4AD9A

Crystal structure of human lactb2.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
288
structure length
288
Chain Sequence
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE-LIKE PROTEIN 2
publication title Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF17778 BLACT_WH Beta-lactamase associated winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ad9A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4ad9A01
1G6NA 4F6HA 2NNNA 2ESHA 3ULQB 2FU9A 1H9TA 2NYPA 3BWGA 2HR3A 4FHTA 3BOQA 5HLIA 1FSHA 5FLXK 2ESNA 4O98A 4R1HA 2Y48A 3HTSB 3AAFA 3KP2A 3H3EA 4EM1A 1LB2A 3SPUA 4KMUX 2BGAA 2F5CA 4A2UA 2GAUA 1XGOA 3HSEA 4L18B 2GXGA 3TQNA 2HS5A 2JPCA 3GLXA 2VT2A 1BC7C 4LLNA 4TZEA 2EB7A 2KIUA 3J81Z 4UBQA 5EV8A 4RS8A 4OINF 3ZMTA 4WXCA 3CLOA 3EQLF 4C1GA 5EVKA 3L9FA 3CTAA 5DD4A 4YFNF 1UHWA 4PGGA 2HWVA 1ZG5A 1W5TA 2PFBA 2F5DA 1G3SA 1QZZA 2DPUA 1FPQA 5ED4A 2YZ3A 2E1CA 5HOOA 3LVZA 4AX0B 5LCFA 5FD6A 3DH8A 3CJNA 4O3MA 1I6XA 2HKOA 3CUOA 4I7HA 1TLHB 2W85A 3EETA 1BIAA 4D0PA 2L02A 2QLZA 3IHUA 2FU6A 1ZH5A 3WE3A 1KU2A 5HIQA 4HLXA 1BI2A 4NQ4A 3B02A 3WODF 2OZ6A 3RJPA 3Q6VA 3T1BA 2ZJ2A 3W6KB 4EYBA 1P92A 3C3WA 4R8HA 4ESBA 2VBXA 5EW0A 2EFQA 2W24A 2P97A 3MCZA 1EH8A 2WC2A 4WXHA 4LG0B 2BFLA 4JBAA 2YNWA 1MJAA 1IF1A 3COAC 1YW9A 1TQMA 4MEYF 3DPLC 5EHTA 3R61A 5EV6A 4U88A 3RDIA 4KEPA 3ZWFA 2YU3A 1WUOA 3RKJA 2B0LA 1BI1A 2BGCA 3FCZA 5L3EA 4I2OA 2BV6A 4EV0A 3WTXC 3K0LA 1R1TA 2AZ4A 2XAFA 5LMCA 5AONA 4CO8A 3JAMK 4L0YB 2BG2A 1KQ8A 1HW2A 1W7PA 2DTRA 4Z67A 3QP5A 2QJSA 4QLCU 4AWXB 4XBFA 4UWSB 2P4WA 5E17F 1FYMA 4XWTA 3HOSA 2K4JA 5D5VB 3T5XA 2D45A 4CDGA 3KZYA 2EK5A 1U5TA 2CQKA 4UVBA 5L3GA 1FYLA 2H27A 4HF2A 3KZZA 4EGYA 3SW3A 2BYVE 2HOEA 1BC2A 5AYAA 1XCBA 2MA3A 3IWZA 3IEMA 4M71A 2QINA 2FA5A 2BE5F 3ZMUA 4PVTA 3IOGA 2FU8A 1DD6A 3IE0A 1KR3A 2Z9OA 1IRGA 4YFXF 4KIFA 5AIQA 2OU2A 4BNCA 4I0BA 3KNRA 2ELHA 2V1DA 2EJRA 5BOXA 1BJAA 2VBYA 3FMRA 2QQ9A 2NRAC 1D5VA 4H0EA 2EWNA 1FT9A 3V4GA 1O57A 3ESHA 2BFZA 5KVRA 5BPDA 1Y44A 3LQRA 2M5WA 3M9AA 3HYIA 1FP2A 2IRFG 5FQAA 4JQFA 3EDPA 1QH3A 4PCQA 5LRRA 4RGSA 5K5OA 4Z5ZA 5K0WA 4EJWA 5HH4A 2OQGA 1K07A 4L9VA 3I15A 1HSTA 1L0OC 2Q0IA 3VPEA 4MTDA 4IHTA 2FRHA 4M6YA 2PQ8A 4ESJA 2GXBA 1YG2A 4IF4A 4G7HF 4FR7A 1FP1D 5D4SA 2O03A 5AHOA 5TJJA 2O0YA 3ZQ7A 2BG7A 4LGWA 4IXAA 5AHRA 2ZXJA 4UWRB 3SXYA 4C1FA 3E5QA 3BPVA 3EUHA 3IE2A 2K86A 5D5UB 1SD7A 5H6RA 3LA3A 4H0DA 2A7MA 2P7VB 2WYMA 3J80K 2O6GE 1A8TA 1XB4A 2F2EA 5DPXA 2M5CA 4KA4A 3F8BA 4ZH4F 4AIKA 2EV5A 5FQCA 4Y13A 3KETA 1ZAOA 3SRXA 1DP7P 1DDKA 3FXQA 4PVOA 1EV7A 2MLGA 1MKMA 3ABTA 1BOAA 1CGPA 4A0ZA 2RDPA 1USSA 1XN7A 1ZKPA 3MD7A 4XSZF 4HQEA 1ZNBA 1I27A 4J5HA 5K5RA 4U4LA 1WUPA 4FEKA 5LSCA 4ON0A 5H6QA 2Z3YA 4EYFA 3KFWX 3J7AO 4KFCA 5DDGA 1WRJA 1JHFA 3BROA 5FFXA 5LGTA 5JHUA 4O5VA 4AIHA 4UWOB 1PP8F 1DUXC 2XKOA 4GXOA 3LFKA 2PN6A 5EEGA 1RUNA 1R5GA 1FWZA 3VODA 1A04A 1KGSA 2HQRA 1XGNA 5D6FA 3IEKA 2QENA 3GEZA 1IN7A 1YQAA 3V8JA 1ZRDA 4UAMA 2BIBA 3BK1A 2UYXA 3PG4A 4G94A 1WRAA 2GA2A 2VXZA 2YNTA 4I02A 1KO3A 2L3DA 3E6BA 4U7DA 3IL2A 1ZLKA 3I0TA 3IKTA 4RGXA 5EH9A 2M8EA 2OHHA 5DV5A 1U78A 1YLFA 5HLHA 3WTZA 5ICEA 3ECHA 3SZTA 2P8TA 1OYYA 1D8JA 3RKYA 2FXAA 1IN6A 2QDSA 5LCAA 4LK1F 4EGZA 4OMYA 3L6NA 2ZNYA 1X8IA 2V9VA 5ILVA 5FB2A 3CUQB 2JT1A 4BHBA 1IXRC 2JSCA 2X0LA 1JT1A 5AXRA 3VQZA 1O3QA 3T8TA 2HTJA 1ON1A 2PI0A 3IOFA 2PMUA 3SHFA 1YTYA 3KLNA 4R79A 3BZ6A 2EA4A 4Y17A 1MZBA 2NZEA 4P55A 4BH9A 4LLGF 2IP2A 3PQJA 3T0YA 5HVQC 1XDSA 5LEKA 4HL2A 2ADUA 2W84A 3QH8A 2RVCA 1W7PB 3K69A 1X8GA 1XCVA 2P1EA 2P4ZA 3BV6A 3AF5A 5LLQA 5ACPA 3GZ5A 2Y8BA 1KYZA 1SD5A 3RKXA 3P9IA 1I5ZA 4ETSA 2YNVB 4FT8A 4D1TA 1BI0A 2WRSA 1T0FA 5K1YA 3ELKA 3KNSA 1WKMA 4RAZA 1T98A 1LVAA 2F5EA 5ACXA 2MBFA 2FMYA 5E20A 3JW4A 4HX8A 4F7ZA 4AX1B 2GKLA 2IJLA 2LF7A 1ON2A 1HXDA 1ZG3A 3QP6A 4QWQA 5FO5A 1VJNA 4RL0A 2QBYA 3ZMVA 2EFWA 4Z5YA 3N97A 3GYHX 2AIOA 4EVIA 3L00A 5K5QA 1KU9A 3RI4A 1MJ9A 2EA2A 4CXFA 3Q9SA 4RB0A 3NEUA 4CICA 4EM2A 3Q5FA 2EFNA 3JTHA 5ACUA 3I5UA 1RI7A 1QPMA 2DK8A 1B9MA 4LB5A 4OU0A 5LBQA 3C7JA 3DV8A 2QYOA 3HTUA 1YW8A 1TTYA 2YR2A 3G1PA 4UVAA 2A61A 4ENKA 3GFJA 2HZTA 5ILUA 5CVVA 1KA8A 1VMEA 4KEQA 4EJOA 1FOKA 2L54A 4MEXF 4XWWA 1TQIA 2GMNA 2FEZA 2HB9A 2K7LA 1STZA 2IA1A 3ZMZA 3WGIA 4HQMA 1YFHA 2OAZA 1ZG1A 2BBYA 3FM5A 1HW1A 3RPQA 5ICGA 2M30A 2Z99A 2OHJA 3F9OA 1MDMB 5FGMA 1WI9A 4UWPB 5E1XA 1RZ4A 5F64A 4M72A 2QQAA 1Z91A 4BQAA 2Z33A 2R2DA 4GYUA 4GCWA 1R36A 2CWEA 2M1BA 4KT5C 1PUEE 1HW5A 4RB2C 2EFPA 3F8FA 4YSKA 3GX4X 3ZN1A 1SD6A 1T2KA 3F6VA 3QPTA 1UCRA 1U3EM 1XGMA 4HZFA 3TO9A 3S2WA 1KYWA 2V79A 2DQRA 1WSUA 3I59B 4CHUA 1SD4A 1UB9A 5EWAA 1ZHFA 4D1UA 2Y8AA 3RPUA 2UWMA 2JTVA 3G3ZA 4RAMA 2W25A 2VT3A 3I54A 2IT0A 4ZO3A 2HKXA 3T9MA 1M2XA 2DAOA 2HYGD 3J81K 2FBIA 2XAJA 1YIOA 1LEAA 2XR1A 3HRUA 2HFHA 3V8KA 2BG6A 3A4YA 3HSRA 1ZLJA 4MGRA 1UHMA 1YYVA 2XIGA 1XMKA 2L01A 4LE6A 5LHGA 2HYFA 2IW5A 5H20A 5LGUA 5ICFA 5D4RA 2GFJA 3V7SA 5LGNA 5IT9Z 3RPCA 3JSOA 3CUQC 1OYWA 4B09A 3WTWC 3SFZA 2K02A 2R7FA 3GO5A 4ENNA 3HRSA 2GFKA 1SFXA 1L9YA 3SD9A 5CYVA 5LLDA 2DO7A 1Q1HA 1ZRFA 2H09A 2CFXA 2G7UA 2OZUA 2ETHA 2ZMEA 1S7OA 5K4MA 5EEHA 5K4KA 3LSTA 2WHGA 2Y87A 5ACQA 2X4HA 1JHHA 1TQPA 4KN7X 3CO7C 1KQ0A 1TNSA 5LHHA 4RBSA 1Z7UA 3QPHA 3C18A 3U9GA 2VOPA 2FOKA 4KUMA 5BMZA 3IDZA 4GYIA 2BTNA 1YO5C 2V1XA 3D5LA 3SZPA 4XLPF 3M1EA 1IW7F 1ZGJA 4NHJA 3C1DA 1S29A 4ZYEA 3HSFA 1QH5A 2FQ3A 2PJPA 4G8XA 3MWMA 3LA2A 3EYYA 4CGZA 2LKPA 2PG4A 1QO0D 3BDDA 2BG8B 3I13A 2IVMA 4C1DA 3F8CA 4DNCA 1OKRA 2AXLA 1BMCA 4B8XA 3FAIA 3T3NA 2QVOA 4AD9A 4MHGA 2W57A 5HDGA 2R7DA 1SMLA 5AEBA 1S6LA 2DU9A 1K78B 3MFKA 3R60A 2A6EF 3GF2A 2FK6A 2XAQA 4WF2A 1ZREA 4B87A 2Y0MA 1B1BA 3M8EA 1T6SA 2GWRA 5E8IA 2Q0JA 2XASA 1CF7A 4OOIA 4L9TA 3K9TA 2Q9UA 4HDVA 1J7KA 3F22A 1O3SA 5DYMA 4I0AA 3AJ3A 1GVJA 2QBYB 3KLOA 2HDCA 3LAPA 3W6JB 2MLKA 2KJBA 3GWZA 3CO6C 3O3KA 4GO1A 1REPC 4WXDA 3E5UA 2IPQX 2FE3A 1TW2A 3FXUA 3N4MA 1BVTA 4YSLA 4M9XA 1FLIA 3GZ6A 2UXXA 2WYLA 2VW8A 1S8NA 3WXCA 3CDHA 3BC2A 1IRFA 4HYEA 1LDJA 4HF1A 1HQCA 3TDZC 4YIIA 1O3RA 3RKWA 3SFPA 3P9CA 4CHLA 2XKPA 3WTTC 2FU7A 2BFKA 4PZJA 1W5SA 4UVCA 4A6EA 3VFZA 2ISYA 2GCUA 5LRSA 3HUGA 3TGNA 1U6GA 4A5MA 3NQOA 4XLNF 1MQOA 4KNYA 1U8RA 4U0YA 3I14A 1TW3A 2XV4S 1O7FA 1HBXG 1IN5A 4P62A 1I1SA 3FWEA 4AWYB 4HV6A 4BHPA 1FY7A 4OMZA 1UFMA 1F1ZA 2Q0OA 1LEBA 3RYRA 2JPBA 4GGGA 4BYYA 3V8LA 5JFRA 3FF5A 1FC3A 4UV9A 4EYLA 1X3UA 3F6OA 2QEDA 2OQRA 2NS0A 3B73A 3I11A 1B9NA 4HA8A 2CGPA 4HW0A 5HIOA 5KK1A 3DFGA 4UV8A 5FFZA 1XMAA 2O8XA 2A6HF 1Z6RA 4PDKA 2LF8A 1SAXA 3HHGA 4KIGA 2BR6A 2GA1A 1U2WA 4GYGA 4M74A 3SBLA 3DQVC 5IT3A 4XUKA 3GFLA 4P9UA 3H92A 3WU1B 1IZ1A 3IRRA 1ODDA 5BS6A 4EM0B 3ZMSA 4BXUA 1R00A 3I53A 2VONA 4Z7RA 5J6XA 1XM8A 1Z05A 3ZMDA 3IKVA 1I1GA 4ZZDA 4RGRA 2CG4A 2G7HA 5D8KB 4NQ5A 3BK2A 2FNPA 1FSEA 3BJAA 1R5HA 1OMIA 4RL2A 3E6DA 3KE2A 3WTYC 3KEOA 3F8MA 1DDNA 2LDUA 3WGHA 4TYFA 2NNYA 4GYQA 3KL7A 2COMA 4LD5A 4V0HA 3X30A 1QZYA 1Z6TA 2OBPA 5LS3A 3M7GA 5DEQA 2ZWRA 2EV0A 1K6OA 5ACSA 5DUKA 1ZGAA 4HBLA 4EJTA 2P6SA 1XGSA 2H6BA 1HKTA 3H3ZA 4AWZA 1JJEA 1V3FA 5EVBA 2BC2A 4LLLA 3RTRA 2FF4A 3MZYA 4EJVA 1K79A 2CBNA 4JO0A 1VTNC 4ZYHA 5CVUA 5ACRA 2ZMEB 4ZYGA 5JVTA 1MJBA 4LMYA 2ZNBA 1J9IA 4RM5A 3MAJA 2FU4A 1J75A 1ZN2A 4Y15A 1QBJA 4AVPA 5B3RA 4TZBA 3ZR9A 3ML6A 3OV8A 1HKSA 1XD7A 2D1VA 3TKYA 4TZ9A 3K2ZA 4HX7A 5FQBA 2FSWA 2QUFA 4J5FA 2ZKZA 4L5IA 5J8FA 1MGTA 3IC7A 5CVRA 3FMSA 5LHIA 1ZTCA 3F8NA 1LQ1A 5HISA 1IXCA 1U5TB 4HX4A 1H0MA 2KRFA 2RC4A 5ERIA 3PY6A 4HL1A 5CJ9A 5AIPA 3T3OA 5ILSA 3X2XA 1K7AA 2FHXA 3IE1A 5A0VA 2Q8KA 2KIFA 3VB2A 4L5JA 3WG9A 1YS7A 2VBZA 2M45A 3BPXA 1JJTA 2XAGA 3U1DA 1E17A 4YIFA 1YW7A 1WWXA 4L9JA 1XTOA 2H94A 3V7CA 2VC0A 4HKYA 3FX3A 5E8GA 3TOBA 3GW2A 1S3JA 1FX7A 3RIRA 2VC1A 5DCMA 1E2XA 2K27A 4G7ZF 2BFZB 4RB1A 1G3TA 4PGHA 4OIQF 1FBQA 4HLYA 3X2YA 2R3SA 1HKQA 5BQTA 3DHCA 2MH9A 1JGSA 4KN4X 6PAXA 4LK0F 2STWA 3I64A 4WD6A 4NB5A 4P5OA 5DD8A 5F1RA 4M9ZA 4MQ9F 4U0WA 3SQNA 5KIKA 3MQ0A 5JI6A 3DP7A 5ACVA 3GUDA 1OYIA 2PEXA 3WGGA 4C1CA 4RB3C 4KYWA 1GXPA 4UNOA 4OIRF 2PBIA 2P5LC 4CYDA 5L3FA 1MD0A 2UXNA 3LQQA 2DFIA 1IXSB 3P7NA 5E18F 3HIFA 1EH7A 3HOTA 4M9SA 1SMYF 3S0ZA 1E5DA 3JXPA 4EMSA 3BJOA 4I09A 2EFOA 1R58A 3PY5A 1RNLA 1VGNA 5D5WB 1R7JA 3FZVA 2YSRA 4I98B 2DQLA 1IN8A 4FX4A 3FMQA 2RGVA 3TO7A 1P4AA 2HEOA 4F6ZA 5JR3A 1TBXA 2TDXA 1AOYA 1LNWA 1BC8C 3BJ6A 5K4NA 1H9GA 1T39A 2XAHA 3P9KA 2JRTA 3L09A 2ZBKA 3R0AA 5F6FA 5B15A 4MTEA 1W4MA 3I71A 3F21A 1FBUA 4S04A 3KP6A 4O6JA 2ACJA 2DKFA 2FBKA 4P9FA 2J5OA 3E6MA 3PQKA 2I7XA 3F23A 4WWCA 1ZYRF 3PFIA 3F72A 3T8RA 1KQ9A 1V4RA 3GFMA 5A87A 3REOA 2ZFWA 4G6QA 2E7WA 2CYYA 2IA0A 5HDNA 1W7PD 5HDKA 4BHCA 4C1HA 2RQPA 3WU0A 3EYIA 2GZWA 1G3WA 5CVJA 5BPIA 2GQQA 2VOOA 2WTEA 5ACTA 5AXOA 3E5XA 3VOEA 3JAMZ 4A12A 4ENMA 3ROUA 1AWCA 4U7BA 2XRNA 3LA7A 3DXJF 2MH2A 2A69F 2YX7A 3G73A 4FX0A 2KIMA 4IRHA 2YNTB 2RN7A 1G3YA 3L7WA 3CUQA 2DPDA 4RGUA 2NXAA 3X2ZA 1WW1A 4D02A 2FNAA 1YCFA 3DHBA 5HIPA 1ONVA 1QQIA 5IT9K 4NQ2A 3QAHA 2AS5F 4YSBA 4WCGA 1J2XA 1PP7U 5HS7A 1D8KA 3E3VA 1DPUA 5HS9A 1P4XA 1YCGA 1U5TC 4U0VA 1J5YA 4A0XA 4ZNBA 2CSOA 1EH6A 4G9YA 2ZCWA 2DW4A 1IN4A 2Q2EA 1T38A 2YNVA 1KO2A 4KIBA 4D1VA 1F9NA 2HQNA 2A68F 3ZN0A 4ESFA 5LE1A 3Q9VA 4D1WA 4JK1X 4Z6XA 4UA4A 1O3TA 3R0JA 3BY6A 1BN5A 2EV6A 1FYKA 4UUVA 1B59A 3I58A 4GCVA 1L3LA 1GHCA 3ADRA 3ZNBA 4IPAA 4C1EA 5IQKA 5HS8A 3GXOA 3V7RA 1RIOH 1BM9A 3WTSC 2H6AA 1R23A 3R4KA 2XGXA 4L9NA 2KKOA 5LEJA 3FHZA 4EFZA 1D3YA 1P6RA 3BP8A 4XSXF 4UXNA 2Y75A 4OIPF 2F5FA 1OR7A 2ISZA 3I0VA 2ZNZA 4HAMA 2FHXB 3D0SA 4FSBA 3O6BB 2OA4A 3R6SA 5DUIA 4G7OF 3DEUA 3KP3A 4ENJA 2FMLA 2P5KA 1S7AA 2QDTA 2C6YA 4P96A 2WV0A 1B4AA 4HOBA 4NQ6A 4Z2YA 1IUYA 3IRQA 4Q47A 2LNBA 3J80Z 3ZP5A 2P18A 4K2EA 1MDMA 2K4BA 3K1MA 5J8CA 4DQ2A 2KJCA 5A5ZA 4M73A 3VEPA 2DBBA 4LFUA 5DCMB 1YCHA 3ZPLA 4BP0A 2CW0F 4E70A 4EXSA 1GXQA 4A0YA 3ABUA 4LB6B 5L3DA 2WYMC 1C0WA 2A5YB 4IRGA 2VN2A 3E97A 1P4WA 1XSXA 2XUBA 1ZARA 2NYXA 1WQ2A 1IAWA 3TP9A 4BZ3A 1J0RA 4EY2A 5B1UA 2DT5A 3HRMA 3NRVA 4N9HA 2RKHA 3ISPA 2ZZIA 2E7YA 4ASNA 4YFKF 4XRFA 4RAWA 1SFEA 5EVDA 5D6EA 5LM6A 1Z1DA 2QZ8A 2L4MA 3I59A 3TOAA 2L4AA 2XHKA 3QU6A 3QRFF 3JTGA 1P2FA 3F3XA 4YG2F 1Y0UA 3JSPA 1QNTA 3IELA 1ULYA 2RNJA 5ICCA 1TNTA 3KP7A 5E1ZB 1KU3A 1YS6A 2VODA 3DPTA 2QM3A 2JZYA 5LCHA 1XDUA 1G4DA 2M5DA 2MC3A 3GVAA 4Q5SF 1LJ9A 3H3UA 2NAZA 1JE8A 3MZHA 1BBYA 2P6TA 4L0ZB 3KP4A 4TV7A 5CLSA 1SMTA 3K1NA 5FD5A 4Q48A 3M8FA 4EJUA 2BMIA 1XSVA 5A2QZ 3FXRA 2XF4A 3TO6A 5L3BA 2GIVA 2VBWA 5CVIA 4TYTA 3RKKA 2O3FA 3E6CC 3L2CA 1RUOA 4LG0A 3O2PE 2PLYA 4MNUA 3DF8A 1HLKA 5HLGA 2A3SA 1Z9CA 4ZYDA 4BAYA 3OOPA 4M6XA 4KDPA 2P5VA 1XSDA 4WK8F 2DOOA 4MQVA 2YPRA 4HF0A 4N0BA 2I7VA 5A2QK 2E7XA 4ZEJA 1R1VA 4ZZLA 3MEXA 1SFUA 4EXYA 2BEOA 2QWWA 1F5TA 1FBSA 3TDUC 4NQWA 2NZFA 2FM6A 1PDNC 4TZFA 4KICA 5D8LB 4EQQA 2VE9A 4S05A 3K1PA 4A5NA 4RAYA 2VE8A 3R2UA 2UZKA 3KCCA 4IJAA 1LDDA 2Q42A 3ZQ4A 1A7TA 1O7LA 2FBHA 1P9EA 5A0TA 2P7CB 3KP5A 2PMHA 1DXKA 4Z60A 2OD5A 3KEQA 4HDUA 3WTVC 2BG8A 2LSOA 4C09A 3HHHA 3I4PA 5TRDA 3QU3A 3AF6A 5DCFA 2E1NA 3LAJA 2Z5UA 4CZZA 1FZPB 1NHAA 2G9WA 5D5XB 4WX9A 3GFIA 2HTSA 1K78A 2D2WA 4A6DA 1JXSA 4DIKA 2RV8A 3WTUC 3HRTA 4KMFA 1ZRCA 2IA2A 1OPCA 3ECOA 5ACWA 3IWFA 4HV5A 2V6CA 1R1UA 2MD5A 1BIBA 3DHAA 2O61A 2CO5A 5HH5A 4IVNA 3WE2A 1BI3A 2DK5A 4IRIA 1F4KA 2DI3A 2WWYA 2DLLA 2YX4A 4G6DA 2STTA 5HH6A 1B6AA 1USTA 3ERED 2I7TA 1CF7B 2H6CA 2J5PA 5E1WA 2ZO4A 2M87A 1HSJA 1QGPA 3LWFA 1LDKB 3QOPA 5L3CA 3P2UA 2YNUA 2D1HA 2A07F 5FLXZ 4N9IA 2OHIA 1DPRA 3RYPA 4ZO2A 1FNNA 1R22A 3U2RA 2YCBA 4IHSA 1J59A 4Q4ZF 1KU7A 4I01A 4UHTA 4AIJA 2V1UA 2HGCA 3DKWA 4DILA 2XVCA 3FM3A 4LJZF 1X8HA 5KILA 2XROA 4OIOF 2QQBA
chains in the Genus database with same CATH superfamily
1G6NA 4E7KA 3HOUJ 4F6HA 1ERDA 2KZGA 2NNNA 2ESHA 3HGYA 3ULQB 2KDZA 2W82A 2IGNA 2FU9A 3OY9A 2LP0A 1H9TA 2UV1A 2NYPA 3BWGA 4HPQA 2HR3A 4FHTA 3BOQA 3A01B 2JQ7A 4ZJZA 4DIQA 5HLIA 1FSHA 5FLXK 4M3GA 2ESNA 4O98A 4R1HA 2JA5J 4A3LJ 3V42A 3CJQB 1N78A 3RZOJ 3TL4X 2Y48A 1IGNA 3HTSB 4LITA 3AAFA 3KP2A 4AU7A 2XRLA 4EM1A 3H3EA 1I3AA 1YJWI 1LB2A 3HBLA 3SPUA 4KMUX 3D1NI 2BGAA 2F5CA 4A2UA 2GAUA 4HNVA 3S14J 1XGOA 3HSEA 3TP0A 4BE1A 3A1YA 2O8KA 3HOWJ 1X1AA 4L18B 2GXGA 3TQNA 2ME6A 2H1KA 5EGOA 3ZQCA 2HS5A 2DOFA 2JPCA 2M7BA 3GLXA 3DKXA 2VT2A 1BC7C 4LLNA 1XC5A 4TZEA 3ZOBA 2VQHA 2EB7A 4XM3A 2KIUA 3J81Z 4UBQA 1RETA 5EV8A 2OF7A 4RS8A 4OINF 3ZMTA 2B63J 4YRVA 4HRIA 3QOEA 3CCEI 4WXCA 5J4YA 4BKXA 3CLOA 1J09A 1TWAJ 2QSGX 3EQLF 4ZDLA 4C1GA 2DA4A 5EVKA 3L2UA 2JVGA 3CTAA 3L9FA 2M34A 1Z3YA 5CQEA 2LFBA 1UHWA 5DD4A 4YFNF 4PGGA 3CF5F 1W0TA 2HWVA 2FQ4A 2CH0A 4Y3OA 1ZG5A 2L7KA 1W5TA 2VASA 1D1AA 2PFBA 2F5DA 1ZR2A 1G3SA 1WHUA 3G1MA 1VQ6I 1QZZA 2DPUA 4ABZA 1FPQA 3LL7A 1YI2I 5ED4A 2YZ3A 4B48A 2E1CA 5HOOA 4XRMA 2JN6A 3LVZA 3CDLA 2N8GA 5KAIC 4AX0B 3K4BA 2CV1A 5LCFA 5FD6A 3DH8A 5DTDA 2LY9A 4CCJA 3CJNA 4AXHA 3J7YJ 4O3MA 1X4OA 3HDDA 1AHDP 4PJLA 1I6XA 3CUOA 2HKOA 1MNEA 4I7HA 5TISC 1TLHB 4FE4A 2W85A 1AA7A 4XLCA 3EETA 1NTCA 4IKFA 1BIAA 2DYSH 4D0PA 3Q0UA 2E2HJ 2L02A 3H3VK 2QLZA 3IHUA 2FU6A 3I56I 1ZH5A 4FISA 2DT6A 3WE3A 1KU2A 5HIQA 4HLXA 1BI2A 4XLEA 2CV2A 4NQ4A 3B02A 3WODF 2KDOA 3UR3C 4DJAA 2OZ6A 2KHMA 3RJPA 3Q6VA 3T1BA 2ZJ2A 3W6KB 4EYBA 2KP6A 2ZMEC 1P92A 3C3WA 2PMZA 4R8HA 4ESBA 2VBXA 2LY1A 3RCOA 3JRHA 5EW0A 2EFQA 2W24A 2P97A 2R5ZA 3MCZA 3CCSI 3DCFA 5J40A 1UAAA 1EH8A 2WC2A 4WXHA 4LG0B 2BFLA 4JBAA 2YNWA 1MJAA 2PX9A 3BG6A 2DA3A 1IF1A 3COAC 1YW9A 3BR3A 1TQMA 4MEYF 1D0YA 3DPLC 5EHTA 3R61A 5EV6A 4XR6A 1MMDA 4U88A 3RDIA 4KEPA 2EIKH 3ZWFA 2YU3A 1WUOA 3RKJA 2B0LA 3RQ4A 2CRGA 1BI1A 1H88C 4E7HA 2BGCA 5FLMJ 3FCZA 5L3EA 4I2OA 2EQRA 2BV6A 2GOMA 4EV0A 3WTXC 3K0LA 1R1TA 4PSXA 2XAFA 2AZ4A 5AONA 5LMCA 4CO8A 3JAMK 4L0YB 2BG2A 1T8IA 2JA7J 1KQ8A 2QA4I 1HW2A 3DLLF 2VKVA 1Q1VA 1W7PA 2R93J 2JA6J 2DTRA 4NQWB 1M1EB 4C30A 3PNVA 4Z67A 4NC6A 3QP5A 1ACIA 2QJSA 5JLXA 1OCCH 4DYRA 4Z6YA 5B3SH 4QLCU 4AWXB 3KZIC 3OYNA 3PO3J 4XBFA 4UWSB 2P4WA 5E17F 2DOAA 3OIPA 4CSWA 1FYMA 1R4NB 3HOSA 4XWTA 2K4JA 3CCVI 1Z77A 2VPRA 5D5VB 3T5XA 3RQIA 2D45A 4CDGA 5E3NA 3HOVJ 3KZYA 2V26A 1QHHD 2F6CA 2EK5A 1U5TA 2CQKA 4UVBA 5L3GA 1FYLA 2H27A 2H8RA 4HF2A 1W36C 3KZZA 1OCZH 4QIWN 4EGYA 3SW3A 2BYVE 1ETVA 2HOEA 1BC2A 5AYAA 1XCBA 2K9LA 2MA3A 3IWZA 4J19A 3IEMA 4M71A 1K4SA 2QINA 2FA5A 3FDYA 3C2GA 2F4MB 2BE5F 4B4CA 1YX5A 3ZMUA 3IOGA 2FU8A 4PVTA 1DD6A 3IE0A 4E6KG 2R5YB 1YHQI 1KR3A 1VQ5I 4Y33A 2Z9OA 1IRGA 4YFXF 2E71A 4KIFA 5AIQA 2OCEA 2OU2A 2RQQA 3FBIB 4I0BA 4BNCA 2L0KA 3KNRA 2ELHA 2V1DA 2EJRA 3S1MJ 5E3MA 2WB1N 2E60A 5BOXA 4E7JA 3M1CA 1BJAA 2VBYA 3FMRA 1OCRH 2QQ9A 2NRAC 5GAHJ 3BTCA 1D5VA 3MKZA 3P5JA 2FUG2 2V7FA 4H0EA 4A3IJ 2VQLA 1BL0A 2EWNA 1FT9A 3TMOA 2CQNA 1NH3A 3V4GA 1D1CA 1O57A 3MD2A 3LMMA 5EYRA 3ESHA 1FMWA 1OQYA 2LTPA 5J1YA 2BFZA 3OSGA 5KVRA 5BPDA 2CQXA 1Y44A 2K3PA 3LQRA 2M5WA 1IUFA 3M9AA 2VKDA 3HYIA 1FP2A 3OYGA 2IRFG 5FQAA 4JQFA 3EDPA 3MVPA 3CCLI 4PCQA 1QH3A 1RESA 5LRRA 1KONA 4RGSA 4KISA 4OWRB 2DTZA 5K5OA 2CG3A 4Z5ZA 5K0WA 4EJWA 5C4XJ 2M4GA 2QCOA 1WJFA 5HH4A 2OQGA 1K07A 2DJNA 4L9VA 3JRDA 3I15A 1HSTA 1L0OC 2Q0IA 3VPEA 1QA6A 4MTDA 4IHTA 2FRHA 4M6YA 3H9QA 2PQ8A 3QPSA 4ESJA 2GXBA 1HDPA 1YG2A 3HM5A 4IF4A 2DMPA 5H2FC 4G7HF 2DOEA 2BY0A 2VJJA 4FR7A 4RAFA 1FP1D 5D4SA 2DA5A 1YE9A 2NOJB 2O03A 5AHOA 5TJJA 2G0EA 2O0YA 3ZQ7A 1NG6A 2BG7A 1OISA 4LGWA 3JCUC 3ZQGA 3TEDA 1YRNB 3QWLA 4IXAA 4RM2A 3GTPJ 2JWTA 5AHRA 2ZXJA 4UWRB 3VYSB 3SXYA 4C1FA 3E5QA 3GBGA 2E35A 3BPVA 3EUHA 1Y8QB 3IE2A 1ORKA 3PO2J 2K86A 2WV1A 5D5UB 1SD7A 5H6RA 1TZLA 2QQ8A 3LA3A 1OCTC 4H0DA 2AHQA 2A7MA 2P7VB 2WYMA 3J80K 2O6GE 1QZEA 1A8TA 4F55A 1XB4A 2WA0A 2F2EA 5DPXA 2M5CA 3OOUA 4IOAF 4KA4A 3CCYA 4DYCA 3F8BA 4ZH4F 3K4MA 4AIKA 3TW6A 2EV5A 5IP7J 5FQCA 4Y13A 4PDXA 3KETA 1ZAOA 3SRXA 2LBFB 3OYKA 1DP7P 1VF9A 4QPOA 1DDKA 3FXQA 2IGOA 9ANTA 4PVOA 1EV7A 2MLGA 1DGWY 1MKMA 3ABTA 1FTZA 1BOAA 1Y1WJ 3HOXJ 1CGPA 4A0ZA 2RNGA 2RDPA 1USSA 1XN7A 2QSFX 5FKOA 3FXJA 1PUFB 2L2OA 1ZKPA 5F1JA 3MD7A 4XSZF 1R5ID 4HQEA 1ZNBA 2L9NA 1I27A 3VDXA 5EGOB 4J5HA 5K5RA 3W6VA 4U4LA 1WUPA 4XOTA 1WI3A 4ON0A 5H6QA 4FEKA 2Z3YA 5LSCA 1P7JA 4EYFA 3KFWX 3CCUI 2XF7A 2HVSA 3DU5A 1AU7A 1V55H 3J7AO 4KFCA 5DDGA 1WRJA 1JHFA 3LSIA 3HL2A 2LG4A 3BROA 4XQFA 4MLOA 2DA7A 2WADA 5FFXA 2MGQA 3OYDA 5LGTA 3S16J 4CA0A 5FKMA 5JHUA 4O5VA 4BQNA 4AIHA 1HC8A 4UWOB 1PP8F 5B66C 1DUXC 3JRGA 2XKOA 2V9KA 4GXOA 3LFKA 2PN6A 5EEGA 4BACA 4NNJA 1RUNA 1R5GA 1FWZA 3VODA 3QQAA 1E3PA 1S72I 1A04A 3ERMA 3G1OA 4GDFA 1KGSA 2HQRA 1XGNA 5LD2C 5D6FA 1ETOA 4NDLA 1VQ4I 3IEKA 2F5VA 2QENA 3GEZA 1IN7A 1YQAA 3V8JA 1ZRDA 4UAMA 5M5WJ 2BIBA 3CLQA 2UYXA 3BK1A 3PG4A 4UB6C 4G94A 1WRAA 2GA2A 2VXZA 2YNTA 2X1EA 1V5FA 4I02A 1W0UA 1KO3A 2X6WA 2V6EA 2L3DA 3CMMA 3E6BA 2B9SA 2R7RA 4U7DA 3IL2A 1ZLKA 3I0TA 3IKTA 2IGMA 4MO7A 4RGXA 5FLVA 5EH9A 2M8EA 3CMAI 2OHHA 5DV5A 1U78A 1YLFA 5HLHA 3KYCB 3JRAA 3WTZA 3IH3A 5ICEA 3ECHA 1IJWC 3SZTA 2P8TA 1OYYA 2I10A 3LOCA 1BA5A 2Z1DA 3TBIA 4A3FJ 2CUZA 5EG0B 1MMNA 3FXKA 1D8JA 3RKYA 3K4CA 2FXAA 2KRCA 1IN6A 1B72A 3CC4I 2QDSA 5LCAA 4LK1F 4EGZA 4OMYA 3L6NA 4CCOA 2ZNYA 3FISA 4HEA2 2O5RA 4V2GA 1X8IA 3ONQA 2V9VA 5ILVA 3HOYJ 1LKXA 5FB2A 2X1CA 3CUQB 2JT1A 2EIJH 4BHBA 1IXRC 2JSCA 2X0LA 3G1LA 1JT1A 5AXRA 3VQZA 2DDBA 3CQZJ 4Y7NJ 1O3QA 5FKNA 3T8TA 2HTJA 4DOZA 4A3BJ 1ON1A 2PI0A 3IOFA 2LYCA 4H4KC 2PMUA 3SHFA 1YTYA 3KLNA 4R79A 3BZ6A 2EA4A 5GP9A 1ETKA 1DQUA 4Y17A 1MZBA 3QYFA 2NZEA 4XONA 4P55A 5GAEJ 4BH9A 4BJ6C 4LLGF 2IP2A 3PQJA 3H9GA 3T0YA 5HVQC 1JUMA 3ZQIA 1XDSA 1QVTA 3IUOA 5LEKA 2ADUA 4HL2A 2D5VA 1HOMA 2NVQJ 2W84A 3QH8A 2RVCA 4X6AJ 1W7PB 1KZHA 1SC7A 3K69A 1X8GA 1FMVA 1XCVA 4EEFG 2P1EA 2EILH 5FROA 1A6IA 2P4ZA 3K70C 3BV6A 3AF5A 5LLQA 4A3CJ 5ACPA 3GZ5A 2Q2EB 1PVEA 2WAQA 2Y8BA 1KYZA 1SD5A 3H5AA 3P9IA 1I5ZA 3RKXA 4ETSA 4FT8A 2YNVB 1BI0A 5F0FA 1T0FA 5K1YA 2WRSA 3ELKA 3KNSA 3OR2C 3E0JB 1WKMA 4RAZA 1T98A 1LVAA 2F5EA 2CV0A 2OPTA 3A2KA 2MBFA 1VQOI 5ACXA 2FMYA 5E20A 3JW4A 4HX8A 4F7ZA 1AKHA 2GKLA 2IJLA 2LF7A 5AJLA 1Y6IA 1ON2A 4AX1B 1HXDA 1ZG3A 3QPLA 1X2MA 1X3WB 3QP6A 2NXNB 1Z21A 5EDNA 1H8AC 3GMEA 4M3BA 4QWQA 5FO5A 1VJNA 2X6XA 4RL0A 2QBYA 3ZMVA 2EFWA 4Z5YA 3N97A 1N75A 3GYHX 2AIOA 4EVIA 2CUEA 3DBLB 3L00A 2ZJPF 5K5QA 3OIOA 1KU9A 3RI4A 4BJTA 2KLOA 1MJ9A 2EA2A 4CXFA 3E7LA 4BEHA 3Q9SA 4RB0A 3NEUA 4CICA 5IOYA 4EM2A 5KHDA 2EFNA 3Q5FA 1X1BA 2JUGA 3JTHA 4M6VA 3I5UA 2GXAA 5ACUA 1RI7A 1QPMA 1APLC 2DK8A 4D5CA 4UUSA 1B9MA 4LB5A 3K2AA 4OU0A 3S15J 3SFIA 5LBQA 2WAEA 3C7JA 4A3KJ 3S3NA 3DV8A 1R6RA 2XSJC 2QYOA 2ZB9A 3HTUA 1YW8A 2AXTC 1UZCA 1TTYA 2YR2A 4V19K 4UVAA 3G1PA 4FTHA 2A61A 4IHWA 1MNDA 5E79C 4ENKA 3GFJA 2HZTA 5ILUA 5CVVA 3G4SI 5HNFA 1KA8A 1VMEA 4KEQA 1I3QJ 4EJOA 1FOKA 3K4JA 2L54A 4MEXF 1ZK8A 4XWWA 1TQIA 1UMQA 2GMNA 2ECCA 2FEZA 2HB9A 2K7LA 3SJMA 1IDZA 1STZA 2IA1A 3ZMZA 3WGIA 1N77A 1TC3C 2MD0A 2R7VA 5M3MJ 3DTEA 1S5LC 1K83J 4HQMA 3RPUD 3SEQA 1YFHA 3W2AA 1TP4A 2OAZA 1ZG1A 2BBYA 1EF4A 1U8BA 3FM5A 3ZXSA 4RAGA 1VQNI 3IDZA 4M3FA 2WAFA 1HW1A 3RPQA 5ICGA 1G59A 3L2VA 2M30A 2CMPA 1VQMI 2Z99A 2OHJA 3F9OA 1MBEA 2DFEA 3TP3A 2H8WA 3H36A 1MDMB 2HPMA 5FGMA 4OIOF 3MN2A 1WI9A 4UWPB 5E1XA 2XPVA 3GTLJ 2HI3A 1D5YA 1RZ4A 5F64A 4M72A 1HF0A 2QQAA 1Z91A 4BQAA 2Z33A 1WCMJ 2Y69H 3AL0C 2R2DA 2M0CA 4GYUA 3LSMA 4BU2A 3QYBA 3DBRB 4GCWA 1R36A 2X6OA 4II2A 2CWEA 2HVQA 2M1BA 3BR6A 4KT5C 4YIRX 1PUEE 2KISA 4XKWA 1HW5A 1UELB 4RB2C 1WPKA 2EFPA 3HPGA 3F8FA 1B8IB 2VJ5A 1R9TJ 4YSKA 3GX4X 1OCOH 3ZN1A 1SD6A 1T2KA 3F6VA 3H1CA 3LSKA 3QPTA 1UCRA 1U3EM 1XGMA 1HCRA 4HZFA 2P81A 1JJ8C 3H35A 3TO9A 3S2WA 3BR1A 1D0ZA 1KYWA 3LSJA 1TL8A 2V79A 2DQRA 4PFOA 2YUSA 1FTTA 1WSUA 3EUKL 3I59B 4CHUA 1SD4A 4RLFA 3I3LA 1UB9A 1YOVB 5EWAA 5GAGJ 1ZHFA 4D1UA 2Y8AA 1ETWA 3PFYA 4XKBA 3RPUA 2UWMA 2JTVA 2DFHA 4BGDA 3G3ZA 3IP4B 2BHYA 4RAMA 2W25A 1VQ7I 2HOSA 2VT3A 2R7WA 3PM1A 4ZTJA 3I54A 2IT0A 3SZGA 4IOCF 4ZO3A 2HKXA 1SVMA 2ME0A 3T9MA 2GLOA 3FKJA 2VIXA 1M2XA 2VUMJ 2E2IJ 4IHXA 2K9MA 2DAOA 5J3LA 3U1KA 2HYGD 2QF7A 4QPQA 5GTIC 3NWTA 4I6ZA 3HGGA 5DM7F 3J81K 1CQTA 4NC8A 1VFCA 3BG9A 2VQCA 2FBIA 3CMEI 3FXMA 3KPHA 4D7NA 2XAJA 1YIOA 1LEAA 2XR1A 3HRUA 3ABKH 2HFHA 1SFKA 3V8KA 2BG6A 3A4YA 3HSRA 1ZLJA 2M4KA 1UHMA 1YYVA 2XIGA 3FXLA 4MGRA 1XMKA 2L01A 4LE6A 3H9JA 5LHGA 2BW3B 1V5GA 2HYFA 2IW5A 2V9PA 5H20A 4M3EA 5LGUA 2ZJRF 1WJDA 5ICFA 4RDUA 1U9NA 5D4RA 3S2DJ 3V7SA 2GFJA 1XTAA 5LGNA 4XNFA 5IT9Z 3RPCA 3JSOA 3JRFA 1T56A 3CUQC 1X19A 4F93B 4F92B 1OYWA 4BQQA 4B09A 3WTWC 1JT6A 4DBRA 1Z67A 3SFZA 2K02A 2R7FA 3GO5A 2Y0SN 4ENNA 2IS4A 3HRSA 2Y9YA 2GFKA 1SFXA 2DN0A 1L9YA 4ZYAA 4F91B 3SD9A 5CYVA 5LLDA 2HVRA 2MSYA 2DO7A 1Q1HA 2VQGA 3HKZA 1ZQ3P 1ZRFA 2K85A 2H09A 2CFXA 2G7UA 2OZUA 3KEYA 2Q1ZB 2L9SA 2ETHA 1W36D 2ZMEA 1S7OA 4YELA 1IG7A 2JSPA 5K4MA 3K4NA 3JR9A 2ELJA 2LD5A 5EEHA 5K4KA 4BJ5C 3VPRA 1Y39A 2P0WA 1WJCA 2MYSA 3LSTA 3PSFA 2WHGA 5TGTA 2Y87A 4G6TB 3W2WA 5ACQA 2X4HA 5JLWA 1RC9A 1JHHA 3S1NJ 1HA8A 1TQPA 4KN7X 2R7ZJ 3CO7C 1KQ0A 5K7FA 2BZTA 1ZR4A 1PYVA 1TNSA 5LHHA 3L2WA 1B72B 4RBSA 1R49A 1Z7UA 3QPHA 4C3HJ 5J4VA 3C18A 1VI0A 2XF5A 3U9GA 1LFPA 2VKHA 2FOKA 2VOPA 2BVMA 4MIMA 4PSWA 1RKWA 2KQRA 4KUMA 5BMZA 4GYIA 4XLAA 2R7QA 1YO5C 2V1XA 2BTNA 1IRXA 3D5LA 3SZPA 4XLPF 2DA2A 5KNLA 1OFCX 2HQAA 3M1EA 3J7ZI 1IW7F 2X9DA 1ZGJA 3FXOA 3S93A 4NHJA 4JOMA 4PJMA 3C1DA 1S29A 4ZYEA 2VPLA 2L9RA 3HSFA 1QH5A 2FQ3A 2PJPA 4G8XA 3GTGJ 2ZSHB 5EZGA 3H5RA 3MWMA 3LA2A 4W97A 4Y4RA 1PJRA 3EYYA 2LKPA 2PG4A 1QO0D 2DYRH 3BDDA 4BY7J 2IVMA 4CGZA 3F8CA 2BG8B 3I13A 2E1OA 4DNCA 4UUTA 2PJRB 3DKYA 1OKRA 2AXLA 4AYBN 1BMCA 4MFDA 4B8XA 3GTJJ 3FAIA 3T3NA 2QVOA 3N05A 4AD9A 4FCYA 4MHGA 2W57A 5HDGA 2R7DA 1SMLA 3PIPF 5AEBA 1S6LA 1U0JA 1JKPC 2DU9A 1WH7A 1K78B 3MFKA 3R60A 2A6EF 4I99C 3GF2A 2FK6A 3VYUB 2XAQA 3HB9A 2DA6A 4LOCA 4WF2A 1ZREA 1MBFA 4B87A 2Y0MA 1OR7C 4S0HB 1B1BA 3M8EA 2K5CA 2HQ5A 5F27A 1T6SA 2GWRA 5E8IA 2Q0JA 2XASA 3ESWB 1CF7A 4OOIA 3MZ8A 3AG1H 3HC7A 4L9TA 3K9TA 3F9KA 2Q9UA 1BOBA 4HDVA 2KFDA 1J7KA 4MFEA 2ZXIA 2FOWA 3FK7A 3F22A 1O3SA 1WJ5A 5DYMA 1ZTRA 2HNHA 4I0AA 4C9YA 3AJ3A 3CCQI 2E34A 1GVJA 2QBYB 3KLOA 3A03A 2CQQA 2HDWA 4XICA 3LAPA 1EKEA 3W6JB 2W7NA 3FK6A 2HDCA 2MLKA 2KJBA 3GWZA 4BL0B 3CO6C 3DU6A 3O3KA 4GO1A 4HNUA 1REPC 4WXDA 2ZC2A 3E5UA 2IPQX 5IYBJ 3CP2A 4PJNA 4BEHB 1SVLA 3FIWA 2FE3A 3OYLA 1TW2A 3FXUA 1IDYA 3N4MA 2DMTA 2JJ7A 2KIQA 1BVTA 4YSLA 2Y2ZA 4M9XA 3VYRB 3VYTB 1FLIA 3GZ6A 1NK2P 2R92J 1MH3A 2UXXA 4HG2A 3PIOF 2E36A 4C3JJ 2WYLA 2VW8A 1S8NA 3NARA 3WXCA 3CDHA 3BC2A 1IRFA 2KT0A 4BY1J 4RBOA 2E5NA 4HYEA 2DJIA 2ZXWH 1LDJA 3A01A 4HF1A 1HQCA 3TDZC 3Q3SA 4YIIA 3ZQLA 1O3RA 2R7SA 3MKLA 3RKWA 3SFPA 3P9CA 1SFOJ 3O8GA 5FKKA 4CHLA 2XKPA 3WTTC 2FU7A 2BFKA 4PZJA 1W5SA 4UVCA 4A6EA 3VFZA 2ISYA 5DM6F 2I8DA 1RPWA 5DS9A 1N25A 4XOPA 3IV5A 3G2BA 2GCUA 5LRSA 5HLTA 2X51A 3HUGA 3TGNA 4GRIA 4XKCA 3PUBA 4F3QA 1U6GA 4A5MA 3NQOA 4XLNF 1MQOA 3WHCA 4KNYA 1YJNI 4PJ0C 3MKWB 1U8RA 4U0YA 3I14A 1TW3A 2XV4S 5BNGA 1O7FA 1HBXG 1IN5A 4B47A 4P62A 1I1SA 3FWEA 4ZDOA 3OL4A 4JP0A 4AWYB 4HV6A 4BHPA 1X4PA 1FY7A 1E3OC 4OMZA 1UFMA 3Q0VA 1F1ZA 2L9VA 2Q0OA 1LEBA 3RYRA 3JREA 2ID3A 2JPBA 4GGGA 4BYYA 3V8LA 5IP6A 3ASOH 5JFRA 3FF5A 3CMYA 2E5ZA 1FC3A 4DGWB 4OAZA 3BR2A 2YU9J 4UV9A 3FBNB 4EYLA 4DYQA 2M7AA 1X3UA 3F6OA 5M3FJ 4CCLA 2WY7Q 2QEDA 5E3LA 2OQRA 2NS0A 3B73A 3I11A 1B9NA 4HA8A 2CGPA 4HW0A 5HIOA 4BBSJ 5KK1A 3DFGA 3OS2A 4UV8A 5FFZA 3UKGA 1XMAA 3OMYA 2O8XA 2A6HF 1Z6RA 3IAS2 4PDKA 2R7UA 2LF8A 1SAXA 1X1CA 3HHGA 3QODA 4KIGA 2BR6A 2GA1A 4HSTA 1U2WA 2ECBA 4GYGA 4BDZA 3L2RA 4M74A 3SBLA 2RREA 3DQVC 5IT3A 1JUSA 3GCMA 4XUKA 5GADJ 1RKTA 3H5NA 3GFLA 4P9UA 1Y56A 3H92A 3RZDJ 3WU1B 1IZ1A 2ZJQF 1ZELA 4XRSG 3IRRA 1ODDA 5BS6A 1MBGA 4JX4A 4A69C 3OWTA 1MBKA 4EM0B 3ZMSA 3PNTA 1JKQC 4BXUA 1R00A 3I53A 2VONA 4LIUA 3GTOJ 4Z7RA 5J6XA 1XM8A 1Z05A 3ZMDA 2HDDA 1R71A 3IKVA 1I1GA 3MMYB 2XC7A 3S8PA 3BTJA 1G8XA 4ZZDA 4RGRA 1MMAA 2CG4A 2G7HA 5D8KB 2CG2A 4NQ5A 3BK2A 2FNPA 5IY5H 1FSEA 3BJAA 1R5HA 1OMIA 4W1UA 5IYCJ 4RL2A 2CW7A 3E6DA 3KE2A 3KEOA 3WTYC 3F8MA 1DDNA 4E7LA 4B44A 2LDUA 2W1OA 3WGHA 4TYFA 2NNYA 2VJ4A 2L7FP 5HNHA 3GZNB 1MNMC 3GTKJ 5LFAA 4EATA 4GYQA 4HSRA 3KL7A 2COMA 3OYFA 4LD5A 1S9HA 4V0HA 3X30A 2JRMA 5B1BH 1QZYA 1Z6TA 2OBPA 5LS3A 3M7GA 2BOLA 3ZGKA 1WJEA 5DEQA 3K70D 2XF6A 1A35A 2ZWRA 2EV0A 2A5WA 5JVGF 2R5ZB 1K6OA 3VWBA 5J47A 5ACSA 3BT9A 5DUKA 1ZGAA 2M0MA 2R4GA 4HBLA 4EJTA 4X0GA 3CC7I 2P6SA 1XGSA 2KL4A 2H6BA 1HKTA 4NURA 3H3ZA 4AWZA 1JJEA 1Y0NA 5EEAA 2ICWG 2OTLI 2WY8Q 1V3FA 2QKMB 2WB1A 2NOGA 5EVBA 1NG7A 2BC2A 1XG1A 4LLLA 3RTRA 1MBHA 2FF4A 3MZYA 4EJVA 4IZZA 1K79A 2CBNA 4JO0A 1VTNC 2KMUA 3PL8A 4ZYHA 5CVUA 3S1RJ 5ACRA 2BY1A 2XGEA 2ZMEB 3CJTB 4ZYGA 3JRCA 5JVTA 1I50J 1MJBA 4LMYA 2ZNBA 1J9IA 4RM5A 2AQEA 1X1DA 3MAJA 2FU4A 1IV8A 1J75A 1ZN2A 4Y15A 1QBJA 4AVPA 5B3RA 1IRZA 4TZBA 3ZR9A 2JVHA 1EJ9A 4CH7A 3I9V2 3ABMH 2JUCA 3ML6A 3O8HA 1JGGA 2QKLB 1WGXA 2LH9A 3OV8A 1HKSA 1XD7A 2HYJA 2D1VA 2IS1A 3TKYA 3OS1A 3K2ZA 4TZ9A 4HX7A 4UB8C 3CF2A 5FQBA 2FSWA 2PMZN 3CESA 4KT6A 2K9SA 3OR1C 3OYEA 2NS8A 1ZGWA 4FQGA 3M07A 2QUFA 4J5FA 1JTYA 2ZKZA 4L5IA 5J8FA 1MGTA 1MBJA 3D5SC 3IC7A 5CVRA 3FMSA 5LHIA 1ZTCA 3OSFA 3F8NA 2FD5A 1LQ1A 1VQ9I 1A36A 4RM3A 5HISA 2BXYA 1IXCA 1U5TB 4HX4A 1H0MA 2EBIA 2KRFA 2RC4A 2CQ7A 2EZLA 3NAUA 4AVZA 5ERIA 3PY6A 4HL1A 1IO2A 3GTQJ 5CJ9A 5IOZA 4D5FA 2DFFA 4NC7A 5AIPA 1FOYA 3NWSA 3T3OA 3LNQA 1UG2A 3IH2A 4JX6A 5ILSA 1X1PA 2DODA 3X2XA 1K7AA 2FHXA 3IE1A 4U87A 1X3ZB 2F48A 5A0VA 2Q8KA 3E1SA 2KIFA 3VB2A 4L5JA 3WG9A 2BHZA 2H1LA 5CQGA 2OUMA 3G71I 1MMGA 4XKVA 1YS7A 3FKIJ 2R7XA 2VBZA 3K6GA 4C3IJ 2M45A 2M9HA 3BPXA 4BQOA 1JJTA 2VKEA 2XAGA 3OYMA 2A05A 3U1DA 1E17A 3WHBA 4YIFA 1YW7A 1WWXA 4L9JA 1XTOA 2H94A 3ZR8X 3BTLA 3V7CA 2VC0A 3L2QA 5B1AH 3FX3A 4HKYA 5E8GA 4X1EA 3TOBA 3GW2A 1S3JA 1FX7A 3RIRA 2OTJI 2VC1A 5DCMA 1E3HA 1E2XA 2K27A 4OAYA 4G7ZF 4RB1A 2BFZB 4J01A 1G3TA 4PGHA 4BE0A 2YHEA 4OIQF 1FBQA 4D7MA 2VL8A 4RLQA 4HLYA 3X2YA 2R3SA 4ITVA 1HKQA 4QSHA 3WU2C 4BUPA 2Y31A 5BQTA 2HU9A 3DHCA 2MH9A 1JGSA 4KN4X 6PAXA 4PFPA 3A4CA 4CCNA 4LK0F 2STWA 2F4IA 3I64A 3HZJA 4WD6A 4NB5A 4P5OA 5DD8A 5F1RA 4M9ZA 4MQ9F 1YRNA 2LY2A 4U0WA 3VSKA 4A3GJ 3SQNA 2RAEA 3OYBA 5KIKA 3MQ0A 2MW8A 3LSPA 1I39A 5JI6A 2R0QC 3DP7A 5ACVA 3D5RC 3GUDA 1OYIA 2PEXA 4C1DA 3WGGA 2AO9A 1NK3P 4C1CA 4UY8I 4RB3C 1FEXA 4KYWA 1GXPA 4UNOA 4OIRF 2PBIA 2P5LC 3HXLA 4CYDA 5L3FA 3OYHA 1MD0A 1SVOA 4YEJA 2UXNA 1I6HJ 3LQQA 2DFIA 1IXSB 3P7NA 5E18F 3AG4H 1T95A 2UUZA 3DLAA 3HIFA 1EH7A 3HOTA 4M9SA 1ETQA 1SMYF 1XMXA 3S0ZA 2Y30A 1XS9A 2LLKA 1E5DA 3JXPA 4FETA 4EMSA 1ENHA 3LFUA 3BJOA 4I09A 2LBFA 2EFOA 1R58A 3PY5A 1RNLA 4NUBA 1VGNA 5D5WB 1R7JA 2V4JC 3FZVA 2YSRA 4I98B 2DQLA 2BY2A 4XK4A 1GDTA 1IN8A 5F08A 2JMWA 4FX4A 3FMQA 2RGVA 3HUGB 2LOOA 3TO7A 4IO9F 1P4AA 1PUFA 2HEOA 2ZSIB 4F6ZA 5JR3A 4G12A 1YJ9I 1F36A 1TBXA 2TDXA 2XB5A 1AOYA 1LNWA 2EZIA 1BC8C 3BJ6A 1A31A 5K4NA 1H9GA 2ELKA 1T39A 1YIJI 2XAHA 3P9KA 2JRTA 3EPZA 2R7OA 1LPQA 3L09A 2ZBKA 3R0AA 5F6FA 5B15A 4MTEA 1W4MA 3I71A 3F21A 1W1WE 3Q0WA 1IV6A 2F4OB 4IQJA 1FBUA 4S04A 2VXDA 3KP6A 2VLAA 3DTKA 5A23A 4O6JA 1Z7LA 2ACJA 2DKFA 2FBKA 4P9FA 2J5OA 1HDDC 3E6MA 3PQKA 1MH4A 3B6AA 2I7XA 3F23A 1JJ6C 4WWCA 1A5JA 1H89C 1ZYRF 4CYCA 3K7AJ 1GVDA 4M3DA 3W3CA 3PFIA 3F72A 2HXOA 2QGUA 1MW7A 4IQ4A 3T8RA 1KQ9A 4DZJA 1V4RA 3GFMA 1LE8A 5B5EC 5A87A 1W5CC 1Y1VJ 3REOA 2ZFWA 4G6QA 4KJZA 2E7WA 2CYYA 4A3EJ 1EA3A 3ZQHA 3AKZA 2IA0A 5HDNA 3U21A 1W7PD 5C3EJ 3CD6I 1X58A 1DP3A 2YS9A 4BHCA 5HDKA 2IXSA 4CCKA 4C1HA 2K9NA 2RQPA 2OV7A 2VJIA 3UNGC 2O9LA 1ETYA 3CJRB 3WU0A 3EYIA 1VZ0A 2GZWA 1G3WA 3HJEA 5CVJA 5C44J 4XRSA 5BPIA 2GQQA 3K4LA 3DPUA 3AG2H 2VOOA 2WTEA 1WH5A 5ACTA 5AXOA 5FJ8J 3E5XA 1VQ8I 3VOEA 3JAMZ 2ID6A 5EG0A 4A12A 4ENMA 3ROUA 1AWCA 2DT7B 4U7BA 2XRNA 3LA7A 4RA2A 5M5YJ 3PSIA 1SANA 3DXJF 2MH2A 3S2HJ 2MABA 4XLHA 2A69F 2YX7A 3G73A 2L7ZA 2KIMA 3BTIA 4FX0A 2RN7A 4IRHA 2YNTB 1G3YA 3L7WA 5J1RA 3M3YJ 2Z2SB 3CCMI 3CUQA 2DPDA 1OJLA 4RGUA 2X1DA 1D1BA 2NXAA 3X2ZA 3RSNA 1WW1A 4D02A 2FNAA 1YCFA 1WJBA 3DHBA 2BY3A 5HIPA 1ONVA 1QQIA 4PUSA 1OLTA 4ZDPA 4BXXJ 4CUGA 5IT9K 4A3MJ 1Z0XA 4NQ2A 3QAHA 1FOWA 2TCTA 1VQPI 2AS5F 4XN0A 4YSBA 3SDBA 3KYLA 4WCGA 1J2XA 2X6YA 3FHNA 1YITI 4HNTA 1PP7U 4IHYA 5HS7A 5IYDJ 4A93J 1D8KA 2GOXB 4AM3A 3E3VA 1VQLI 5AIJA 1DPUA 1LFBA 5HS9A 3M4OJ 1P4XA 1P9QC 1YCGA 1U5TC 4U0VA 1J5YA 3L1PA 5IP9J 1QRYA 4A0XA 5FRMA 2CS3A 3OL3A 4ZNBA 2CSOA 1EH6A 2IAIA 4G9YA 2Y9ZA 5F0HA 1Y8RB 1WZ2A 2ZCWA 2DW4A 3AG3H 2LREA 1IN4A 1MMSA 2Q2EA 4XL9A 1T38A 2LR8A 1DU0A 1QVUA 4PK4A 3S3OA 3LSHA 2YNVA 3ASNH 1QHGA 3RKQA 1KO2A 4KIBA 4D1VA 1F9NA 3S1QJ 2HQNA 2A68F 3ZN0A 1JI8A 4ESFA 5EZHA 5LE1A 2XGDA 3Q9VA 2HOTA 4D1WA 4JK1X 3GLLA 1UHSA 2NVUB 4UA4A 4Z6XA 1S7EA 1O3TA 3R0JA 3BY6A 1BN5A 2EV6A 4A3JJ 4N4NB 4DW6A 1FYKA 2LMDA 4UUVA 1B59A 3I58A 3BLYA 4GCVA 1LFUP 1L3LA 3IH4A 1GHCA 3ADRA 3ZNBA 2CFZA 3M8JA 4IPAA 2X48A 4C1EA 3ZCOA 4FASD 2AQFA 5IQKA 5HS8A 3GXOA 2BVLA 3V7RA 1RIOH 1BM9A 3WTSC 2H6AA 4XORA 3S17J 1R23A 3R4KA 3LSRA 1MSFC 3W2VA 2LC2A 2XGXA 3PJRA 4L9NA 4PJJA 1BR2A 4XIDA 2KKOA 5LEJA 3K10A 1AKHB 3FHZA 5K7HA 5EF6A 4D1QA 4EFZA 1D3YA 5M5XJ 1P6RA 3C2HA 4AUXA 3BP8A 3BQYA 4XSXF 2EH3A 3A0BC 2K9QA 2Y75A 4UXNA 1RR7A 3DTIA 4OIPF 3CDIA 4D9JA 2F5FA 1OR7A 1BR1A 1TWCJ 2EZKA 1GV2A 2ISZA 3I0VA 2XSDC 4E7IA 2ZNZA 2W4SA 1D0XA 3I55I 4HAMA 2FHXB 3D0SA 4Y52J 4FSBA 1TWGJ 3O6BB 2IS2A 2OA4A 3R6SA 2GM4A 5DUIA 4G7OF 1U9OA 4B3AA 3DEUA 3KP3A 5EJCA 3WG7H 4C2TA 3ZQQA 1FOXA 4ENJA 2FMLA 2P5KA 1S7AA 2EZHA 1JT0A 2QDTA 3BZCA 4UUSB 4BXFA 5KCMA 2C6YA 4XN3A 2WAQN 4P96A 2L5QA 2WV0A 1B4AA 4HOBA 1JTXA 4Z2YA 4NQ6A 1SAUA 1UG0A 4B43A 1IUYA 3IRQA 1SEUA 4Q47A 5KAFC 2LNBA 2TRTA 3J80Z 3ZP5A 4L5EA 4IX7A 4K2EA 1MDMA 2P18A 2K4BA 3K1MA 5J8CA 3PNYA 5J1UA 2KJCA 4DQ2A 5A5ZA 4M73A 3VEPA 2DBBA 4LFUA 5DCMB 1YCHA 3EUHC 3ZPLA 2CFOA 4II3A 2Z16A 4ANJA 2CW0F 4BP0A 4E70A 2BXZA 1XPXA 1GXQA 4EXSA 1X2NA 4A0YA 3J7AY 2VB6A 3ABUA 4LB6B 3BC8A 5L3DA 2V1NA 3DEEA 2X85A 2XGCA 4LG3A 1BW5A 2WYMC 1C0WA 2A5YB 3BG7A 4IRGA 2VN2A 3E97A 1P4WA 1TWFJ 1XSXA 2XUBA 3A02A 1ZARA 3HEFA 3SYTA 3OS0A 2NYXA 1WQ2A 1IAWA 3TP9A 3DEWA 4BZ3A 2LKXA 3CCRI 1B8IA 1P7IA 1E0EA 2E1MB 1J0RA 4EY2A 5B1UA 2OJED 2DT5A 2WBMA 2IBDA 3HRMA 1DU6A 3NRVA 4N9HA 3IAM2 2RKHA 3ISPA 2ZZIA 2E7YA 4ASNA 4YFKF 2QEXI 2E2JJ 4XRFA 4RAWA 1SFEA 5EVDA 2CW8A 3CZ6A 3HPHA 5D6EA 2CUJA 5LM6A 1Z1DA 2QZ8A 2L4MA 1POGA 2KZVA 3I59A 3TOAA 5JHFA 1LUJB 1WFXA 2L4AA 2XHKA 3QU6A 3QRFF 3JTGA 1P2FA 1MSEC 2QSHX 3F3XA 4E4HA 4YG2F 1Y0UA 3JSPA 2VI6A 1QNTA 2HZDA 2W48A 3VSLA 2NVTJ 1ULYA 3IELA 2RNJA 5ICCA 1TNTA 3KP7A 5E1ZB 5GTHC 1KU3A 1YS6A 2FJ1A 2VODA 3C2BA 3OYIA 1K6YA 3DPTA 4JYKA 2Y0SA 2QM3A 2JZYA 5LCHA 3CC2I 2XPUA 1XDUA 1G4DA 3EUAA 2M5DA 2MC3A 2DDAA 4A3DJ 3GVAA 1UJ8A 2FX0A 4AIDA 3CP8A 4Q5SF 1LJ9A 3A0HC 3H3UA 3AL0B 2NAZA 3KIOA 1JE8A 4XMYA 3MZHA 4IEJA 1BBYA 3K4KA 2NS7A 2P6TA 4L0ZB 3KP4A 4JX5A 4TV7A 5CLSA 1RRJA 2IEKA 2KRHA 4D1TA 1SMTA 3K1NA 5FD5A 1JKOC 4Q48A 1BJZA 4XLFA 3M8FA 5F04A 4EJUA 2BMIA 1XSVA 5A2QZ 3FXRA 2DCEA 2LRDA 5C4JJ 4AC0A 2BW3A 2W00A 5FKLA 4B1RA 2XF4A 3TO6A 5L3BA 4BDYA 2GIVA 2VBWA 4BE2A 1K61A 5CVIA 4TYTA 3RKKA 2O3FA 3PUFA 5HODA 3E6CC 1FJLA 5E3OA 5IPAA 2HXIA 5GPCA 2L7MP 1T33A 4BBRJ 4CYCB 3QYEA 3L2CA 3HG9A 3ABLH 1RUOA 4LG0A 2NVXJ 2DMQA 2HPIA 3O2PE 1LE8B 2PLYA 1WJAA 4MNUA 3HOZJ 3DF8A 1HLKA 5HLGA 3JRIA 1F43A 2O7OA 3AFHA 5CPRB 4DBQA 2A3SA 1Z9CA 2XPWA 4ZYDA 2I5UA 3BCAA 4BAYA 4KITB 1MIJA 3OOPA 4M6XA 2QQBA 3OYAA 2JK3A 4KDPA 2P5VA 1XSDA 3ZQFA 4WK8F 2DOOA 3BR0A 4MQVA 3S3MA 4N4OB 2DMNA 2YPRA 2K3FA 4HF0A 4N0BA 5CKTA 2I7VA 1VNDA 3DBHB 5A2QK 1V5EA 2E7XA 1ITYA 4ZEJA 4AYBA 2EPFA 2ZXHA 1R1VA 4ZZLA 4FE7A 1YX3A 2M3AA 3MEXA 1SFUA 4EXYA 2BEOA 1GLNA 2QWWA 1TT0A 1F5TA 1FBSA 3TDUC 4DZPA 4NQWA 2CUFA 2E19A 2NZFA 2FM6A 1PDNC 4TZFA 3SDGA 2HOAA 3LSGA 4E7SA 2IS6A 2MFZA 4KICA 5D8LB 4IHVA 4EQQA 2VE9A 4S05A 3K1PA 3MKYB 4A5NA 3JRBA 4QTRA 5K7ZA 2CU7A 4RAYA 2VE8A 3R2UA 2UZKA 3OIQA 1O4XA 4CCMA 3KCCA 4IJAA 4RMNA 1LDDA 4LIVA 2Q42A 1JUPA 3ZQ4A 1A7TA 1LVKA 3KYDB 1O7LA 2FBHA 2ZFUA 1P9EA 2P7CB 5A0TA 3KP5A 2PMHA 1DXKA 4Z60A 2OD5A 3KEQA 4HDUA 3WTVC 2M8GX 1GV5A 2DA1A 2BG8A 2LSOA 4C09A 1V54H 3HHHA 3I4PA 4E7ZA 4ZTFA 1T0FC 3X2QH 5TRDA 1IC8A 2PJRA 3QU3A 3AF6A 3TW7A 5DCFA 1TT5B 2E1NA 2R5YA 3LAJA 2Z5UA 4CZZA 1FZPB 1NHAA 2OC6A 2G9WA 5D5XB 1XX5A 2XDVA 3KX2A 5FRNA 4B3XA 4J00A 4WX9A 3GFIA 1QU3A 2HTSA 1K78A 4AV7A 2D2WA 4A6DA 1JXSA 3BR5A 4DIKA 2RV8A 3WTUC 5F0CA 4BS9A 1K4TA 3HKZN 3HRTA 3S32A 4KMFA 1ZRCA 2IA2A 1OPCA 3ECOA 4ZC3A 1VQKI 5ACWA 4F52A 3IWFA 3SEZA 4HV5A 2V6CA 1R1UA 2MD5A 1BIBA 3DHAA 2O61A 2LVSA 2CO5A 5GPAA 4P1WA 5HH5A 1R4MB 2LK2A 3ZRGA 2GBYA 3BG5A 4IVNA 3WE2A 1RR8C 2R7TA 1GT0C 2A6TA 1BI3A 2EINH 4NBQA 1HLVA 2DK5A 4IRIA 1F4KA 3OYCA 1T08B 1DGRM 1OCPA 2DI3A 2DLLA 2JA2A 2XB0X 2WWYA 1TWHJ 2XAUA 2CJJA 3F0CA 4IL6C 2IGKA 2YX4A 2EIMH 4G6DA 2STTA 5HH6A 1B6AA 1USTA 3BG3A 1WVRA 2DMUA 1BW6A 1A6QA 2GIZA 3I4NJ 3ERED 3B6CA 3DWLE 3H0GJ 2KPMA 2LKSA 2I7TA 2COBA 1CF7B 2H6CA 2J5PA 4CZCA 1ETXA 5E1WA 4I76A 2ZO4A 2M87A 1FIAA 1HSJA 1QGPA 3BCBA 1LDKB 3LWFA 3QOPA 4C2MJ 5L3CA 1QPIA 2YNUA 1G2HA 3P2UA 2K40A 2D1HA 3H0DA 2A07F 5FLXZ 4N9IA 2M2EA 1DPRA 2OHIA 3BQZA 3RYPA 3G6EI 1GUUA 4ZO2A 1FNNA 1R22A 2MG4A 2MC4A 2DXIA 3U2RA 3CCJI 2CFUA 2YCBA 4IHSA 4V2FA 1J59A 4Q4ZF 1KU7A 2E1MC 2JA8J 4I01A 4C2UA 4UHTA 4AIJA 2V1UA 2OCCH 2HGCA 3GTMJ 3OYJA 1Z3XA 3DKWA 4GFBA 4DILA 2XVCA 3FM3A 2B7EA 1BR4A 3BZKA 4LJZF 1X8HA 5KILA 3I4MJ 2NVYJ 2XROA 1JKRC 1FIPA 1ZKGA
chains in the Genus database with same CATH topology
1G6NA 4F6HA 2NNNA 2ESHA 3ULQB 2FU9A 1H9TA 2NYPA 3BWGA 2HR3A 4FHTA 3BOQA 5HLIA 1FSHA 5FLXK 2ESNA 4O98A 4R1HA 2Y48A 3HTSB 3AAFA 3KP2A 3H3EA 4EM1A 1LB2A 3SPUA 4KMUX 2BGAA 2F5CA 4A2UA 2GAUA 1XGOA 3HSEA 4L18B 2GXGA 3TQNA 2HS5A 2JPCA 3GLXA 2VT2A 1BC7C 4LLNA 4TZEA 2EB7A 2KIUA 3J81Z 4UBQA 5EV8A 4RS8A 4OINF 3ZMTA 4WXCA 3CLOA 3EQLF 4C1GA 5EVKA 3L9FA 3CTAA 5DD4A 4YFNF 1UHWA 4PGGA 2HWVA 1ZG5A 1W5TA 2PFBA 2F5DA 1G3SA 1QZZA 2DPUA 1FPQA 5ED4A 2YZ3A 2E1CA 5HOOA 3LVZA 4AX0B 5LCFA 5FD6A 3DH8A 3CJNA 4O3MA 1I6XA 2HKOA 3CUOA 4I7HA 1TLHB 2W85A 3EETA 1BIAA 4D0PA 2L02A 2QLZA 3IHUA 2FU6A 1ZH5A 3WE3A 1KU2A 5HIQA 4HLXA 1BI2A 4NQ4A 3B02A 3WODF 2OZ6A 3RJPA 3Q6VA 3T1BA 2ZJ2A 3W6KB 4EYBA 1P92A 3C3WA 4R8HA 4ESBA 2VBXA 5EW0A 2EFQA 2W24A 2P97A 3MCZA 1EH8A 2WC2A 4WXHA 4LG0B 2BFLA 4JBAA 2YNWA 1MJAA 1IF1A 3COAC 1YW9A 1TQMA 4MEYF 3DPLC 5EHTA 3R61A 5EV6A 4U88A 3RDIA 4KEPA 3ZWFA 2YU3A 1WUOA 3RKJA 2B0LA 1BI1A 2BGCA 3FCZA 5L3EA 4I2OA 2BV6A 4EV0A 3WTXC 3K0LA 1R1TA 2AZ4A 2XAFA 5LMCA 5AONA 4CO8A 3JAMK 4L0YB 2BG2A 1KQ8A 1HW2A 1W7PA 2DTRA 4Z67A 3QP5A 2QJSA 4QLCU 4AWXB 4XBFA 4UWSB 2P4WA 5E17F 1FYMA 4XWTA 3HOSA 2K4JA 5D5VB 3T5XA 2D45A 4CDGA 3KZYA 2EK5A 1U5TA 2CQKA 4UVBA 5L3GA 1FYLA 2H27A 4HF2A 3KZZA 4EGYA 3SW3A 2BYVE 2HOEA 1BC2A 5AYAA 1XCBA 2MA3A 3IWZA 3IEMA 4M71A 2QINA 2FA5A 2BE5F 3ZMUA 4PVTA 3IOGA 2FU8A 1DD6A 3IE0A 1KR3A 2Z9OA 1IRGA 4YFXF 4KIFA 5AIQA 2OU2A 4BNCA 4I0BA 3KNRA 2ELHA 2V1DA 2EJRA 5BOXA 1BJAA 2VBYA 3FMRA 2QQ9A 2NRAC 1D5VA 4H0EA 2EWNA 1FT9A 3V4GA 1O57A 3ESHA 2BFZA 5KVRA 5BPDA 1Y44A 3LQRA 2M5WA 3M9AA 3HYIA 1FP2A 2IRFG 5FQAA 4JQFA 3EDPA 1QH3A 4PCQA 5LRRA 4RGSA 5K5OA 4Z5ZA 5K0WA 4EJWA 5HH4A 2OQGA 1K07A 4L9VA 3I15A 1HSTA 1L0OC 2Q0IA 3VPEA 4MTDA 4IHTA 2FRHA 4M6YA 2PQ8A 4ESJA 2GXBA 1YG2A 4IF4A 4G7HF 4FR7A 1FP1D 5D4SA 2O03A 5AHOA 5TJJA 2O0YA 3ZQ7A 2BG7A 4LGWA 4IXAA 5AHRA 2ZXJA 4UWRB 3SXYA 4C1FA 3E5QA 3BPVA 3EUHA 3IE2A 2K86A 5D5UB 1SD7A 5H6RA 3LA3A 4H0DA 2A7MA 2P7VB 2WYMA 3J80K 2O6GE 1A8TA 1XB4A 2F2EA 5DPXA 2M5CA 4KA4A 3F8BA 4ZH4F 4AIKA 2EV5A 5FQCA 4Y13A 3KETA 1ZAOA 3SRXA 1DP7P 1DDKA 3FXQA 4PVOA 1EV7A 2MLGA 1MKMA 3ABTA 1BOAA 1CGPA 4A0ZA 2RDPA 1USSA 1XN7A 1ZKPA 3MD7A 4XSZF 4HQEA 1ZNBA 1I27A 4J5HA 5K5RA 4U4LA 1WUPA 4FEKA 5LSCA 4ON0A 5H6QA 2Z3YA 4EYFA 3KFWX 3J7AO 4KFCA 5DDGA 1WRJA 1JHFA 3BROA 5FFXA 5LGTA 5JHUA 4O5VA 4AIHA 4UWOB 1PP8F 1DUXC 2XKOA 4GXOA 3LFKA 2PN6A 5EEGA 1RUNA 1R5GA 1FWZA 3VODA 1A04A 1KGSA 2HQRA 1XGNA 5D6FA 3IEKA 2QENA 3GEZA 1IN7A 1YQAA 3V8JA 1ZRDA 4UAMA 2BIBA 3BK1A 2UYXA 3PG4A 4G94A 1WRAA 2GA2A 2VXZA 2YNTA 4I02A 1KO3A 2L3DA 3E6BA 4U7DA 3IL2A 1ZLKA 3I0TA 3IKTA 4RGXA 5EH9A 2M8EA 2OHHA 5DV5A 1U78A 1YLFA 5HLHA 3WTZA 5ICEA 3ECHA 3SZTA 2P8TA 1OYYA 1D8JA 3RKYA 2FXAA 1IN6A 2QDSA 5LCAA 4LK1F 4EGZA 4OMYA 3L6NA 2ZNYA 1X8IA 2V9VA 5ILVA 5FB2A 3CUQB 2JT1A 4BHBA 1IXRC 2JSCA 2X0LA 1JT1A 5AXRA 3VQZA 1O3QA 3T8TA 2HTJA 1ON1A 2PI0A 3IOFA 2PMUA 3SHFA 1YTYA 3KLNA 4R79A 3BZ6A 2EA4A 4Y17A 1MZBA 2NZEA 4P55A 4BH9A 4LLGF 2IP2A 3PQJA 3T0YA 5HVQC 1XDSA 5LEKA 4HL2A 2ADUA 2W84A 3QH8A 2RVCA 1W7PB 3K69A 1X8GA 1XCVA 2P1EA 2P4ZA 3BV6A 3AF5A 5LLQA 5ACPA 3GZ5A 2Y8BA 1KYZA 1SD5A 3RKXA 3P9IA 1I5ZA 4ETSA 2YNVB 4FT8A 4D1TA 1BI0A 2WRSA 1T0FA 5K1YA 3ELKA 3KNSA 1WKMA 4RAZA 1T98A 1LVAA 2F5EA 5ACXA 2MBFA 2FMYA 5E20A 3JW4A 4HX8A 4F7ZA 4AX1B 2GKLA 2IJLA 2LF7A 1ON2A 1HXDA 1ZG3A 3QP6A 4QWQA 5FO5A 1VJNA 4RL0A 2QBYA 3ZMVA 2EFWA 4Z5YA 3N97A 3GYHX 2AIOA 4EVIA 3L00A 5K5QA 1KU9A 3RI4A 1MJ9A 2EA2A 4CXFA 3Q9SA 4RB0A 3NEUA 4CICA 4EM2A 3Q5FA 2EFNA 3JTHA 5ACUA 3I5UA 1RI7A 1QPMA 2DK8A 1B9MA 4LB5A 4OU0A 5LBQA 3C7JA 3DV8A 2QYOA 3HTUA 1YW8A 1TTYA 2YR2A 3G1PA 4UVAA 2A61A 4ENKA 3GFJA 2HZTA 5ILUA 5CVVA 1KA8A 1VMEA 4KEQA 4EJOA 1FOKA 2L54A 4MEXF 4XWWA 1TQIA 2GMNA 2FEZA 2HB9A 2K7LA 1STZA 2IA1A 3ZMZA 3WGIA 4HQMA 1YFHA 2OAZA 1ZG1A 2BBYA 3FM5A 1HW1A 3RPQA 5ICGA 2M30A 2Z99A 2OHJA 3F9OA 1MDMB 5FGMA 1WI9A 4UWPB 5E1XA 1RZ4A 5F64A 4M72A 2QQAA 1Z91A 4BQAA 2Z33A 2R2DA 4GYUA 4GCWA 1R36A 2CWEA 2M1BA 4KT5C 1PUEE 1HW5A 4RB2C 2EFPA 3F8FA 4YSKA 3GX4X 3ZN1A 1SD6A 1T2KA 3F6VA 3QPTA 1UCRA 1U3EM 1XGMA 4HZFA 3TO9A 3S2WA 1KYWA 2V79A 2DQRA 1WSUA 3I59B 4CHUA 1SD4A 1UB9A 5EWAA 1ZHFA 4D1UA 2Y8AA 3RPUA 2UWMA 2JTVA 3G3ZA 4RAMA 2W25A 2VT3A 3I54A 2IT0A 4ZO3A 2HKXA 3T9MA 1M2XA 2DAOA 2HYGD 3J81K 2FBIA 2XAJA 1YIOA 1LEAA 2XR1A 3HRUA 2HFHA 3V8KA 2BG6A 3A4YA 3HSRA 1ZLJA 4MGRA 1UHMA 1YYVA 2XIGA 1XMKA 2L01A 4LE6A 5LHGA 2HYFA 2IW5A 5H20A 5LGUA 5ICFA 5D4RA 2GFJA 3V7SA 5LGNA 5IT9Z 3RPCA 3JSOA 3CUQC 1OYWA 4B09A 3WTWC 3SFZA 2K02A 2R7FA 3GO5A 4ENNA 3HRSA 2GFKA 1SFXA 1L9YA 3SD9A 5CYVA 5LLDA 2DO7A 1Q1HA 1ZRFA 2H09A 2CFXA 2G7UA 2OZUA 2ETHA 2ZMEA 1S7OA 5K4MA 5EEHA 5K4KA 3LSTA 2WHGA 2Y87A 5ACQA 2X4HA 1JHHA 1TQPA 4KN7X 3CO7C 1KQ0A 1TNSA 5LHHA 4RBSA 1Z7UA 3QPHA 3C18A 3U9GA 2VOPA 2FOKA 4KUMA 5BMZA 3IDZA 4GYIA 2BTNA 1YO5C 2V1XA 3D5LA 3SZPA 4XLPF 3M1EA 1IW7F 1ZGJA 4NHJA 3C1DA 1S29A 4ZYEA 3HSFA 1QH5A 2FQ3A 2PJPA 4G8XA 3MWMA 3LA2A 3EYYA 4CGZA 2LKPA 2PG4A 1QO0D 3BDDA 2BG8B 3I13A 2IVMA 4C1DA 3F8CA 4DNCA 1OKRA 2AXLA 1BMCA 4B8XA 3FAIA 3T3NA 2QVOA 4AD9A 4MHGA 2W57A 5HDGA 2R7DA 1SMLA 5AEBA 1S6LA 2DU9A 1K78B 3MFKA 3R60A 2A6EF 3GF2A 2FK6A 2XAQA 4WF2A 1ZREA 4B87A 2Y0MA 1B1BA 3M8EA 1T6SA 2GWRA 5E8IA 2Q0JA 2XASA 1CF7A 4OOIA 4L9TA 3K9TA 2Q9UA 4HDVA 1J7KA 3F22A 1O3SA 5DYMA 4I0AA 3AJ3A 1GVJA 2QBYB 3KLOA 2HDCA 3LAPA 3W6JB 2MLKA 2KJBA 3GWZA 3CO6C 3O3KA 4GO1A 1REPC 4WXDA 3E5UA 2IPQX 2FE3A 1TW2A 3FXUA 3N4MA 1BVTA 4YSLA 4M9XA 1FLIA 3GZ6A 2UXXA 2WYLA 2VW8A 1S8NA 3WXCA 3CDHA 3BC2A 1IRFA 4HYEA 1LDJA 4HF1A 1HQCA 3TDZC 4YIIA 1O3RA 3RKWA 3SFPA 3P9CA 4CHLA 2XKPA 3WTTC 2FU7A 2BFKA 4PZJA 1W5SA 4UVCA 4A6EA 3VFZA 2ISYA 2GCUA 5LRSA 3HUGA 3TGNA 1U6GA 4A5MA 3NQOA 4XLNF 1MQOA 4KNYA 1U8RA 4U0YA 3I14A 1TW3A 2XV4S 1O7FA 1HBXG 1IN5A 4P62A 1I1SA 3FWEA 4AWYB 4HV6A 4BHPA 1FY7A 4OMZA 1UFMA 1F1ZA 2Q0OA 1LEBA 3RYRA 2JPBA 4GGGA 4BYYA 3V8LA 5JFRA 3FF5A 1FC3A 4UV9A 4EYLA 1X3UA 3F6OA 2QEDA 2OQRA 2NS0A 3B73A 3I11A 1B9NA 4HA8A 2CGPA 4HW0A 5HIOA 5KK1A 3DFGA 4UV8A 5FFZA 1XMAA 2O8XA 2A6HF 1Z6RA 4PDKA 2LF8A 1SAXA 3HHGA 4KIGA 2BR6A 2GA1A 1U2WA 4GYGA 4M74A 3SBLA 3DQVC 5IT3A 4XUKA 3GFLA 4P9UA 3H92A 3WU1B 1IZ1A 3IRRA 1ODDA 5BS6A 4EM0B 3ZMSA 4BXUA 1R00A 3I53A 2VONA 4Z7RA 5J6XA 1XM8A 1Z05A 3ZMDA 3IKVA 1I1GA 4ZZDA 4RGRA 2CG4A 2G7HA 5D8KB 4NQ5A 3BK2A 2FNPA 1FSEA 3BJAA 1R5HA 1OMIA 4RL2A 3E6DA 3KE2A 3WTYC 3KEOA 3F8MA 1DDNA 2LDUA 3WGHA 4TYFA 2NNYA 4GYQA 3KL7A 2COMA 4LD5A 4V0HA 3X30A 1QZYA 1Z6TA 2OBPA 5LS3A 3M7GA 5DEQA 2ZWRA 2EV0A 1K6OA 5ACSA 5DUKA 1ZGAA 4HBLA 4EJTA 2P6SA 1XGSA 2H6BA 1HKTA 3H3ZA 4AWZA 1JJEA 1V3FA 5EVBA 2BC2A 4LLLA 3RTRA 2FF4A 3MZYA 4EJVA 1K79A 2CBNA 4JO0A 1VTNC 4ZYHA 5CVUA 5ACRA 2ZMEB 4ZYGA 5JVTA 1MJBA 4LMYA 2ZNBA 1J9IA 4RM5A 3MAJA 2FU4A 1J75A 1ZN2A 4Y15A 1QBJA 4AVPA 5B3RA 4TZBA 3ZR9A 3ML6A 3OV8A 1HKSA 1XD7A 2D1VA 3TKYA 4TZ9A 3K2ZA 4HX7A 5FQBA 2FSWA 2QUFA 4J5FA 2ZKZA 4L5IA 5J8FA 1MGTA 3IC7A 5CVRA 3FMSA 5LHIA 1ZTCA 3F8NA 1LQ1A 5HISA 1IXCA 1U5TB 4HX4A 1H0MA 2KRFA 2RC4A 5ERIA 3PY6A 4HL1A 5CJ9A 5AIPA 3T3OA 5ILSA 3X2XA 1K7AA 2FHXA 3IE1A 5A0VA 2Q8KA 2KIFA 3VB2A 4L5JA 3WG9A 1YS7A 2VBZA 2M45A 3BPXA 1JJTA 2XAGA 3U1DA 1E17A 4YIFA 1YW7A 1WWXA 4L9JA 1XTOA 2H94A 3V7CA 2VC0A 4HKYA 3FX3A 5E8GA 3TOBA 3GW2A 1S3JA 1FX7A 3RIRA 2VC1A 5DCMA 1E2XA 2K27A 4G7ZF 2BFZB 4RB1A 1G3TA 4PGHA 4OIQF 1FBQA 4HLYA 3X2YA 2R3SA 1HKQA 5BQTA 3DHCA 2MH9A 1JGSA 4KN4X 6PAXA 4LK0F 2STWA 3I64A 4WD6A 4NB5A 4P5OA 5DD8A 5F1RA 4M9ZA 4MQ9F 4U0WA 3SQNA 5KIKA 3MQ0A 5JI6A 3DP7A 5ACVA 3GUDA 1OYIA 2PEXA 3WGGA 4C1CA 4RB3C 4KYWA 1GXPA 4UNOA 4OIRF 2PBIA 2P5LC 4CYDA