5LMCA 4XLNF 4ENMA 3WU0A 3J81Z 1J75A 2NYXA 4I98B 2E7YA 3S0ZA 2ZNYA 5HS7A 4M74A 2HKXA 3TGNA 1QPMA 2XAHA 2QWWA 3HIFA 2FM6A 3E6DA 4U0WA 4OIQF 5HIOA 2IP2A 4N9HA 2W85A 1P2FA 1QNTA 4HX8A 2K7LA 1HKSA 3G1PA 3QP6A 1ZG3A 4U0VA 4LFUA 4A12A 3IKTA 1T38A 4GYGA 1S6LA 4HV5A 5CVUA 2ZWRA 5ACWA 5LEKA 4BNCA 2WWYA 1FWZA 2YPRA 4A0ZA 5ILSA 3BOQA 2XAQA 4Z60A 2UWMA 3LA2A 3K0LA 2Z9OA 2MLGA 3RTRA 4IRHA 5K0WA 1XCVA 1B4AA 1XDUA 2LF8A 1FY7A 1YS6A 2DFIA 3DKWA 1E5DA 3HRUA 3K69A 3BC2A 1MZBA 2NZFA 1YG2A 1REPC 6PAXA 1O3TA 2NNYA 2O0YA 3MD7A 5ACVA 4MQ9F 1K7AA 1W7PA 3L7WA 4NQ6A 4I2OA 4WX9A 3FZVA 2WYLA 4A2UA 1I6XA 1QO0D 3BZ6A 5LRRA 4C1GA 2P4ZA 4RGXA 2OU2A 1FNNA 3I15A 4MHGA 1LEAA 3DPLC 1R00A 4KN4X 4M9ZA 1O7FA 2PQ8A 1OKRA 4ESBA 2CW0F 3EUHA 2VC1A 2EV0A 3LWFA 4IHSA 5FO5A 4FX4A 3V8KA 2XKPA 4OIOF 3H3ZA 2QENA 1FSEA 1BIBA 1ZYRF 2KIUA 2QM3A 4RL0A 4HLYA 1T2KA 3EYYA 2Y75A 1ZREA 4TYFA 3QOPA 3AF5A 5HH4A 4O6JA 3NQOA 4PGGA 2P8TA 4HBLA 3IE2A 5DD8A 2VOOA 3RPCA 3GVAA 3PFIA 3WTWC 1K6OA 2HTSA 1JHHA 2EK5A 2JPBA 5J8CA 1DUXC 4YG2F 1FOKA 3FM3A 1W5TA 1TBXA 3JTHA 1HKQA 1MGTA 4U4LA 5DEQA 2P6TA 2PFBA 3U2RA 1YCFA 3OV8A 2RVCA 2OHIA 1ZKPA 5A2QZ 3FWEA 2B0LA 4Q47A 5K4KA 3I59A 3HSEA 1TQPA 1KQ9A 5CVJA 5K5RA 5EHTA 1TQIA 3LSTA 3WTUC 1D5VA 1M2XA 3TO7A 2ZMEB 3S2WA 4HDVA 4DILA 3CDHA 1A04A 4R1HA 3L6NA 4WD6A 3BJAA 2GFKA 3N4MA 2EFOA 4OMZA 3I71A 4EGZA 4HL1A 4AWXB 2QBYB 1KGSA 2EFPA 4HX7A 2OHHA 4JO0A 2M8EA 3GFLA 4M9SA 2AXLA 2D1HA 2BE5F 3SW3A 4HF1A 5E1ZB 3WE3A 3AF6A 1XM8A 1U5TA 3K1MA 4LD5A 5AXRA 3F22A 4GCVA 3FF5A 5AIPA 4LLLA 5ACSA 3GW2A 1JHFA 2VE9A 3WGGA 2XF4A 1O3SA 1IF1A 1AWCA 4LK1F 2GXGA 3LFKA 4YFNF 1KQ0A 2QJSA 2IW5A 3WODF 3P7NA 3EYIA 2P4WA 1AOYA 3ZNBA 1SD7A 1YW7A 3JAMK 4P9FA 4BXUA 1HBXG 4L9TA 1QQIA 1R1TA 4AIKA 4HA8A 4TZBA 1Y44A 4KYWA 5IT9K 3WTVC 2FMYA 1U3EM 4XUKA 2L54A 3QPHA 4TYTA 2O61A 3JSPA 1BI1A 2RV8A 2GA1A 2ZNBA 4XLPF 3MEXA 1EV7A 1FPQA 2DK8A 3SXYA 3ZN0A 4FHTA 4EYLA 1XCBA 2RC4A 3B02A 4C1FA 3BV6A 2GQQA 2FNPA 5IT3A 4KUMA 4HAMA 3RPUA 1YIOA 2ZBKA 5HLIA 3GLXA 4PVTA 3D0SA 4UWSB 5E17F 2LF7A 3RKWA 5HH5A 3F6OA 2WYMC 4RM5A 3L2CA 4I0AA 5ILVA 1LEBA 3CTAA 2VN2A 4A5NA 1UHMA 1R5HA 4NQWA 3TDUC 5K5QA 4AX0B 2V6CA 2NAZA 3DP7A 2XAGA 1G6NA 5AEBA 2BMIA 2K4BA 5D5VB 2Q9UA 4HQMA 2FQ3A 3SD9A 3WGHA 2CFXA 2PN6A 3VQZA 3H3EA 2O8XA 4PGHA 3KETA 2NZEA 5DUKA 2Z3YA 4ETSA 2ZNZA 3GUDA 2ZXJA 2H94A 4EFZA 2A61A 1XTOA 1BM9A 2LNBA 3IEMA 2P97A 1FZPB 3GFJA 3HTUA 5D4RA 2M5DA 1V4RA 3EQLF 1SMYF 1XDSA 1T6SA 3I0VA 4AIHA 2Y0MA 3DHCA 2NRAC 3GF2A 4KNYA 1A8TA 5FGMA 3RYPA 5AONA 1P4AA 2VODA 3U1DA 5LHGA 1T98A 4G7ZF 4ZYDA 2Q0IA 4IXAA 2H09A 5CJ9A 1HW2A 1E17A 4U7DA 4HLXA 1FP1D 4P5OA 5H20A 1TNTA 5K5OA 4CDGA 3P9CA 3DPTA 4XWTA 3ESHA 2A3SA 2OQRA 4ZZLA 3IE0A 3R2UA 1UHWA 5IT9Z 5E8GA 1TQMA 2VOPA 3GO5A 3PQKA 4G7HF 1ZG1A 4H0DA 3NRVA 4RAWA 4G7OF 4CHUA 2K4JA 4LLGF 1KO2A 3ELKA 2PJPA 4KIBA 1XN7A 2O3FA 5ACTA 1WI9A 2BBYA 3KL7A 5HDKA 5LSCA 2WRSA 2ADUA 2FU7A 3QU6A 1MDMA 4G9YA 4LE6A 4UV8A 4NHJA 1SMTA 3MCZA 4KIGA 5FD5A 2YZ3A 2RGVA 5CVIA 3GWZA 3HHHA 3ABUA 2GCUA 2DAOA 1IN8A 3C18A 4GCWA 3IKVA 4EQQA 1G3YA 2YSRA 1U8RA 3RI4A 1QH5A 5J8FA 2WV0A 2FBIA 2HEOA 2W84A 2F5FA 4ZYHA 2H6CA 2K86A 4L5JA 1EH8A 2HYFA 2F5DA 3WTXC 5BPDA 4IPAA 1YCGA 1L9YA 4L5IA 2RNJA 5FLXZ 1P9EA 2PI0A 3WTTC 1BC2A 3ISPA 3WXCA 1FP2A 4AVPA 5LHHA 4UVAA 3BY6A 5HDGA 2VC0A 5D8KB 5D6EA 3ULQB 5HVQC 1S7OA 2EFNA 1J5YA 1ZLJA 3ZPLA 1ONVA 2EFQA 2DPDA 5FFXA 2XUBA 1WRAA 2DK5A 5IQKA 2VBWA 1VTNC 2BYVE 4Y15A 5L3BA 1KYWA 5ACUA 1FT9A 3FAIA 4A6EA 2MD5A 5LRSA 3K2ZA 4HW0A 4Z67A 4ESFA 4YIIA 1W7PD 1SD4A 2FK6A 4R79A 1OMIA 3M8EA 5BPIA 2BG2A 2E7WA 5EVBA 2BG8B 2QDSA 4YSLA 1H0MA 1GVJA 3ZMTA 3KFWX 4DIKA 3J7AO 5A2QK 1Z7UA 1FC3A 3QRFF 4XWWA 2L4MA 1YQAA 1QH3A 5D4SA 2FNAA 5H6QA 1X8IA 3KLNA 2HDCA 2MBFA 5K4MA 2VW8A 1ZG5A 3DV8A 1IAWA 5LM6A 1WUPA 3DH8A 3FXUA 3E5XA 2EV5A 1FBSA 4YFKF 3RPQA 4I7HA 5FQBA 1RI7A 4UVCA 2E1NA 4UNOA 2P18A 3ZR9A 1GHCA 1KU3A 1R1VA 3KCCA 2BEOA 3T3OA 3BK2A 2KIFA 4LK0F 2J5OA 4J5HA 1UCRA 3LA3A 2HKOA 1SD5A 2MH9A 3NEUA 3Q6VA 4UWRB 3HOTA 4ESJA 3JTGA 2HWVA 3ZMZA 3BROA 1QZYA 3BJOA 4KEPA 4ZYEA 3V8JA 3FCZA 3SFZA 1HW1A 4ENNA 4BZ3A 4GO1A 2LSOA 4UV9A 1S3JA 3WTZA 4G94A 1I5ZA 4M6YA 3FXQA 5DCMB 3ROUA 2JPCA 2M1BA 5B3RA 5LEJA 1MKMA 3T8TA 3GX4X 2ISYA 1L3LA 4KMFA 4FEKA 5L3EA 4B87A 3CO6C 1P4XA 2P5KA 2LKPA 3MQ0A 1B59A 2DT5A 4CICA 3EDPA 2WC2A 4I02A 2BC2A 2VT2A 1JGSA 5AHOA 4CHLA 1U5TB 2IRFG 3LAPA 4C1CA 3L09A 4Z5YA 5ICCA 1LDKB 1IN5A 2KRFA 1Z1DA 1DD6A 1UFMA 3P9IA 3ZN1A 3IOFA 4ZYGA 2OHJA 2HTJA 1S7AA 3T3NA 2DI3A 2FA5A 4Z5ZA 2GIVA 2EA4A 1DDKA 1FSHA 4UUVA 1PP8F 3DHBA 2PG4A 4RS8A 4TZFA 2EB7A 1CF7B 4LG0B 2HGCA 3RYRA 4EM2A 1JJEA 2DLLA 3I58A 2AS5F 4EV0A 2M30A 2VXZA 3R4KA 2P1EA 3CLOA 1QBJA 2KJCA 1GXQA 4E70A 4RGUA 1H9TA 2ZKZA 2O6GE 4EYFA 4FX0A 5A0TA 5TRDA 2V1XA 3I0TA 4EM0B 5FD6A 4D0PA 5AYAA 3T5XA 1J2XA 5EVKA 4B8XA 1PDNC 2BFLA 2FU8A 3HTSB 1F9NA 4UXNA 2KKOA 1P92A 4K2EA 1E2XA 1USSA 4OU0A 2QLZA 1RZ4A 2Q0OA 3FXRA 1ZN2A 2A5YB 4L18B 1TNSA 4AX1B 3JAMZ 2Q42A 4Z7RA 2Q0JA 3F23A 2MLKA 4OINF 1A7TA 5ACRA 2YNVA 4QLCU 1HLKA 1J7KA 2QQBA 5F1RA 1CGPA 5EH9A 3BDDA 4YSBA 3COAC 4N9IA 2XAFA 5ACPA 4AWYB 3FM5A 4EY2A 2H6BA 4EGYA 5DDGA 1D3YA 5EV6A 5LE1A 4EMSA 4XSXF 4FT8A 1JE8A 1EH7A 3HSRA 3RKYA 3LAJA 1KU9A 2GWRA 2IA1A 2PLYA 4XBFA 1GXPA 3KNRA 3QH8A 1G3WA 3FX3A 3IELA 2Y8AA 2BGAA 4Q4ZF 2A6EF 1HKTA 2L02A 4LGWA 5E8IA 2FEZA 5KK1A 4AIJA 2HS5A 5L3FA 2VBXA 2VONA 2DQRA 4EJUA 1O57A 2DU9A 5ACQA 3I5UA 2W24A 1ZGJA 3O6BB 5DCMA 2XRNA 2DW4A 1XB4A 5D5UB 3SQNA 4EXSA 4Z6XA 4WF2A 1BC7C 2WTEA 4I09A 4O98A 1BI0A 4L9JA 2XGXA 5FLXK 4EYBA 1NHAA 2DPUA 5FQAA 1HQCA 2MA3A 3B73A 2IA2A 1R1UA 2OQGA 3QP5A 2EWNA 1XMKA 2OD5A 5KVRA 3WTYC 3JW4A 1CF7A 1WUOA 5B1UA 3SZTA 4P96A 5LGNA 1LNWA 4NQ5A 2UXXA 3HRMA 1FX7A 3HHGA 4YFXF 1XMAA 4WK8F 4NB5A 2PMUA 2YNUA 5EEHA 2GXBA 4KEQA 1FYMA 3GFMA 1J9IA 2FU4A 3KZZA 2BIBA 3QU3A 1IRFA 2DKFA 5HISA 3KLOA 2BGCA 5DD4A 3SPUA 2BV6A 5LLQA 5D5XB 3WGIA 1JT1A 2CQKA 1IXSB 4S04A 3X30A 4HL2A 4J5FA 4ENKA 1K07A 3KP3A 3T1BA 2IT0A 2HFHA 1Z05A 1FBUA 4BHBA 1B9NA 3R0JA 2E1CA 2FU9A 5HH6A 1V3FA 3JXPA 2FE3A 4IVNA 4AD9A 4IHTA 1KO3A 3MWMA 4D02A 3I54A 1LJ9A 2BFZB 1EH6A 4UWPB 3MZHA 1WWXA 1IXRC 3KZYA 2CWEA 4UWOB 1OYYA 4Q5SF 2XV4S 4S05A 3SHFA 3KP2A 4L0ZB 2JRTA 2QDTA 4ZZDA 4C1EA 4RGRA 2NNNA 3E3VA 2Q8KA 1ZARA 4HV6A 4FSBA 3ZMDA 1UB9A 1FYKA 1LQ1A 3E5UA 2M5CA 3IRQA 4KDPA 2WHGA 4F6ZA 3TOBA 4L9VA 3Q5FA 2QQAA 2V1DA 3BP8A 4Y13A 4TV7A 2YNWA 2HB9A 2Y8BA 3ECOA 2D2WA 5HS9A 3MAJA 3W6KB 2R2DA 4RB3C 3ECHA 3P2UA 2GFJA 4ZH4F 1SFEA 3E6BA 1SAXA 5EVDA 2XROA 4HX4A 3R61A 2ZJ2A 3KNSA 5BQTA 5DCFA 3R0AA 1BI3A 4WXDA 1DXKA 2YX7A 4Q48A 4O5VA 2CG4A 2OZUA 1DDNA 3ZMVA 5LCAA 3C3WA 1KQ8A 1LDJA 4MQVA 2IJLA 4CZZA 2F2EA 3V7RA 1U5TC 3FMRA 3DXJF 2OA4A 1KR3A 2V79A 1RUOA 4LB5A 1YCHA 4CGZA 1VMEA 3T8RA 3RDIA 4C1HA 4O3MA 4Z2YA 3J80K 1K79A 2P6SA 3WTSC 1XGNA 1SD6A 3ZP5A 4I01A 4U7BA 5HOOA 2UYXA 5KILA 5A5ZA 1W5SA 2Y48A 1J0RA 4P9UA 2G9WA 4I0BA 2FF4A 2R7FA 2X4HA 3DF8A 2EJRA 1WQ2A 3I53A 4WWCA 2D1VA 2W57A 3V8LA 2CO5A 5LBQA 1O7LA 5AHRA 3KEOA 1HW5A 3TO6A 1P6RA 2IVMA 2ETHA 2H27A 2BG7A 3ADRA 3F8NA 3IHUA 1ON1A 1QZZA 2RDPA 3IWFA 2ZFWA 2A68F 3F8MA 1G3TA 4L9NA 3SFPA 1X8GA 2VBZA 4DQ2A 2YX4A 1RNLA 4KICA 1K78B 3IEKA 1RIOH 2A07F 1XSDA 1IRGA 5A87A 2WYMA 2FXAA 1TW3A 4HYEA 3F21A 2FHXB 3M1EA 1I1SA 3TKYA 3BJ6A 2CGPA 2QBYA 1MQOA 3RKKA 2VBYA 4HQEA 4UA4A 3C1DA 3LQQA 3VODA 3FMQA 3L00A 4RL2A 2CBNA 3ZQ7A 1R7JA 3HOSA 3SZPA 1H9GA 3AAFA 2QZ8A 1D8JA 2UZKA 4C1DA 4ZO2A 4B09A 1F1ZA 4MNUA 2XKOA 4IJAA 2HQNA 1R36A 3O2PE 5CVRA 1LB2A 3BPVA 4EM1A 2ISZA 5LGTA 1YW9A 4EJVA 3WG9A 2NS0A 3P9KA 1O3QA 4LLNA 2COMA 4F7ZA 2V1UA
chains in the Genus database with same CATH superfamily
2VE8A 4HKYA 1YLFA 2AHQA 3R6SA 4EJWA 4QWQA 1FYLA 2XVCA 4NDLA 3RKJA 1YFHA 2DMNA 1U2WA 1WCMJ 4H4KC 3IDZA 1GDTA 5BMZA 4FCYA 2ESNA 3CC4I 3PNTA 4D1VA 1W7PB 1I27A 1MJBA 3IH3A 1TLHB 4XK4A 1X8HA 2P7VB 5DV5A 2ZO4A 4CSWA 1R23A 5LCFA 4A3FJ 1RR7A 1X4PA 1ZHFA 5B15A 1YS7A 3KEQA 2PMHA 4DIQA 5GTIC 3MFKA 4ZO3A 2ZCWA 1I50J 5CQGA 2A6TA 2A69F 5JVTA 5HIQA 2Y9ZA 1D0YA 3X2QH 2FRHA 2RAEA 1R58A 1J59A 3ONQA 2NYPA 3REOA 3ZQ4A 5EGOB 2BG8A 4XM3A 3GBGA 4W1UA 2R5YA 4IX7A 2XF7A 3HRSA 4EJTA 2QSHX 5LD2C 1U8BA 4D1TA 1ON2A 1JKQC 4IQJA 4KFCA 3G2BA 3ZMUA 3ERED 1W36D 2BVLA 2OZ6A 3OYDA 3CCJI 1ETVA 4H0EA 2F5EA 2ZJPF 1IN7A 4UVBA 5CQEA 3CUQB 2OV7A 2BTNA 1UELB 3BWGA 3C7JA 2BXYA 2JA2A 4C3HJ 3S3NA 1R4NB 4KISA 4CYDA 2O9LA 4FR7A 3W6JB 2IPQX 2VJIA 5EEGA 1OYWA 2M8GX 5AJLA 2IXSA 4XNFA 3OYMA 1IO2A 3NARA 4DNCA 2HYJA 3VYUB 4YRVA 3I14A 3CUQC 4AXHA 1X1AA 3DEUA 3SFIA 2I7TA 2LK2A 5C44J 4X6AJ 2ZB9A 1IN4A 4OOIA 2RKHA 3IOGA 1B72B 4BEHA 1K78A 1R71A 4IHWA 2YNTB 1WRJA 1TC3C 4PJ0C 3UNGC 2QEDA 3BTIA 1D1AA 3ML6A 3QYBA 1IUYA 3RIRA 4KN7X 1PJRA 2NVUB 2QEXI 3Q9VA 4L5EA 3VFZA 2K02A 4TZ9A 4XR6A 3Q9SA 2OTLI 1B9MA 3PSFA 3F3XA 1QA6A 3F9KA 2KJBA 2Z33A 4PJMA 4D1UA 1SMLA 3H35A 1LPQA 3PG4A 3IC7A 4G8XA 3HSFA 3L1PA 2FHXA 1AU7A 3WG7H 3B6AA 5M3MJ 1Z6TA 5CYVA 1ULYA 3TL4X 3ZXSA 3CF5F 3JRBA 1SFUA 1UG0A 1KU2A 2H8WA 2W1OA 2LBFB 1N78A 1VNDA 3H1CA 5FJ8J 3M9AA 1EF4A 2K9QA 1NG6A 4A5MA 2F5VA 4PVOA 2VQLA 1ZRFA 1FBQA 4CYCA 4A3IJ 4XRFA 2DXIA 1IXCA 4GYIA 4NQ2A 4ZYAA 1KU7A 2XF6A 4E7LA 2JA8J 1WHUA 1MBFA 3LOCA 1ZGAA 4MEXF 1ODDA 3Q0WA 3CMAI 3I4MJ 2CUEA 3IL2A 2CG2A 2QQ9A 4PZJA 3TOAA 1HF0A 2YCBA 4GYQA 4XRSG 3ZMSA 2P5VA 3H3UA 2UUZA 3MKZA 1IN6A 2QINA 4ITVA 5E1WA 3JRHA 3F72A 2JZYA 3D5LA 4XSZF 1XD7A 4Y4RA 2BW3A 4U0YA 1JJTA 4MEYF 3KP7A 1X1BA 1UG2A 5F64A 5DYMA 3JR9A 2IAIA 5CPRB 2HR3A 1ZLKA 4HF2A 1YW8A 5HLGA 2L4AA 2W25A 4A0XA 2HVSA 5E1XA 2I7VA 1YIJI 2L5QA 3OYFA 5F08A 4IOCF 2CUZA 4W97A 2M87A 2RQPA 3GTGJ 1F5TA 2V9PA 5EW0A 2FU6A 3FBIB 4EXYA 2DOEA 1T39A 3HUGB 3BQZA 1R9TJ 2DTRA 3N97A 4OIPF 3BR5A 2CQ7A 1XS9A 2KLOA 2EQRA 2Y69H 4WXHA 4XMYA 5GAGJ 1R5GA 1YYVA 4N0BA 2IS6A 2DO7A 2OAZA 1ZRCA 2STWA 3J81K 3E6CC 2E71A 5J3LA 5ERIA 1A36A 1BOAA 4BAYA 1STZA 2Y0SA 1ZNBA 3SDBA 5E20A 2AZ4A 3ABTA 3E6MA 4LG0A 4J01A 2IS1A 5LHIA 1OYIA 4XN0A 4YIRX 1IRXA 2BR6A 3GTKJ 3RPUD 2M5WA 5LFAA 5HDNA 5LCHA 2G7HA 3O8HA 3CD6I 1MH3A 5BNGA 2ELHA 4II3A 2IA0A 1B72A 1WPKA 1FEXA 3J7YJ 2LP0A 2H6AA 5IOYA 1TWGJ 2YNTA 4FASD 4UBQA 1U9NA 1WSUA 5L3GA 2V9KA 1POGA 3BG5A 3WHBA 3CCSI 1BJAA 2TDXA 4PDKA 4OAYA 3CMEI 4MTEA 5D6FA 4HDUA 2L3DA 1XG1A 3SEZA 3SEQA 4DZJA 4Y17A 3CLQA 2BFZA 2X48A 5FQCA 2ZSIB 1HSTA 3PFYA 3K10A 2LH9A 5HLHA 1DPUA 2JTVA 3OYKA 2KIMA 2WY8Q 1LVAA 3S3MA 1DPRA 3AG1H 5GAHJ 2A7MA 3AKZA 4DOZA 4IF4A 4HNTA 3CUQA 1TW2A 2CFUA 3I11A 1KYZA 1BIAA 5AIQA 5B1AH 3E5QA 4IRIA 3X2ZA 4ZNBA 1L0OC 2K9SA 4JK1X 1HOMA 2P0WA 3RQ4A 3JREA 3GTJJ 2Y87A 2VJ5A 5FKKA 4LB6B 5L3CA 1ITYA 2HDWA 4YIFA 4R8HA 5JR3A 1GT0C 3DHAA 1V54H 3HDDA 4JBAA 2YNVB 2Y0SN 2DOOA 3K1NA 2Z5UA 3HKZA 1W1WE 4XKCA 1MDMB 3FKIJ 4RM2A 3DEEA 3LVZA 1R6RA 1XGOA 5EV8A 5ILUA 5DPXA 5M5YJ 1IV8A 3I59B 4CO8A 1ZTCA 1HCRA 4V2GA 2BXZA 5ACXA 2K3PA 3H5NA 2PMZA 3CO7C 3CESA 2O03A 4BP0A 5EWAA 3VPRA 2ZMEA 2EA2A 1DQUA 2MW8A 4JOMA 1USTA 1DU0A 2O5RA 3QAHA 4PSXA 4HPQA 1VQ9I 3SBLA 4EVIA 4C09A 3CF2A 3OOUA 4U88A 1BBYA 1TT0A 1Y39A 4ZDOA 3L9FA 3LQRA 4RAMA 3K4NA 4M72A 2A6HF 2VT3A 1XMXA 3HUGA 4WCGA 3KYCB 3PY5A 5JHUA 4IRGA 2DMPA 1R22A 5K4NA 2A05A 4UAMA 3CCQI 1T0FA 4A69C 3OMYA 1MBHA 3HOUJ 2HQRA 2X85A 4GXOA 2ELJA 2FJ1A 4A3KJ 2BFKA 3I13A 1NG7A 4D1WA 3CP8A 3PNVA 1BR4A 3DWLE 1SC7A 4B43A 3V4GA 1FMVA 4M6XA 2CSOA 2HPMA 1B8IB 3BR2A 4L0YB 1CQTA 5LLDA 3QPTA 4C2TA 3SZGA 1QGPA 4YSKA 2XASA 2GKLA 1B1BA 2PBIA 3KYLA 2LDUA 1WKMA 2K27A 4HEA2 2ZZIA 3I4PA 4DZPA 2NS8A 2L01A 1BI2A 1MJAA 2ID6A 4ASNA 2YU3A 2E5NA 2EBIA 4BH9A 3TQNA 1XGSA 5LGUA 1G4DA 4I6ZA 1HDDC 4A93J 4B44A 1VFCA 1X3UA 3F8BA 1HXDA 2DYRH 2MG4A 1G3SA 1ZELA 5DTDA 3GFIA 2JSCA 2Y31A 3I64A 3PIOF 2R3SA 2EZIA 2G7UA 3KPHA 4HF0A 3JSOA 2X0LA 4RMNA 1VQPI 3BT9A 4CCLA 1IZ1A 4BYYA 4B3AA 5K1YA 4RLQA 1BMCA 2R5ZA 3E97A 3DU5A 1TWHJ 2ICWG 1UJ8A 2HNHA 3X2YA 1ZR2A 1S29A 4P55A 5J6XA 2CQNA 2XHKA 4G6QA 4UHTA 1XSVA 3CDLA 1PUFA 3GYHX 2V6EA 2BY2A 2DOFA 2R7DA 2E7XA 3MZYA 4RAZA 1LFUP 1IV6A 4MTDA 3AJ3A 4BGDA 3RJPA 5IP7J 5J40A 2J5PA 3OR2C 4OIRF 2XR1A 3IRRA 2L0KA 1JXSA 4P62A 3FXJA 5FB2A 4DBRA 1OR7A 3DTEA 4RAYA 2H1KA 2HYGD 1JUMA 4J19A 4DW6A 3HRTA 4I99C 3AL0C 1S8NA 2MFZA 3IE1A 3IWZA 1OPCA 4A6DA 2CS3A 5J4YA 5BS6A 1U6GA 5JFRA 5FRMA 1BC8C 1WW1A 3KE2A 4XL9A 2XB0X 2VKHA 3NWSA 4M3EA 1TT5B 3BG7A 2M45A 3DFGA 5EZGA 3F8FA 1JTXA 1MBKA 1ZRDA 3M8FA 4RBSA 4HZFA 4AWZA 1MD0A 2FD5A 4EJOA 4BY1J 3H0GJ 2C6YA 2W48A 3IH4A 2VJJA 2P5LC 2HOEA 3VPEA 2Z99A 2EPFA 3OOPA 1TL8A 2AQFA 3A02A 2Y9YA 4P1WA 2MC3A 1Z6RA 4QIWN 5HS8A 1PP7U 3OY9A 4RAGA 4JX5A 2GZWA 3A4YA 3BPXA 3PQJA 1YO5C 3I3LA 2D45A 2ACJA 2NXAA 2FSWA 3PM1A 2TCTA 2AIOA 2OBPA 2F5CA 2JK3A 3FMSA 4A0YA 1PUEE 4LOCA 1O3RA 4OMYA 3S14J 4BQAA 4RB1A 4KIFA 3P5JA 2RQQA 3DQVC 4BJTA 2YR2A 1TTYA 1V5GA 4RB0A 4E7SA 5DUIA 2QVOA 3KP5A 1W4MA 2EFWA 4RB2C 4C2UA 2KRHA 1BN5A 1ETYA 3VYTB 3KP6A 2Y30A 4LMYA 5C4JJ 5A0VA 5H6RA 1XSXA 4JQFA 3OYAA 2Q2EA 3H92A 3RSNA 2XPWA 2BHZA 2K9MA 1V5EA 4LIVA 2UXNA 2KMUA 3K4CA 4LJZF 1YRNA 3OYBA 2RN7A 5F6FA 5C4XJ 1KA8A 1SANA 2R7UA 1T56A 4C3JJ 3M8JA 4F6HA 1OJLA 2PEXA 2E1MB 1LFBA 2LTPA 3U1KA 1LUJB 5JI6A 1T8IA 1NK2P 1Z91A 4ENJA 5CLSA 1D0XA 2QUFA 1Z9CA 3CJNA 4GYUA 4BL0B 1JKPC 3JRAA 2FOKA 4E7KA 1B8IA 3V7CA 1A31A 2KDOA 4TZEA 3J80Z 1I1GA 2HZTA 2ESHA 2QQ8A 3F6VA 1LDDA 3X2XA 2XF5A 4V0HA 1VF9A 1FLIA 4CH7A 3K1PA 4ZJZA 4PJNA 4XLFA 3OYNA 2EV6A 3VOEA 3FHZA 1WJCA 2V9VA 5KIKA 1C0WA 3OSGA 2I7XA 4HOBA 5CKTA 1U78A 2L2OA 3N05A 4CXFA 3HYIA 5AXOA 4CCMA 2JA7J 3HOVJ 1ZH5A 2CV1A 1QHGA 4D7MA 2STTA 5LS3A 1DP7P 2OCCH 3ABKH 2X1CA 1YTYA 5BOXA 2AO9A 2GM4A 2GA2A 5HIPA 1WJEA 4MGRA 5ICEA 3GEZA 3HOWJ 1I3AA 1FTTA 1TWCJ 3RKXA 1B6AA 3A03A 3MVPA 4M71A 3VEPA 2P7CB 3PY6A 5ICFA 3KP4A 1SFXA 2M7BA 3EETA 4E6KG 1F4KA 4CCOA 3GZ5A 3MD2A 2MH2A 1Y0UA 3SRXA 1P4WA 4B4CA 5D8LB 3R60A 1HA8A 2QYOA 3T9MA 5ED4A 2XIGA 2DJNA 1BVTA 1BA5A 3BK1A 3BG9A 2VJ4A 4OWRB 5B66C 4BHPA 1GV2A 1HSJA 3G3ZA 3TO9A 4XOPA 1APLC 3FKJA 4ZEJA 3FISA 2FX0A 4KA4A 4G6DA 1RKTA 1T33A 5A23A 2GLOA 2MC4A 3OSFA 3TP9A 4F52A 2FBHA 2XRLA 5FFZA 3S93A 2E5ZA 2MGQA 4KMUX 4AYBA 3VB2A 3TDZC 5FLMJ 5AIJA 1Q1VA 2L7KA 3U9GA 1HLVA 4KT5C 5IYDJ 4AYBN 5CVVA 2DQLA 3O3KA 2CYYA 1AHDP 3G1LA 4IL6C 5TJJA 3EUHC 5J47A 2GMNA 4M9XA 4RAFA 5E3NA 2R0QC 2BG6A 1RETA 1YX5A 4M73A 1XGMA 3V7SA 2GAUA 2FBKA 5L3DA 4ON0A 1D8KA 2LRDA 2JT1A 3CMMA 3WU1B 1Q1HA 4NQ4A 3F8CA 3G73A 4RGSA 4Y3OA 4GGGA 1RUNA 2V1UA 1VJNA 2R5YB 1SVOA 1VGNA 4BHCA 2VPRA 3WE2A 4BQNA 1ZAOA 2XAJA 3M7GA 5F0CA 1MNMC 1MJ9A 2HQAA 1IW7F 2DBBA 1X58A 3CUOA 3HC7A 4FTHA 3W2AA 3PUBA 2E2IJ 4PFOA 3GXOA 3GZ6A 1SFKA 4PUSA 4Z6YA 2CG3A 1RESA 2GOXB 3K9TA 5D5WB 1WFXA 1RPWA 1GV5A 2FMLA 4WXCA 2R7ZJ 3T0YA 1NH3A 5ICGA 4PCQA 2W4SA 4RM3A 5TGTA 2WAQN 3G71I 3LA7A 1JKOC 3ZWFA 5LMCA 4XLNF 4ENMA 1Z0XA 2H1LA 3WU0A 3TW6A 3J81Z 1J75A 2NYXA 4I98B 2E7YA 3S0ZA 2K5CA 2F6CA 2ZNYA 5HS7A 4M74A 2K9NA 2L9RA 2HKXA 4BUPA 2RREA 3TGNA 3OYEA 3UKGA 1QPMA 2XAHA 4GFBA 2QWWA 3HIFA 2FM6A 3E6DA 4U0WA 3S32A 1YJWI 1LKXA 4OIQF 1ETQA 5HIOA 1K4SA 2IP2A 1D0ZA 4N9HA 2W85A 5HNFA 4XIDA 4FISA 5FKLA 3CJTB 4B48A 1VQLI 3G1MA 1P2FA 4XN3A 1F36A 1QNTA 1M1EB 2VASA 4HX8A 4UB6C 4NURA 2K7LA 1HKSA 3G1PA 2CH0A 3QP6A 1ZG3A 4U0VA 2X9DA 1WH5A 3HXLA 4LFUA 4RLFA 3IKTA 4A12A 2L7FP 1T38A 4GYGA 2CRGA 1S6LA 2LR8A 4HV5A 5CVUA 2ZWRA 5ACWA 5E3LA 4D9JA 1QPIA 5LEKA 4BNCA 5GPCA 2WWYA 1FWZA 2YPRA 4A0ZA 2ZXHA 5ILSA 3BOQA 2XAQA 4Z60A 3ERMA 2UWMA 3GLLA 3LA2A 4F91B 3K0LA 2Z9OA 2MLGA 3RTRA 4IRHA 3OIQA 1XCVA 5DM7F 1B4AA 1OCTC 5K0WA 3BR6A 4D7NA 1XDUA 2PMZN 3ZOBA 2LF8A 2ME0A 2IS4A 1FY7A 1YS6A 4PK4A 2DFIA 3DKWA 1E5DA 1Y1WJ 3SYTA 3HRUA 2GXAA 3K69A 3BC2A 1MZBA 1OQYA 4V19K 2NZFA 3QODA 1YG2A 1REPC 6PAXA 1O3TA 2NNYA 2O0YA 4LITA 2JN6A 3MD7A 5ACVA 4MQ9F 4C30A 4DYQA 2BY1A 3JRDA 1K7AA 2RNGA 1W7PA 1Y6IA 3L7WA 4N4OB 3M07A 4NQ6A 4I2OA 4WX9A 3FZVA 2WYLA 2QSGX 4A2UA 1I6XA 1QO0D 1GUUA 2HVQA 3BZ6A 3IH2A 5LRRA 4C1GA 4MO7A 3TP3A 1H88C 2P4ZA 2ID3A 4RGXA 3PIPF 2XSDC 2OU2A 3FIWA 1FNNA 3ZGKA 3I15A 1Y56A 1BW5A 2EZKA 3LNQA 3ASOH 2W7NA 4MHGA 3CCVI 3DKYA 1LEAA 1WJ5A 1ORKA 3C2GA 3DPLC 1QZEA 1R00A 1X1CA 3K4LA 4KN4X 1O7FA 4FETA 4M9ZA 2PQ8A 4B3XA 1OKRA 4ESBA 4Y33A 4IHVA 3W2WA 2L9NA 3BR0A 2CW0F 4M6VA 1Z3XA 3JRIA 3EUHA 5JLXA 4XQFA 3H9GA 2VC1A 2EV0A 3LWFA 1JJ8C 4IHSA 2LMDA 5FO5A 3V8KA 2XKPA 4FX4A 4OIOF 2EIMH 3H3ZA 3JRFA 2QENA 1R5ID 3FK7A 2VKDA 1BIBA 1FSEA 1ZYRF 2KIUA 2QM3A 4RL0A 4HLYA 1FOXA 1T2KA 1MSEC 3EYYA 2Y75A 1ZREA 1X4OA 4TYFA 3QOPA 3AF5A 1A35A 2ELKA 2R92J 1XPXA 3KX2A 3MZ8A 5HH4A 3DBHB 2XGCA 1MSFC 4O6JA 3VDXA 3NQOA 4PGGA 2P8TA 3BTLA 4HBLA 3H5AA 3BTJA 4EEFG 3JRCA 3IE2A 5DD8A 1IUFA 2VOOA 3RPCA 2E36A 1P7JA 2HDDA 4A3GJ 3GVAA 1OCZH 3PFIA 3WTWC 1K6OA 3Q0VA 2HTSA 1JHHA 2EK5A 3SDGA 2JPBA 2E19A 3HEFA 4AIDA 5J8CA 4YG2F 1DUXC 1FOKA 5K7ZA 3FM3A 3ZQHA 4LIUA 1W5TA 1TBXA 3IUOA 3JTHA 4A3MJ 1HKQA 1MGTA 1OCOH 5DEQA 2P6TA 4U4LA 2KP6A 3E7LA 1KZHA 3HBLA 2PFBA 3U2RA 1MBEA 1VQ5I 1YCFA 1E0EA 3OV8A 2RVCA 2OHIA 1ZKPA 2V1NA 2QF7A 3Q3SA 3FXKA 5A2QZ 3FWEA 2B0LA 1IGNA 4Q47A 3K4MA 5K4KA 1HDPA 3I59A 3HSEA 3D5RC 2F4IA 1TQPA 2JVGA 3G1OA 1KQ9A 5CVJA 5K5RA 5FKNA 3L2UA 5EHTA 3CP2A 2NOGA 1KONA 2HXIA 1TQIA 1BJZA 3LSTA 3BTCA 3WTUC 3TO7A 2M4GA 2I5UA 1D5VA 1M2XA 2ZMEB 3S2DJ 4E7IA 3S2WA 2X6OA 3OYLA 4HDVA 3ZQGA 3CDHA 1A04A 4R1HA 4DILA 3L6NA 4WD6A 3BJAA 2GFKA 2R7QA 4BACA 3OL4A 2DMUA 3QOEA 3OS2A 3N4MA 1OISA 2ZXWH 2EFOA 3QPLA 1QVUA 2BZTA 3FHNA 4OMZA 3I71A 4EGZA 4XKWA 4HL1A 4AWXB 2QBYB 1KGSA 4XORA 2EFPA 2ECCA 2LYCA 2DDAA 4HX7A 3RCOA 4Y7NJ 3GTOJ 5M5XJ 2OHHA 1DGWY 1PYVA 4JO0A 2M8EA 3GFLA 4M9SA 2AXLA 2D1HA 1EA3A 2BE5F 2GIZA 1Z3YA 2L9SA 3SW3A 4HF1A 2NS7A 5GTHC 1LFPA 2PJRB 5E1ZB 3WE3A 5KNLA 1JGGA 3AF6A 4E4HA 1XM8A 1U5TA 3DTKA 3K1MA 4LD5A 5AXRA 2H8RA 3F22A 5E3MA 4GCVA 3FF5A 5AIPA 3I56I 4LLLA 2V26A 5EGOA 2Z2SB 3H3VK 3BLYA 5ACSA 3GW2A 3LSIA 1JHFA 2KZVA 2VE9A 3WGGA 2XF4A 1O3SA 3TW7A 1IF1A 1AWCA 4LK1F 3BCAA 2DCEA 2GXGA 2VXDA 2DA1A 3LFKA 3BR1A 4D1QA 4YFNF 2B9SA 3EUAA 1KQ0A 2QJSA 2VLAA 2IW5A 4MFDA 2QKLB 3WODF 3P7NA 5C3EJ 3EYIA 2P4WA 1AOYA 3U21A 3ZNBA 4XLCA 1MBGA 1SD7A 4CCKA 1YW7A 3JAMK 1AA7A 4P9FA 4BXUA 1HBXG 1Z67A 2NVXJ 3ABMH 4L9TA 2COBA 1ZKGA 2LKSA 3W2VA 4HNUA 1QQIA 2R5ZB 1R1TA 4AIKA 4HA8A 4IQ4A 4BE0A 3ZQQA 4TZBA 1Y44A 3CCMI 4KYWA 4UB8C 5IT9K 1SVMA 3WTVC 1BL0A 2FMYA 3TEDA 2DA2A 4MIMA 1U3EM 4XUKA 1S5LC 2VQCA 2L54A 3OIOA 5GADJ 1SEUA 4IO9F 2YHEA 2LG4A 3QPHA 4TYTA 1H89C 2O61A 3JSPA 4DBQA 1G8XA 3K7AJ 3LSPA 1BI1A 2RV8A 2GA1A 2R7VA 2ZNBA 4XLAA 4XLPF 3MEXA 1EV7A 1TZLA 1FPQA 2DK8A 3HPGA 4JX4A 4B1RA 3SXYA 3ZN0A 1OLTA 4FHTA 4EYLA 4BBRJ 1VQ8I 1XCBA 5IP9J 2W00A 2RC4A 3B02A 1LE8A 4C1FA 3BV6A 1R4MB 2GQQA 2FNPA 1X19A 1ETWA 5IT3A 5K7FA 4KUMA 4HAMA 3RPUA 2X6WA 1YIOA 2ZBKA 1ETOA 5HLIA 4V2FA 3GLXA 4PVTA 3FXLA 3D0SA 3DKXA 2LF7A 5E17F 4UWSB 2OJED 4HSRA 3RKWA 5HH5A 3F6OA 2BHYA 2WYMC 4RM5A 3L2CA 1QRYA 4I0AA 5ILVA 1LEBA 1FJLA 3CTAA 2M3AA 2VN2A 1FOWA 4A5NA 1SFOJ 4IHYA 1UHMA 1R5HA 4NQWA 3TDUC 5K5QA 4AX0B 2V6CA 2NAZA 3DP7A 2XAGA 4DYRA 2WV1A 1G6NA 4ZDLA 5AEBA 2BMIA 3CCYA 2K4BA 3A1YA 1UZCA 2VUMJ 5D5VB 2Q9UA 4HQMA 2FQ3A 2IGOA 1YJNI 2OTJI 2R4GA 3WGHA 3SD9A 1WI3A 2CFXA 3RZDJ 2PN6A 4XKBA 3ZR8X 1MMAA 3VQZA 3H3EA 2O8XA 4PGHA 2M0MA 3KETA 3OYJA 1N75A 3IP4B 2NZEA 3MN2A 5DUKA 5EF6A 2Z3YA 4ETSA 2ZNZA 3GUDA 2ZXJA 3KYDB 3F9OA 2QGUA 2CQXA 2H94A 2ZJQF 3GTPJ 4EFZA 2VI6A 5J4VA 2A61A 1XTOA 1A6QA 3OL3A 4U87A 3MKYB 3PNYA 1BM9A 2LNBA 3IEMA 4AVZA 3UR3C 4YEJA 3W6VA 3V42A 2P97A 1FZPB 1OCCH 1WJBA 3CDIA 2R7OA 1ZTRA 5M5WJ 3GFJA 3HTUA 3GTMJ 5D4RA 3HPHA 2M5DA 1V4RA 3EQLF 1SMYF 2CV2A 1X2MA 3I55I 2CFOA 2DFEA 2VPLA 2KQRA 1XDSA 1T6SA 2XGDA 3MKLA 3I0VA 4AU7A 4AIHA 2Y0MA 3DHCA 2YS9A 1V55H 3HB9A 2NRAC 3GF2A 4KNYA 1A8TA 2Y2ZA 2L7MP 3O8GA 5FGMA 3HGYA 3RYPA 5AONA 1P4AA 2VODA 3U1DA 5LHGA 1T98A 4G7ZF 2N8GA 4ZYDA 4AC0A 3ZRGA 2Q0IA 2BW3B 4IXAA 2H09A 5CJ9A 3VSLA 1HW2A 2NOJB 1E17A 1D5YA 2HI3A 2HU9A 4HLXA 2X1EA 1FP1D 4P5OA 4U7DA 3I9V2 1TNTA 5H20A 4CDGA 3P9CA 5K5OA 3LSRA 2CQQA 3FXMA 3DPTA 4M3GA 4NUBA 4XWTA 3ESHA 1WGXA 2QCOA 2KPMA 2A3SA 5IP6A 2OQRA 4ZZLA 3IE0A 3R2UA 1UHWA 5IT9Z 1YOVB 2DTZA 1RC9A 2IS2A 5E8GA 1TQMA 4DGWB 2VOPA 3IAS2 5FRNA 2WB1A 3GO5A 4F55A 3PQKA 5EG0B 4G7HF 2WBMA 2WAEA 3AL0B 1ZG1A 4H0DA 3NRVA 4PDXA 2LY1A 4RAWA 3C2HA 4G7OF 4CHUA 2BY3A 2ZSHB 2B7EA 1X1DA 3GTQJ 2K4JA 1UAAA 4LLGF 4S0HB 1KO2A 3ELKA 5E3OA 2PJPA 4KIBA 4II2A 2LKXA 1XN7A 2O3FA 2DFHA 4IEJA 5ACTA 1WI9A 2BBYA 3KL7A 2G0EA 5HDKA 1JUPA 2DN0A 3CCRI 3CQZJ 5LSCA 3ZCOA 2WRSA 2ADUA 3D5SC 4MFEA 2FU7A 3QU6A 1RR8C 2XDVA 1MDMA 4G9YA 4LE6A 4UV8A 2KL4A 4NHJA 1NTCA 1GVDA 1SMTA 2CU7A 1H8AC 3MCZA 4KIGA 5FD5A 5IYCJ 2RGVA 5CVIA 2YZ3A 3GWZA 2OC6A 3HHHA 3I4NJ 3ABUA 2GCUA 3NAUA 2DAOA 1IN8A 3C18A 3E0JB 4GCWA 3IKVA 3L2RA 3AG2H 3H0DA 4EQQA 1G3YA 2YSRA 2JQ7A 1VQOI 1U8RA 2JA5J 3K6GA 3RI4A 1QH5A 2JWTA 4FQGA 3CMYA 1AKHB 1OCPA 4M3FA 5J8FA 1YJ9I 3HKZN 2WV0A 1FOYA 2FBIA 2JUCA 2HEOA 4A3CJ 1IRZA 2W84A 2XAUA 1MBJA 1T08B 5HLTA 4RBOA 2F5FA 2KISA 4ZYHA 2JJ7A 2H6CA 2K86A 4L5JA 3TBIA 2LLKA 1EH8A 1G2HA 2HYFA 2LBFA 2L7ZA 2F5DA 4F93B 1GLNA 3WTXC 1IC8A 5BPDA 4IPAA 3TMOA 1YHQI 4Y52J 1YCGA 3EUKL 2E2JJ 1L9YA 4L5IA 2RNJA 5FLXZ 1P9EA 2PI0A 1I39A 1TWAJ 2M2EA 3ISPA 3WTTC 1BC2A 3WXCA 1FP2A 2YU9J 4AVPA 5LHHA 3BC8A 2M9HA 5HNHA 4UVAA 3BY6A 5HDGA 3BG6A 3CJQB 1QVTA 2VC0A 3LSHA 2ZFUA 2OCEA 5F27A 5D8KB 5D6EA 3ULQB 5HVQC 2HVRA 1S7OA 3QWLA 2EFNA 1J5YA 3DLLF 1ZLJA 2TRTA 3ZPLA 1ONVA 4BQQA 2EFQA 4CUGA 2DPDA 5FFXA 1X2NA 2XUBA 1WRAA 2IEKA 2L9VA 2X6YA 2DK5A 5TISC 4X1EA 2I10A 2JVHA 5IQKA 2VBWA 5EG0A 1V5FA 1VTNC 2BYVE 1X3ZB 1MNDA 1IDYA 1ETKA 2DA4A 4Y15A 5L3BA 1KYWA 5ACUA 1FT9A 3FAIA 4BXXJ 2AXTC 2MD5A 3LL7A 4A6EA 5LRSA 3K2ZA 5F0FA 4HW0A 4Z67A 2V7FA 4EATA 2CUFA 4ESFA 2E2HJ 2GBYA 5K7HA 2EZLA 1W7PD 1SD4A 4YIIA 2FK6A 4R79A 2LY9A 1JI8A 1OMIA 1WZ2A 3M8EA 5BPIA 4BE1A 2BG2A 2E7WA 5EVBA 2BG8B 2QDSA 4YSLA 4GRIA 1P9QC 2ME6A 3ABLH 1K83J 1GVJA 1H0MA 5FKMA 3ZMTA 3KFWX 4CZCA 4DIKA 2EIKH 3J7AO 3S1QJ 5A2QK 1Z7UA 4GDFA 1FC3A 3QRFF 3FBNB 2L4MA 4C2MJ 5KHDA 1OR7C 4XWWA 1YQAA 1SVLA 1QH3A 3A01B 5D4SA 3K70D 2FNAA 1U0JA 5H6QA 9ANTA 1X8IA 3KLNA 3VWBA 1W0UA 4A3JJ 3A0HC 1ACIA 2HDCA 2OUMA 4M3BA 2MBFA 5K4MA 4AUXA 1WVRA 2VW8A 1ZG5A 3DV8A 4M3DA 2KRCA 1IAWA 1VZ0A 5GAEJ 5LM6A 5IPAA 1WUPA 3DH8A 1FIPA 3FXUA 3E5XA 2Z1DA 2R93J 2EV5A 2R7SA 1FBSA 4YFKF 3RPQA 4I7HA 5FQBA 2X51A 2P81A 1RI7A 4HSTA 2E1NA 4UVCA 4KITB 4UNOA 3H9JA 2P18A 3ZR9A 1GHCA 1KU3A 1R1VA 3KCCA 2BEOA 3OWTA 3T3OA 3BK2A 2KIFA 4HNVA 4LK0F 4CA0A 2DMQA 2J5OA 2NVQJ 3ZQIA 4J5HA 1UCRA 5EJCA 3LA3A 1E3OC 2HOAA 1IG7A 2HKOA 1SD5A 2MH9A 3NEUA 3Q6VA 4E7HA 4UWRB 3QQAA 3HOTA 4ESJA 3JRGA 4RA2A 4J00A 3FXOA 3JTGA 2HWVA 3ZMZA 3H36A 2LC2A 2VKEA 4ABZA 1YI2I 3BROA 1QZYA 3BJOA 2R7XA 4KEPA 4ZYEA 1Y1VJ 3V8JA 3FCZA 2EILH 3SFZA 5E79C 1HW1A 1X3WB 4ENNA 4BZ3A 4GO1A 2KT0A 2LOOA 2LSOA 5F04A 4D5CA 2DDBA 3HZJA 4UV9A 1S3JA 3WTZA 3S1NJ 2ZC2A 4G94A 3PO3J 1I5ZA 4M6YA 3JCUC 3W3CA 3FXQA 5DCMB 3ROUA 1MMGA 4BKXA 2JPCA 2VIXA 2M1BA 3HG9A 2HOTA 5B3RA 2K3FA 5FKOA 5LEJA 3MKWB 1MKMA 5B5EC 1W36C 3T8TA 1MNEA 1BR1A 3GX4X 2ISYA 4RDUA 1AKHA 4MLOA 1G59A 1W0TA 1L3LA 3IAM2 3LMMA 4KMFA 4FEKA 5L3EA 4B87A 3DPUA 3HL2A 1P4XA 2E1MC 1ENHA 2P5KA 4UUSB 3CO6C 3FK6A 2LKPA 2MD0A 5FROA 2E34A 3MQ0A 1B59A 2DT5A 3S8PA 4CICA 3EDPA 2WC2A 3VYRB 4I02A 2BC2A 2VT2A 1JGSA 4BDZA 5AHOA 3S1MJ 2PJRA 4CHLA 2X6XA 4NNJA 4NC8A 1U5TB 2IRFG 3LAPA 1JUSA 4CCJA 4C1CA 3L09A 4Z5YA 5ICCA 1LDKB 4ANJA 1IN5A 2QA4I 2KRFA 2IGNA 1Z1DA 4XICA 4XRSA 3PL8A 5KAFC 4FE4A 1DD6A 1UFMA 1E3PA 1X1PA 3P9IA 1YE9A 4I76A 5GPAA 3ZN1A 3WU2C 1WJDA 1JKRC 3IOFA 4ZYGA 2OHJA 2HTJA 3K4JA 1S7AA 3T3NA 2DI3A 2FA5A 4Z5ZA 2GIVA 2EA4A 4JP0A 1DDKA 1FSHA 1UMQA 2E60A 2FUG2 1U9OA 1PP8F 4UUVA 3DHBA 2PG4A 4RS8A 2QSFX 4TZFA 5IOZA 2EB7A 1CF7B 3ZQLA 2HGCA 3RYRA 4LG0B 1WJAA 2F4OB 4EM2A 1MMSA 1JJEA 2HOSA 2DLLA 3I58A 2AS5F 3PO2J 4EV0A 3S17J 2M30A 4DJAA 2VXZA 4IZZA 2KDZA 2XB5A 3R4KA 3M1CA 2P1EA 2KIQA 3CLOA 1QBJA 2KJCA 3OYCA 1GXQA 4E70A 4RGUA 1H9TA 2F48A 1N77A 1RKWA 2ZKZA 2O6GE 4EYFA 4AV7A 4FX0A 5GP9A 5A0TA 5TRDA 3H5RA 2V1XA 3I0TA 4EM0B 5FD6A 4D0PA 5AYAA 3T5XA 1J2XA 2DA3A 2WAFA 3OR1C 4B8XA 4BQOA 5EVKA 1PDNC 2BFLA 2FU8A 4A3EJ 3ZQFA 2E1OA 3HTSB 1F9NA 4UXNA 2KKOA 1P92A 4K2EA 2V4JC 1E2XA 1USSA 1YX3A 4OU0A 2QLZA 2K9LA 3S3OA 1RZ4A 2Q0OA 3FXRA 1MH4A 1ZN2A 2A5YB 3ASNH 3K2AA 4L18B 4UY8I 3HOZJ 1TNSA 5F1JA 4AX1B 3M4OJ 3JAMZ 2Q42A 4Z7RA 5B3SH 2WADA 2DOAA 2M7AA 2KFDA 3AG4H 2VB6A 2Q0JA 3F23A 1Y8RB 2MLKA 2HQ5A 4OINF 1A7TA 4YELA 3G6EI 2OF7A 5ACRA 2EZHA 3L2QA 2YNVA 4QLCU 4NQWB 1HLKA 1J7KA 2JRMA 3OS0A 2QQBA 2BOLA 5F1RA 1CGPA 3AFHA 4HG2A 5EH9A 4PJJA 3BDDA 4BE2A 3G4SI 4YSBA 2CFZA 3COAC 4N9IA 1S72I 2XAFA 1RRJA 5ACPA 2XPUA 2AQEA 4AWYB 2JA6J 3FM5A 4EY2A 2H6BA 4EGYA 5DDGA 3L2VA 1D3YA 5EV6A 5EYRA 4XONA 5EZHA 1DGRM 5LE1A 4EMSA 3GZNB 2ZJRF 4XSXF 4FT8A 5HODA 1JE8A 1EH7A 3OYHA 3HSRA 3RKYA 4NC7A 3LAJA 1KU9A 2GWRA 2WAQA 2IBDA 2IA1A 2PLYA 1D1BA 4XBFA 1GXPA 3J7ZI 3KNRA 3QH8A 1G3WA 5H2FC 3CCLI 1TWFJ 3FX3A 5EEAA 1O4XA 2Y8AA 3IV5A 3IELA 2BGAA 4Q4ZF 2A6EF 1HKTA 1TP4A 2L02A 4LGWA 5E8IA 3K70C 2FEZA 3HM5A 5KK1A 1E3HA 4AIJA 2HS5A 5L3FA 2VBXA 1SAUA 2VONA 2NVYJ 4ZTJA 2DQRA 1BR2A 4EJUA 3BZCA 1O57A 1YRNB 1VI0A 2DU9A 5ACQA 4XLHA 3I5UA 2MYSA 1MIJA 1EKEA 2W24A 1ZGJA 3O6BB 5DCMA 2DA5A 1VQKI 2XRNA 2F4MB 1XX5A 2DW4A 1XB4A 2WY7Q 1I6HJ 4CYCB 5D5UB 3SQNA 2LD5A 4EXSA 4Z6XA 3A4CA 4WF2A 2WTEA 4I09A 2M4KA 1BC7C 4O98A 1D1CA 1BI0A 1XTAA 2XGEA 1F43A 1WJFA 4L9JA 2XGXA 2R7WA 5FLXK 4EYBA 1NHAA 5DS9A 3LSMA 2DMTA 2DPUA 3OYGA 5FQAA 1HQCA 4QPOA 1JT6A 3TP0A 3CCEI 2MA3A 4UUSA 1VQ7I 3B73A 2IA2A 4KT6A 1R1UA 4C9YA 4IHXA 2OQGA 1ZGWA 3QP5A 2DT6A 2K40A 2EWNA 4JYKA 4XLEA 1XMKA 2JMWA 3OYIA 1XC5A 2OD5A 5KVRA 3WTYC 3JW4A 1CF7A 1WUOA 2JSPA 2LY2A 1FTZA 2O8KA 5B1UA 4BU2A 3BG3A 3SZTA 4P96A 1EJ9A 5LGNA 1R49A 3DTIA 1LNWA 2KZGA 4NQ5A 2UXXA 3BQYA 3HRMA 2MSYA 1BW6A 3S2HJ 3F0CA 1FX7A 3HHGA 4YFXF 1XMAA 2PX9A 4WK8F 4NB5A 2B63J 2PMUA 2YNUA 5EEHA 3OS1A 1MW7A 2NXNB 3KZIC 3MMYB 4NC6A 2GXBA 2GOMA 2CW7A 4KEQA 4QTRA 3DLAA 1FYMA 2DFFA 3GFMA 1J9IA 2CV0A 1ERDA 2FU4A 4IKFA 3KZZA 2BIBA 3QU3A 1IRFA 2DKFA 5HISA 3KLOA 2BGCA 5DD4A 3SPUA 2BV6A 1Z77A 5D5XB 3C2BA 5LLQA 3WGIA 3A2KA 2CQKA 1JT1A 2VKVA 1IXSB 4S04A 3X30A 4HL2A 4J5FA 4ENKA 4BS9A 1Y0NA 1K07A 2VL8A 3KP3A 1WH7A 2ZXIA 3T1BA 1JJ6C 1NK3P 4BDYA 1K4TA 2HFHA 2IT0A 1Z05A 1FBUA 4BJ5C 4BHBA 1B9NA 3R0JA 2E1CA 2FU9A 5HH6A 3RKQA 2K85A 1V3FA 3JXPA 1A5JA 4NBQA 2FE3A 4IVNA 1JTYA 3M3YJ 4AD9A 4IHTA 1KO3A 3MWMA 4D02A 3AG3H 3I54A 1LJ9A 2BFZB 1EH6A 4UWPB 3MZHA 1WWXA 1IXRC 1IJWC 3KZYA 3J7AY 2CWEA 4IOAF 4UWOB 1OYYA 4XOTA 4Q5SF 2A5WA 3S1RJ 4PFPA 4HRIA 2XV4S 1T0FC 4S05A 5EDNA 3SHFA 4A3BJ 3KP2A 2QKMB 2JRTA 4L0ZB 2QDTA 3NWTA 2Q2EB 4ZZDA 3B6CA 4C1EA 4RGRA 2NNNA 3E3VA 2Q8KA 1ZARA 4HV6A 4FSBA 2FOWA 3ZMDA 1UB9A 1Z7LA 1FYKA 1LQ1A 3BZKA 3E5UA 5J1RA 2E35A 2CUJA 3SJMA 2M5CA 3IRQA 3PSIA 1JT0A 2D5VA 3TOBA 4KDPA 2WHGA 4F6ZA 4L9VA 3Q5FA 4XKVA 2QQAA 1S7EA 2V1DA 3Q0UA 4JX6A 4B47A 3BP8A 4Y13A 3DCFA 3HJEA 4TV7A 2YNWA 5B1BH 2HB9A 2Y8BA 3RQIA 4A3LJ 3A0BC 3ECOA 2D2WA 3BCBA 3MAJA 5HS9A 3W6KB 2R2DA 4ZDPA 4RB3C 2Z16A 3ECHA 3GTLJ 3P2UA 2GFJA 4ZH4F 2DA6A 3OIPA 2MABA 1S9HA 1T95A 3D1NI 1SFEA 5IY5H 3E6BA 1SAXA 5EVDA 5KAIC 1VQMI 2XROA 3GCMA 4HX4A 1W5CC 3R61A 4PJLA 4X0GA 1QU3A 2XPVA 2FQ4A 2M34A 2DYSH 2ZJ2A 2EIJH 3KNSA 5BQTA 5DCFA 1PUFB 3R0AA 5F0HA 1BI3A 1PVEA 4WXDA 5J1YA 1DXKA 2YX7A 4Q48A 4O5VA 2CG4A 2OZUA 1J09A 2XC7A 1DDNA 2Q1ZB 5JHFA 3ZMVA 5IYBJ 2ECBA 3FDYA 5LCAA 3C3WA 4CCNA 1KQ8A 1LDJA 4MQVA 3HOYJ 3HGGA 2EINH 3HOXJ 1A6IA 2IJLA 3LFUA 3VSKA 4CZZA 4LG3A 2F2EA 3V7RA 1U5TC 3FMRA 3DXJF 2DT7B 3KIOA 3QYFA 4ZTFA 3EPZA 2OA4A 1ZK8A 2UV1A 1KR3A 5M3FJ 3CCUI 4BBSJ 2BY0A 2V79A 1RUOA 2DJIA 4LB5A 1YCHA 4CGZA 1VMEA 3T8RA 3DBLB 3RDIA 3LSGA 4C1HA 4O3MA 4Z2YA 2IGKA 1HC8A 1OCRH 3KEYA 4PSWA 3J80K 2P6SA 1K79A 1DU6A 3WTSC 2BVMA 3DBRB 1UHSA 2EH3A 1XGNA 3WHCA 2R7TA 1SD6A 2HZDA 2LREA 3K4KA 3ZP5A 3PJRA 1MMNA 4QSHA 4I01A 4U7BA 5HOOA 2UYXA 5KILA 5A5ZA 4DYCA 4QPQA 1W5SA 2R7RA 5DM6F 3CZ6A 1K6YA 1I3QJ 2W82A 4AM3A 2Y48A 2CMPA 1J0RA 4P9UA 2G9WA 4I0BA 1QHHD 2FF4A 2R7FA 3CC7I 3DF8A 2X4HA 3DEWA 4BEHB 2EJRA 1Y8QB 1WQ2A 3I53A 1VQ4I 4WWCA 2D1VA 3S15J 3LSJA 2OPTA 2W57A 1K61A 5FLVA 3V8LA 2CO5A 2I8DA 1LE8B 3ZQCA 2X1DA 1ZR4A 2XSJC 4BJ6C 5LBQA 4F92B 3LSKA 1O7LA 4N4NB 5AHRA 2DODA 2HXOA 3KEOA 3BR3A 5JVGF 2IGMA 1N25A 4C3IJ 1HW5A 3TO6A 1P6RA 2IVMA 2ETHA 2H27A 2CJJA 2BG7A 3ADRA 1LVKA 3F8NA 2M0CA 3IHUA 3A01A 2JUGA 1ON1A 1P7IA 1QZZA 2RDPA 2NVTJ 3IWFA 2ZFWA 2A68F 1MMDA 3F8MA 3L2WA 1G3TA 2LVSA 4E7JA 4L9NA 3SFPA 1X8GA 2VBZA 2YX4A 4KICA 1RNLA 4DQ2A 1K78B 3IEKA 1RIOH 2A07F 1XSDA 1ETXA 4OAZA 4D5FA 3VYSB 1VQ6I 1IRGA 3E1SA 2HPIA 3GMEA 5A87A 2WYMA 4ZC3A 3CJRB 2FXAA 4UUTA 1TW3A 4HYEA 3F21A 1BOBA 1OFCX 2FHXB 3M1EA 1FMWA 1I1SA 4G12A 2VQGA 3TKYA 3BJ6A 2CGPA 3CC2I 1IDZA 2QBYA 1MQOA 2KHMA 3RKKA 2VQHA 2VBYA 4E7ZA 3H9QA 4HQEA 4UA4A 2WA0A 3C1DA 3LQQA 2O7OA 3VODA 3FMQA 3L00A 4RL2A 4KJZA 1DP3A 2CBNA 2WB1N 3ZQ7A 3S16J 3QPSA 1R7JA 3HOSA 3SZPA 1H9GA 3PUFA 3AAFA 4A3DJ 2QZ8A 5JLWA 1D8JA 3QYEA 4G6TB 1ZQ3P 2UZKA 2YUSA 4XRMA 5KCMA 4F3QA 4C1DA 4ZO2A 4B09A 1F1ZA 3RZOJ 4MNUA 2XKOA 3ESWB 4BXFA 4IJAA 2HQNA 1FIAA 1R36A 1Z21A 4BY7J 2LFBA 2CW8A 3O2PE 5CVRA 1LB2A 3DU6A 3BPVA 4EM1A 2ZMEC 5J1UA 2ISZA 5LGTA 1YW9A 4EJVA 2DA7A 3WG9A 2NS0A 3P9KA 4FE7A 1O3QA 1VQNI 1YITI 4LLNA 3K4BA 2COMA 4F7ZA 5E18F
chains in the Genus database with same CATH topology
2VE8A 4HKYA 1YLFA 3R6SA 4EJWA 4QWQA 1FYLA 2XVCA 3RKJA 1YFHA 1U2WA 3IDZA 5BMZA 2ESNA 4D1VA 1W7PB 1I27A 1MJBA 1TLHB 1X8HA 2P7VB 5DV5A 2ZO4A 1R23A 5LCFA 1ZHFA 5B15A 1YS7A 3KEQA 2PMHA 3MFKA 4ZO3A 2ZCWA 2A69F 5JVTA 5HIQA 2FRHA 1R58A 1J59A 2NYPA 3REOA 3ZQ4A 2BG8A 4EJTA 3HRSA 4D1TA 1ON2A 4KFCA 3ZMUA 3ERED 2OZ6A 4H0EA 2F5EA 1IN7A 4UVBA 3CUQB 2BTNA 3BWGA 3C7JA 4CYDA 4FR7A 3W6JB 2IPQX 5EEGA 1OYWA 4DNCA 3I14A 3CUQC 3DEUA 2I7TA 1IN4A 4OOIA 2RKHA 3IOGA 1K78A 2YNTB 1WRJA 2QEDA 3ML6A 1IUYA 3RIRA 4KN7X 3Q9VA 3VFZA 2K02A 4TZ9A 3Q9SA 1B9MA 3F3XA 2KJBA 2Z33A 4D1UA 1SMLA 3PG4A 3IC7A 4G8XA 3HSFA 2FHXA 1Z6TA 5CYVA 1ULYA 1SFUA 1KU2A 3M9AA 4A5MA 4PVOA 1ZRFA 1FBQA 4XRFA 1IXCA 4GYIA 4NQ2A 1KU7A 1ZGAA 4MEXF 1ODDA 3IL2A 2QQ9A 4PZJA 3TOAA 2YCBA 4GYQA 3ZMSA 2P5VA 3H3UA 2QINA 1IN6A 5E1WA 3F72A 2JZYA 3D5LA 4XSZF 1XD7A 4U0YA 1JJTA 4MEYF 3KP7A 5F64A 5DYMA 2HR3A 1ZLKA 4HF2A 1YW8A 5HLGA 2L4AA 2W25A 4A0XA 2I7VA 5E1XA 2M87A 2RQPA 1F5TA 5EW0A 2FU6A 4EXYA 1T39A 5E18F 2DTRA 3N97A 4OIPF 4WXHA 1R5GA 1YYVA 4N0BA 2DO7A 2OAZA 1ZRCA 2STWA 3J81K 3E6CC 5ERIA 1BOAA 4BAYA 1STZA 1ZNBA 5E20A 2AZ4A 3ABTA 3E6MA 4LG0A 5LHIA 1OYIA 2BR6A 2M5WA 5HDNA 5LCHA 2G7HA 2ELHA 2IA0A 2H6AA 2YNTA 4UBQA 1WSUA 5L3GA 1BJAA 2TDXA 4PDKA 4MTEA 5D6FA 4HDUA 2L3DA 4Y17A 2BFZA 5FQCA 1HSTA 5HLHA 1DPUA 2JTVA 2KIMA 1LVAA 1DPRA 2A7MA 4IF4A 3CUQA 1TW2A 3I11A 1KYZA 1BIAA 5AIQA 4IRIA 3E5QA 3X2ZA 4ZNBA 1L0OC 4JK1X 2Y87A 3F9OA 4LB6B 4RAMA 5L3CA 4YIFA 4R8HA 5JR3A 3DHAA 4JBAA 2YNVB 2DOOA 3K1NA 2Z5UA 1MDMB 3LVZA 1XGOA 5EV8A 5ILUA 5DPXA 3I59B 4CO8A 1ZTCA 5ACXA 3CO7C 2O03A 4BP0A 5EWAA 2ZMEA 2EA2A 1USTA 3QAHA 3SBLA 4EVIA 4C09A 4U88A 1BBYA 3L9FA 3LQRA 4M72A 2A6HF 2VT3A 3HUGA 3PY5A 4WCGA 5JHUA 4IRGA 1R22A 5K4NA 4UAMA 1T0FA 2BFKA 2HQRA 4GXOA 3I13A 4D1WA 3V4GA 4M6XA 2CSOA 4L0YB 5LLDA 3QPTA 1QGPA 4YSKA 2XASA 2GKLA 1B1BA 2PBIA 2LDUA 1WKMA 2K27A 2ZZIA 3I4PA 2L01A 1BI2A 1MJAA 4ASNA 2YU3A 4BH9A 3TQNA 1XGSA 5LGUA 1G4DA 1X3UA 3F8BA 1HXDA 1G3SA 3GFIA 2JSCA 3I64A 2R3SA 2G7UA 4HF0A 3JSOA 2X0LA 1IZ1A 4BYYA 5K1YA 1BMCA 3E97A 3X2YA 1S29A 4P55A 5J6XA 2XHKA 4G6QA 4UHTA 1XSVA 3GYHX 2R7DA 2E7XA 3MZYA 4RAZA 4MTDA 3AJ3A 3RJPA 2J5PA 4OIRF 2XR1A 3IRRA 1JXSA 4P62A 5FB2A 1OR7A 4RAYA 2HYGD 3HRTA 1S8NA 3IE1A 3IWZA 1OPCA 4A6DA 5BS6A 1U6GA 5JFRA 1BC8C 1WW1A 3KE2A 3DFGA 2M45A 1ZRDA 3F8FA 3M8FA 4RBSA 4HZFA 4AWZA 1MD0A 4EJOA 2C6YA 2P5LC 2HOEA 3VPEA 2Z99A 3OOPA 2MC3A 1Z6RA 5HS8A 1PP7U 2GZWA 3A4YA 3BPXA 3PQJA 1YO5C 2D45A 2ACJA 2NXAA 2FSWA 2AIOA 2OBPA 2F5CA 3FMSA 4A0YA 1PUEE 1O3RA 4OMYA 4BQAA 4RB1A 4KIFA 3DQVC 2YR2A 1TTYA 4RB0A 5DUIA 2QVOA 3KP5A 1W4MA 2EFWA 4RB2C 1BN5A 3KP6A 4LMYA 5A0VA 5H6RA 1XSXA 4JQFA 2Q2EA 3H92A 2UXNA 4LJZF 2RN7A 5F6FA 1KA8A 4F6HA 2PEXA 5JI6A 1Z91A 4ENJA 5CLSA 2QUFA 1Z9CA 4GYUA 3CJNA 2FOKA 3V7CA 4TZEA 3J80Z 1I1GA 2HZTA 2ESHA 3F6VA 1LDDA 3X2XA 4V0HA 1FLIA 3K1PA 2EV6A 3VOEA 3FHZA 2V9VA 5KIKA 1C0WA 2I7XA 4HOBA 1U78A 4CXFA 3HYIA 5AXOA 1ZH5A 2STTA 5LS3A 1DP7P 1YTYA 5BOXA 2GA2A 5HIPA 4MGRA 5ICEA 3GEZA 3RKXA 1B6AA 4M71A 3VEPA 2P7CB 3PY6A 5ICFA 3KP4A 1SFXA 1F4KA 3EETA 3GZ5A 2MH2A 1Y0UA 3SRXA 1P4WA 5D8LB 3R60A 2QYOA 3T9MA 5ED4A 2XIGA 1BVTA 3BK1A 4BHPA 1HSJA 3G3ZA 3TO9A 4ZEJA 4KA4A 4G6DA 3TP9A 2FBHA 5FFZA 4KMUX 3VB2A 3TDZC 3U9GA 4KT5C 5CVVA 2DQLA 3O3KA 2CYYA 5TJJA 2GMNA 4M9XA 2BG6A 4M73A 1XGMA 3V7SA 2GAUA 2FBKA 5L3DA 4ON0A 1D8KA 2JT1A 3WU1B 1Q1HA 4NQ4A 3F8CA 3G73A 4RGSA 4GGGA 1RUNA 1VJNA 1VGNA 4BHCA 3WE2A 1ZAOA 2XAJA 3M7GA 1MJ9A 1IW7F 2DBBA 3CUOA 3GXOA 3GZ6A 3K9TA 5D5WB 4WXCA 2FMLA 3T0YA 5ICGA 4PCQA 3LA7A 3ZWFA 5LMCA 4XLNF 4ENMA 3WU0A 3J81Z 1J75A 2NYXA 4I98B 2E7YA 3S0ZA 2ZNYA 5HS7A 4M74A 2HKXA 3TGNA 1QPMA 2XAHA 2QWWA 3HIFA 2FM6A 3E6DA 4U0WA 4OIQF 5HIOA 2IP2A 4N9HA 2W85A 1P2FA 1QNTA 4HX8A 2K7LA 1HKSA 3G1PA 3QP6A 1ZG3A 4U0VA 4LFUA 4A12A 3IKTA 1T38A 4GYGA 1S6LA 4HV5A 5CVUA 2ZWRA 5ACWA 5LEKA 4BNCA 2WWYA 1FWZA 2YPRA 4A0ZA 5ILSA 3BOQA 2XAQA 4Z60A 2UWMA 3LA2A 3K0LA 2Z9OA 2MLGA 3RTRA 4IRHA 5K0WA 1XCVA 1B4AA 1XDUA 2LF8A 1FY7A 1YS6A 2DFIA 3DKWA 1E5DA 3HRUA 3K69A 3BC2A 1MZBA 2NZFA 1YG2A 1REPC 6PAXA 1O3TA 2NNYA 2O0YA 3MD7A 5ACVA 4MQ9F 1K7AA 1W7PA 3L7WA 4NQ6A 4I2OA 4WX9A 3FZVA 2WYLA 4A2UA 1I6XA 1QO0D 3BZ6A 5LRRA 4C1GA 2P4ZA 4RGXA 2OU2A 1FNNA 3I15A 4MHGA 1LEAA 3DPLC 1R00A 4KN4X 4M9ZA 1O7FA 2PQ8A 1OKRA 4ESBA 2CW0F 3EUHA 2VC1A 2EV0A 3LWFA 4IHSA 5FO5A 4FX4A 3V8KA 2XKPA 4OIOF 3H3ZA 2QENA 1FSEA 1BIBA 1ZYRF 2KIUA 2QM3A 4RL0A 4HLYA 1T2KA 3EYYA 2Y75A 1ZREA 4TYFA 3QOPA 3AF5A 5HH4A 4O6JA 3NQOA 4PGGA 2P8TA 4HBLA 3IE2A 5DD8A 2VOOA 3RPCA 3GVAA 3PFIA 3WTWC 1K6OA 2HTSA 1JHHA 2EK5A 2JPBA 5J8CA 1DUXC 4YG2F 1FOKA 3FM3A 1W5TA 1TBXA 3JTHA 1HKQA 1MGTA 4U4LA 5DEQA 2P6TA 2PFBA 3U2RA 1YCFA 3OV8A 2RVCA 2OHIA 1ZKPA 5A2QZ 3FWEA 2B0LA 4Q47A 5K4KA 3I59A 3HSEA 1TQPA 1KQ9A 5CVJA 5K5RA 5EHTA 1TQIA 3LSTA 3WTUC 1D5VA 1M2XA 3TO7A 2ZMEB 3S2WA 4HDVA 4DILA 3CDHA 1A04A 4R1HA 3L6NA 4WD6A 3BJAA 2GFKA 3N4MA 2EFOA 4OMZA 3I71A 4EGZA 4HL1A 4AWXB 2QBYB 1KGSA 2EFPA 4HX7A 2OHHA 4JO0A 2M8EA 3GFLA 4M9SA 2AXLA 2D1HA 2BE5F 3SW3A 4HF1A 5E1ZB 3WE3A 3AF6A 1XM8A 1U5TA 3K1MA 4LD5A 5AXRA 3F22A 4GCVA 3FF5A 5AIPA 4LLLA 5ACSA 3GW2A 1JHFA 2VE9A 3WGGA 2XF4A 1O3SA 1IF1A 1AWCA 4LK1F 2GXGA 3LFKA 4YFNF 1KQ0A 2QJSA 2IW5A 3WODF 3P7NA 3EYIA 2P4WA 1AOYA 3ZNBA 1SD7A 1YW7A 3JAMK 4P9FA 4BXUA 1HBXG 4L9TA 1QQIA 1R1TA 4AIKA 4HA8A 4TZBA 1Y44A 4KYWA 5IT9K 3WTVC 2FMYA 1U3EM 4XUKA 2L54A 3QPHA 4TYTA 2O61A 3JSPA 1BI1A 2RV8A 2GA1A 2ZNBA 4XLPF 3MEXA 1EV7A 1FPQA 2DK8A 3SXYA 3ZN0A 4FHTA 4EYLA 1XCBA 2RC4A 3B02A 4C1FA 3BV6A 2GQQA 2FNPA 5IT3A 4KUMA 4HAMA 3RPUA 1YIOA 2ZBKA 5HLIA 3GLXA 4PVTA 3D0SA 4UWSB 5E17F 2LF7A 3RKWA 5HH5A 3F6OA 2WYMC 4RM5A 3L2CA 4I0AA 5ILVA 1LEBA 3CTAA 2VN2A 4A5NA 1UHMA 1R5HA 4NQWA 3TDUC 5K5QA 4AX0B 2V6CA 2NAZA 3DP7A 2XAGA 1G6NA 5AEBA 2BMIA 2K4BA 5D5VB 2Q9UA 4HQMA 2FQ3A 3SD9A 3WGHA 2CFXA 2PN6A 3VQZA 3H3EA 2O8XA 4PGHA 3KETA 2NZEA 5DUKA 2Z3YA 4ETSA 2ZNZA 3GUDA 2ZXJA 2H94A 4EFZA 2A61A 1XTOA 1BM9A 2LNBA 3IEMA 2P97A 1FZPB 3GFJA 3HTUA 5D4RA 2M5DA 1V4RA 3EQLF 1SMYF 1XDSA 1T6SA 3I0VA 4AIHA 2Y0MA 3DHCA 2NRAC 3GF2A 4KNYA 1A8TA 5FGMA 3RYPA 5AONA 1P4AA 2VODA 3U1DA 5LHGA 1T98A 4G7ZF 4ZYDA 2Q0IA 4IXAA 2H09A 5CJ9A 1HW2A 1E17A 4U7DA 4HLXA 1FP1D 4P5OA 5H20A 1TNTA 5K5OA 4CDGA 3P9CA 3DPTA 4XWTA 3ESHA 2A3SA 2OQRA 4ZZLA 3IE0A 3R2UA 1UHWA 5IT9Z 5E8GA 1TQMA 2VOPA 3GO5A 3PQKA 4G7HF 1ZG1A 4H0DA 3NRVA 4RAWA 4G7OF 4CHUA 2K4JA 4LLGF 1KO2A 3ELKA 2PJPA 4KIBA 1XN7A 2O3FA 5ACTA 1WI9A 2BBYA 3KL7A 5HDKA 5LSCA 2WRSA 2ADUA 2FU7A 3QU6A 1MDMA 4G9YA 4LE6A 4UV8A 4NHJA 1SMTA 3MCZA 4KIGA 5FD5A 2YZ3A 2RGVA 5CVIA 3GWZA 3HHHA 3ABUA 2GCUA 2DAOA 1IN8A 3C18A 4GCWA 3IKVA 4EQQA 1G3YA 2YSRA 1U8RA 3RI4A 1QH5A 5J8FA 2WV0A 2FBIA 2HEOA 2W84A 2F5FA 4ZYHA 2H6CA 2K86A 4L5JA 1EH8A 2HYFA 2F5DA 3WTXC 5BPDA 4IPAA 1YCGA 1L9YA 4L5IA 2RNJA 5FLXZ 1P9EA 2PI0A 3WTTC 1BC2A 3ISPA 3WXCA 1FP2A 4AVPA 5LHHA 4UVAA 3BY6A 5HDGA 2VC0A 5D8KB 5D6EA 3ULQB 5HVQC 1S7OA 2EFNA 1J5YA 1ZLJA 3ZPLA 1ONVA 2EFQA 2DPDA 5FFXA 2XUBA 1WRAA 2DK5A 5IQKA 2VBWA 1VTNC 2BYVE 4Y15A 5L3BA 1KYWA 5ACUA 1FT9A 3FAIA 4A6EA 2MD5A 5LRSA 3K2ZA 4HW0A 4Z67A 4ESFA 4YIIA 1W7PD 1SD4A 2FK6A 4R79A 1OMIA 3M8EA 5BPIA 2BG2A 2E7WA 5EVBA 2BG8B 2QDSA 4YSLA 1H0MA 1GVJA 3ZMTA 3KFWX 4DIKA 3J7AO 5A2QK 1Z7UA 1FC3A 3QRFF 4XWWA 2L4MA 1YQAA 1QH3A 5D4SA 2FNAA 5H6QA 1X8IA 3KLNA 2HDCA 2MBFA 5K4MA 2VW8A 1ZG5A 3DV8A 1IAWA 5LM6A 1WUPA 3DH8A 3FXUA 3E5XA 2EV5A 1FBSA 4YFKF 3RPQA 4I7HA 5FQBA 1RI7A 4UVCA 2E1NA 4UNOA 2P18A 3ZR9A 1GHCA 1KU3A 1R1VA 3KCCA 2BEOA 3T3OA 3BK2A 2KIFA 4LK0F 2J5OA 4J5HA 1UCRA 3LA3A 2HKOA 1SD5A 2MH9A 3NEUA 3Q6VA 4UWRB 3HOTA