4AD9A

Crystal structure of human lactb2.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
288
structure length
288
Chain Sequence
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE-LIKE PROTEIN 2
total genus 86
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF17778 BLACT_WH Beta-lactamase associated winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ad9A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4ad9A01
1P2FA 4L9VA 1OYIA 5FFZA 3KFWX 5TRDA 5LEJA 1G3WA 5K4KA 4GYUA 3I11A 1G6NA 1LJ9A 3CTAA 1IN8A 4PCQA 5E20A 3WE2A 3FZVA 3KP3A 3T0YA 5CVJA 3EDPA 4CICA 3MZHA 3RYRA 4KUMA 5K5OA 1ONVA 2RV8A 5ILSA 4A5NA 5EVBA 4EYBA 1K78A 2RKHA 3QU6A 1QBJA 4M6YA 4ZO3A 4LLNA 2CSOA 3ZPLA 4EM1A 3M1EA 1LNWA 5ED4A 3KLOA 1BOAA 4JQFA 3SHFA 4FX0A 1Q1HA 4N9HA 5HLGA 1QPMA 4CZZA 1J5YA 5ICGA 1K79A 3ZN0A 2XAFA 1WRJA 4U0VA 4L18B 4HDUA 5DD8A 1O3RA 3H3EA 2EA2A 3TKYA 2WTEA 4ZYEA 4EJUA 4EGZA 1XCVA 1PP8F 3HHGA 3GO5A 5HS7A 3KP6A 3F6VA 3PQJA 3FF5A 1A7TA 5HIQA 3P9CA 3ZWFA 2DQRA 4G8XA 2E7XA 4AWYB 2R7FA 3BP8A 2QBYA 4KT5C 2V6CA 4NQ5A 4KEPA 2FQ3A 3T9MA 2K02A 2F5FA 2Z5UA 1FP1D 1OPCA 5D4RA 2G7UA 5FQBA 3E5QA 4YSBA 1USSA 1W5TA 3V8JA 3L9FA 4KN4X 5CVUA 3GZ6A 4HW0A 3ADRA 2L4MA 2DPUA 4F6ZA 5A0VA 3BY6A 1JT1A 2V9VA 2HDCA 5AYAA 3IE2A 3I0TA 5IT3A 2Z3YA 5EVDA 5DUIA 3AF6A 3JSPA 1YS7A 5E1ZB 5AXOA 2XROA 2DLLA 1DDNA 3IELA 5FO5A 2EFNA 4AX1B 2M1BA 5LEKA 2WC2A 1R5GA 4RAWA 4AX0B 2K4BA 2YNVA 4N9IA 3GEZA 2NAZA 4Z67A 2VE8A 5HDNA 2GCUA 2F5EA 2IA1A 4EVIA 2OHIA 4EJOA 3WODF 1EH8A 4WK8F 3TP9A 1KU2A 2TDXA 4BAYA 1UCRA 2P8TA 4UXNA 3WTXC 5ILUA 1TTYA 2HTSA 3HRUA 4EXSA 4L9TA 2FMYA 3TDUC 2RC4A 1Z6RA 4HLYA 5HVQC 3RKKA 1QZZA 3CJNA 4HF1A 1MQOA 2QDSA 5ACVA 3F8NA 3CO7C 1HBXG 5L3GA 1R22A 2MLKA 1KU7A 4BXUA 3F3XA 3BZ6A 4XSZF 1EH6A 5LRSA 1XM8A 3S0ZA 1TBXA 2FU9A 2Q8KA 1K07A 2NZFA 2X0LA 3TO7A 1LQ1A 4LD5A 1F5TA 1HW1A 3IWZA 3EYYA 5HH6A 1O7FA 1W7PA 2G7HA 5JI6A 2GAUA 3QP6A 3U1DA 2Y87A 2DT5A 2P7VB 4FEKA 5EV6A 1H9GA 2BG8B 4FR7A 4GCWA 2XAQA 1ZGAA 3GXOA 3RPCA 5LS3A 4CHUA 1HSJA 2EV6A 2QENA 4F7ZA 3ZMDA 4CYDA 3HSRA 3NQOA 1LVAA 1TQIA 2K27A 2WV0A 2I7XA 3BC2A 2IJLA 3MFKA 3EETA 1P92A 2P5KA 2PI0A 2J5OA 2VOOA 1BC2A 2DOOA 5LLDA 2ZCWA 4OMYA 4UVBA 3JW4A 3ZMSA 3R0AA 2AIOA 2YNUA 1KQ9A 1JE8A 2VBWA 1OYYA 1VJNA 2YU3A 3N4MA 4UA4A 3QOPA 5EH9A 4KIGA 5ERIA 4FX4A 3V4GA 3GUDA 5LHIA 5EEGA 5LRRA 2HS5A 1LEBA 1YLFA 1BIAA 4XWTA 5HDKA 5LGTA 5AHRA 3I53A 1HQCA 5B3RA 2DK5A 2WYMC 1STZA 5HS8A 4ZYDA 1CGPA 5K1YA 1G4DA 1O3QA 3L09A 3IKVA 3L2CA 3WTYC 2ZWRA 4ESBA 1DUXC 5ICCA 5ICFA 2GQQA 3M9AA 1P9EA 4IHTA 3S2WA 3KNRA 3I59B 4B09A 2KIFA 3IWFA 2E1CA 3HSFA 5L3EA 2JRTA 4I01A 2Q0OA 4MNUA 2A7MA 1ZHFA 4XLPF 2HEOA 4OMZA 2BBYA 1WI9A 1F1ZA 2DK8A 3LAPA 2XV4S 2FE3A 5F64A 5DEQA 1ODDA 2BGCA 4ZYHA 1Z7UA 2H6CA 3TOBA 3VB2A 1QO0D 4B8XA 3FCZA 3T5XA 1YCGA 2XIGA 2RN7A 3IKTA 2DBBA 3LA7A 4UAMA 3Q6VA 3FM5A 2FM6A 4MTDA 5JVTA 2BG6A 2LNBA 3FWEA 3HRTA 3WTWC 4A5MA 2QYOA 5A2QK 2P5LC 3K0LA 1MJAA 4GO1A 1XGOA 3SD9A 2PLYA 1WRAA 2VBXA 1XCBA 3HOTA 2BYVE 2A68F 1J0RA 2O3FA 4OIOF 2W57A 4YG2F 4A2UA 1S6LA 1WQ2A 2I7VA 4ENJA 4MEXF 2FEZA 4HA8A 3AF5A 1MJBA 2W85A 3M8FA 1XSXA 1OMIA 4ENKA 3BOQA 3NEUA 3I54A 4AVPA 5D5WB 4IJAA 2E7WA 3BPVA 3L00A 1R58A 2O6GE 4UVCA 2DQLA 2FHXA 3GFJA 2DTRA 4CO8A 3GFLA 5DD4A 2M87A 3HUGA 1T39A 1BI0A 3FHZA 4ENMA 3IDZA 2VE9A 2DU9A 1ZLJA 3I71A 5FLXK 1FX7A 5D5VB 3M7GA 1Z1DA 1ZRFA 2YCBA 1RZ4A 2EA4A 3F8MA 3ML6A 1V4RA 4GYIA 3ZR9A 2G9WA 4Z60A 2MH9A 4HX8A 3JXPA 2HQRA 4YIIA 2ZFWA 3EQLF 1BI3A 5LMCA 2NYPA 3WG9A 1B59A 3IOFA 1BMCA 5D8KB 5HDGA 2WRSA 4LLGF 4NQWA 3WXCA 1X8HA 3I5UA 4A6EA 4L5IA 2VW8A 3K2ZA 2AZ4A 1WKMA 3HRSA 4EJTA 2PFBA 4G94A 4EY2A 1CF7B 2FOKA 1B9NA 5TJJA 2NRAC 2H6BA 2L4AA 2KRFA 1KQ0A 1V3FA 4TV7A 1FP2A 1G3YA 1WW1A 2WWYA 4OIRF 5B1UA 2M5CA 4D02A 3FXRA 4I98B 3SQNA 2DKFA 4RB1A 2RGVA 4L5JA 5IQKA 4RAYA 4OOIA 1DDKA 3IE1A 3BWGA 3ERED 3MEXA 2H09A 4RGSA 3RI4A 1E17A 1VMEA 2ZNBA 5D6FA 3J80Z 4QLCU 1YO5C 1C0WA 4AWXB 4ESFA 5BS6A 1ZG3A 3DH8A 2PBIA 3GVAA 2XKOA 3IRQA 1U5TB 5FGMA 2YPRA 3I15A 2HTJA 5ILVA 3Q9VA 1I1SA 4KMFA 4Z7RA 5AIPA 4EQQA 2BFZA 3ULQB 4Q5SF 3MCZA 3TGNA 2XHKA 1W4MA 3FMSA 2CW0F 2D1HA 3CUQB 2WYLA 1SD6A 2ZKZA 3T3NA 2DFIA 3KL7A 1ZN2A 4PGHA 2LF7A 5DUKA 4KA4A 5LCAA 2GKLA 3WTZA 1JJEA 3WGGA 4IRIA 4CHLA 2JZYA 4G6DA 1XGSA 1FBSA 3TO6A 2W24A 2BG2A 4BZ3A 3KE2A 5FFXA 2BFKA 5BQTA 1ZYRF 4GGGA 3FAIA 3P2UA 4YSLA 2QQBA 2RVCA 3I4PA 3BDDA 1PDNC 1FZPB 1USTA 2VXZA 1IN7A 4HV6A 5E8GA 4I02A 2VODA 4P96A 4PGGA 4IRHA 1Y0UA 4IPAA 1R36A 4TYTA 4TZFA 4EXYA 5K5QA 1B9MA 2JPCA 3HTSB 3U9GA 1K6OA 1HKSA 1YIOA 4BNCA 2JPBA 4H0DA 4TZBA 5EW0A 2EB7A 5H20A 5J6XA 3HSEA 4A0YA 1MDMA 1FSEA 3H3ZA 3T3OA 3PY5A 2O8XA 1K78B 1BJAA 1JHFA 1ZRDA 2FNPA 1QGPA 2DI3A 3GF2A 1XSDA 4J5HA 2LF8A 2Y8AA 3I14A 2ZJ2A 3JTHA 4HDVA 4BQAA 2BIBA 4EYFA 3E3VA 2FBIA 3WTTC 1DXKA 1DPRA 2UXNA 3P9IA 2QJSA 1LDJA 3WU0A 3D5LA 3JAMZ 4D1UA 2FHXB 3BK2A 1OYWA 4NHJA 3ZQ4A 2IA0A 2Q0IA 5JFRA 3DXJF 2WYMA 2NZEA 3J81Z 4PZJA 2OBPA 1S8NA 1BVTA 4LK1F 5ACPA 1J7KA 2YX7A 2GXBA 1YFHA 2ESHA 1FY7A 2ESNA 3X2ZA 2Y48A 1X3UA 4CXFA 3JSOA 2FBKA 1ZRCA 4RGUA 2EFWA 2PN6A 3C18A 2P4WA 1LB2A 3ECOA 4EM2A 5J8FA 1ZG5A 1B1BA 3ELKA 1F4KA 3R61A 4WX9A 5LE1A 4I0AA 4ZZDA 2HFHA 4IHSA 4D1WA 1TNTA 1ULYA 5K5RA 2VN2A 4XSXF 4M9SA 3V7SA 2A6HF 2OQGA 2GIVA 3SBLA 4KIBA 3F23A 5L3CA 2V79A 3FXQA 2F5DA 4U4LA 2QEDA 1VGNA 2VONA 5E1XA 5EV8A 5JHUA 2FK6A 5H6QA 2CBNA 2O61A 3KLNA 1IXSB 4IVNA 5ACUA 4MQVA 3K1NA 1JXSA 4UV8A 2M45A 2ZBKA 3R60A 1UHWA 2XVCA 4OU0A 3QH8A 4C1HA 1SFUA 4KYWA 4U7DA 2CFXA 2MH2A 1FNNA 1S29A 4Y17A 2ZNZA 5IT9Z 1BN5A 2R2DA 2Z9OA 3V7CA 3IHUA 4PVTA 2HKXA 3DKWA 3RKXA 4LB6B 1Z9CA 2OD5A 3FX3A 1U8RA 1G3SA 3W6JB 2D2WA 2ZZIA 4Y13A 3DFGA 4YIFA 2GA2A 1FBQA 1IN5A 4EJWA 3P7NA 4O5VA 1KGSA 1SFEA 4EM0B 2DAOA 4R79A 1B6AA 1RI7A 3ZN1A 4Z2YA 5CLSA 4LB5A 2BFLA 3TOAA 1IRFA 4ZO2A 1TW3A 1SFXA 5LGNA 5HIOA 2XGXA 2JTVA 3R2UA 3MWMA 3RKJA 3ECHA 3W6KB 1MJ9A 2RQPA 1ZNBA 1KR3A 2CQKA 3KEQA 2K7LA 5HLIA 4P9UA 5LHHA 2M5DA 2GA1A 2P4ZA 2UZKA 2O03A 3VEPA 4YFKF 1W7PB 1YCHA 3FMRA 3HOSA 4Z5ZA 3JTGA 2Q42A 2QM3A 2BV6A 5DV5A 4D0PA 2GFKA 2B0LA 2FBHA 4ETSA 3F8CA 1QH3A 1R5HA 2XAJA 1MKMA 1YCFA 5LCFA 5HH4A 2XAHA 3EUHA 3T8TA 4R8HA 4HX7A 3SRXA 1E5DA 2A07F 1FYMA 1W5SA 3WTUC 5F1RA 1ZARA 3REOA 4I0BA 3L6NA 4M6XA 2PG4A 4UWRB 4HF0A 4O98A 5HOOA 4M72A 2BG7A 2DW4A 4KFCA 3FMQA 2MC3A 3KZYA 3G3ZA 2V1UA 1XDSA 4I7HA 1I5ZA 3F22A 3VQZA 2L02A 3LA3A 3RYPA 5AEBA 2MLGA 3TDZC 2FU6A 3DHBA 5LHGA 2NNNA 1D3YA 1U3EM 1FPQA 3KCCA 3GWZA 5BPIA 3GX4X 4CGZA 2CGPA 2A3SA 5CVRA 3KEOA 4HAMA 3RPUA 2H6AA 1XDUA 2IP2A 1IN4A 3I58A 5CYVA 2MBFA 4XWWA 4FSBA 4KICA 3E6DA 4Z5YA 3K69A 1AOYA 3KP2A 4C1FA 2P6TA 2QLZA 5EWAA 1IUYA 2OHJA 1YG2A 1GXQA 4GXOA 1TQMA 5E1WA 3RDIA 3ZMUA 2NXAA 2KIMA 3KP7A 3SFZA 2QBYB 2COMA 1YW9A 4OIQF 1LEAA 2NYXA 4LGWA 4GYGA 3I13A 3O3KA 1MD0A 2PJPA 5AHOA 4C1CA 1DPUA 1Z6TA 5IT9K 3ZMVA 1XN7A 1LDKB 1U2WA 4A12A 4OINF 1FYKA 3I64A 3GFMA 1L3LA 1D8JA 3PY6A 4U7BA 4I2OA 2Q0JA 1TLHB 2LDUA 3FM3A 5KIKA 4KEQA 2R7DA 3OV8A 4DIKA 1U5TC 1XSVA 2GFJA 5DCMA 4WWCA 2BR6A 5LCHA 5BMZA 2R3SA 5EVKA 3ABUA 4ON0A 1WUOA 4NQ6A 4WXDA 3CUQC 1S3JA 1YTYA 5L3BA 1QH5A 3IEKA 4FHTA 2UXXA 4KMUX 4E70A 1ZG1A 4XRFA 5ACWA 1GXPA 3WGIA 1BC7C 1IN6A 5DCMB 4RB3C 3FXUA 2IA2A 4ZH4F 1TNSA 2H27A 3CO6C 4JBAA 1Z91A 2EJRA 2OA4A 2UYXA 2FXAA 4WXHA 3RPQA 2STWA 4LK0F 2QVOA 4HL2A 4B87A 1RUNA 2PQ8A 4J5FA 3F21A 3DV8A 4ZEJA 1P4WA 2V1DA 3RKYA 4MTEA 3DEUA 2STTA 1QQIA 4Q4ZF 4AIJA 3B73A 2H94A 1R1TA 1SD4A 5DYMA 3R4KA 3WTVC 2HR3A 4C1DA 4F6HA 3X30A 4GYQA 3DF8A 1IW7F 1O3SA 1BBYA 2DO7A 5ACSA 2W84A 1DP7P 4WD6A 4LG0A 1EH7A 2BEOA 2F5CA 1YW8A 2HYFA 1X8GA 1SD7A 4PDKA 3ZNBA 5BPDA 2GWRA 3QPHA 3G73A 4UNOA 2EV0A 4XUKA 3U2RA 3PFIA 2IPQX 2C6YA 2Y8BA 2PMHA 1I1GA 1BI1A 3GLXA 1L0OC 3C3WA 4KN7X 1ZTCA 4O6JA 2BC2A 4V0HA 5B15A 4A6DA 4C09A 1KO2A 1E2XA 3E6CC 2KKOA 1XTOA 5D5XB 2BGAA 1YW7A 1S7OA 3RTRA 3Q9SA 1SD5A 2AXLA 1U78A 1SMLA 4LLLA 1ZAOA 4IF4A 3CUQA 4IXAA 1HW2A 2A5YB 1KU3A 1GHCA 4KNYA 4NB5A 3BROA 5KILA 4HBLA 3K1PA 1A04A 4AIKA 4S05A 1FOKA 1IF1A 4EMSA 4UHTA 2J5PA 5A0TA 3LFKA 1REPC 4L9JA 3LQRA 3SPUA 1T6SA 2FU4A 4HQMA 2FSWA 1NHAA 4OIPF 3VOEA 2ZXJA 4Q47A 1BI2A 3I59A 2GXGA 1FLIA 2ETHA 2HWVA 1R00A 5D5UB 5ACQA 3MAJA 4ENNA 3E6MA 3VFZA 3L7WA 2P18A 1RIOH 3E97A 1P6RA 4MQ9F 2YNVB 4UVAA 1P4AA 3LVZA 4JK1X 2ISZA 4I09A 3KZZA 2ELHA 3IE0A 2BTNA 3WU1B 4UWSB 1MGTA 2M30A 5FQCA 3ZQ7A 1OKRA 1HLKA 1ON2A 1W7PD 4RBSA 4BP0A 3ABTA 2BE5F 2CWEA 1I6XA 3D0SA 4ZNBA 1D5VA 1R1VA 3GYHX 1HSTA 1XB4A 2FF4A 4LFUA 4WCGA 3SZPA 2ADUA 1HW5A 1K7AA 5ICEA 3LAJA 3DPLC 4P5OA 4LJZF 2HGCA 3O2PE 1L9YA 3LA2A 5ACRA 2BG8A 2W25A 4KDPA 2ISYA 5LBQA 4QWQA 5E8IA 5L3DA 4P9FA 2QINA 5KVRA 5K4MA 2ZMEB 4BHPA 3B02A 4DQ2A 3IRRA 5CVIA 5D8LB 3ROUA 4IRGA 3QU3A 4A0ZA 1TQPA 4DILA 5A2QZ 3F6OA 2XKPA 1XMAA 2F2EA 3Q5FA 3KP5A 4HKYA 4UWPB 3BJ6A 4YSKA 3C1DA 1XGNA 3ZP5A 2IRFG 2ZMEA 2YNTA 2XRNA 5LSCA 5FD6A 5BOXA 2OZUA 2V1XA 3ESHA 4JO0A 1BC8C 3MQ0A 3VODA 2QUFA 1KO3A 2X4HA 3X2XA 1EV7A 3QRFF 1J2XA 2K86A 2VT2A 1O7LA 5HH5A 1H9TA 1CF7A 4U0WA 3ZMZA 4LG0B 4ASNA 3CUOA 2KIUA 2XAGA 1ON1A 3TQNA 3PG4A 4RAMA 3QPTA 3V8KA 2P7CB 2OU2A 3LQQA 3V7RA 5K4NA 3F9OA 4M74A 1FWZA 1U6GA 3I0VA 1ZKPA 4U88A 2P5VA 5DDGA 1UHMA 5DPXA 5HISA 2NNYA 4FT8A 2YX4A 4BH9A 4M9ZA 4G9YA 2XUBA 1HKQA 2BMIA 4D1VA 4GCVA 4KIFA 3QP5A 2QQAA 2A61A 1IRGA 2XR1A 4BHCA 5FLXZ 2Y75A 4HZFA 2EFOA 5A87A 2P97A 1PUEE 5A5ZA 1AWCA 1X8IA 5H6RA 1UFMA 2A69F 3DHAA 3E6BA 3KNSA 1KA8A 4RL0A 4BYYA 1HXDA 5E17F 1T0FA 4DNCA 2HQNA 1JGSA 3AJ3A 1J75A 6PAXA 1TW2A 1Y44A 4WF2A 3HTUA 2OZ6A 4D1TA 4C1EA 4A0XA 3DP7A 1G3TA 4BHBA 2HB9A 1FT9A 2VC0A 4CDGA 3COAC 1PP7U 3CDHA 1A8TA 5FQAA 4ZYGA 2CG4A 5L3FA 5ACXA 1P4XA 2FU7A 3GZ5A 4P55A 1KU9A 2E7YA 4Y15A 2HOEA 1LDDA 3QAHA 3AAFA 5K0WA 4WXCA 3OOPA 5FB2A 2YR2A 3K9TA 4L9NA 2L54A 3F72A 4YFNF 1IXCA 3BK1A 5EEHA 4H0EA 1HKTA 1UB9A 4M9XA 4TYFA 2VBZA 3M8EA 1FC3A 4XBFA 1BM9A 5D4SA 1J9IA 4RB0A 4RAZA 3X2YA 1FBUA 2GMNA 1WSUA 4L0YB 3WTSC 2K4JA 1SMYF 4G7OF 2CO5A 1T98A 3DQVC 2EK5A 1S7AA 3H3UA 3HRMA 5E18F 2GZWA 3N97A 4XLNF 1RUOA 1F9NA 2QQ9A 4ESJA 4EFZA 2OAZA 3J7AO 2UWMA 2YSRA 1BIBA 5JR3A 3F8BA 2O0YA 3ZMTA 2ZNYA 3KP4A 2A6EF 3SW3A 1Z05A 1YQAA 2IT0A 4RS8A 4Q48A 3P9KA 2KJBA 1FYLA 1R1UA 3BJOA 4UV9A 1ZH5A 4TZEA 1JHHA 5FD5A 1R23A 2HZTA 4EYLA 1O57A 4U0YA 2WHGA 2QDTA 3IOGA 3A4YA 2MA3A 2RNJA 3SZTA 2HYGD 2M5WA 2Q9UA 2VT3A 1I27A 2JSCA 3DHCA 4LE6A 1SMTA 2PEXA 2FRHA 2P1EA 4HQEA 2CYYA 4S04A 1XMKA 3CLOA 4LMYA 3KETA 2YNWA 2YNTB 2EWNA 5LLQA 5DCFA 4UUVA 2EFQA 1FSHA 3DPTA 1XD7A 4C1GA 4MGRA 5KK1A 1J59A 4NQ4A 3JAMK 1MDMB 1WUPA 2FNAA 2VOPA 1RNLA 4AD9A 2QZ8A 4ZZLA 3BJAA 2PMUA 2Z33A 1XGMA 5AXRA 1QNTA 1ZLKA 2EV5A 4EV0A 1QZYA 2BFZB 4RM5A 5ACTA 4AIHA 5AONA 1KYZA 1WWXA 1IZ1A 1YS6A 3HYIA 4G7HF 2NS0A 1GVJA 4PVOA 5D6EA 1MZBA 1U5TA 1R7JA 2Q2EA 1YYVA 2L3DA 5J8CA 3J81K 4RGRA 2XASA 1OR7A 2P6SA 2DPDA 3T1BA 3GFIA 4G6QA 2KJCA 3F8FA 3PQKA 4Z6XA 4HF2A 3R0JA 3G1PA 4RB2C 1H0MA 2QWWA 3IC7A 2I7TA 4RGXA 2MD5A 1T38A 2HKOA 2Z99A 5AIQA 5F6FA 1B4AA 4AWZA 2LSOA 5CVVA 2YZ3A 2L01A 3E5UA 4HYEA 3MZYA 4UBQA 3HHHA 3V8LA 3E5XA 1JJTA 5EHTA 4R1HA 5HLHA 2FU8A 5LM6A 3MD7A 4G7ZF 2IVMA 2ZO4A 2D1VA 3RKWA 1M2XA 3LSTA 2LKPA 2EFPA 1O3TA 4M73A 2E1NA 1SAXA 3HIFA 3ISPA 1KYWA 1ZREA 2XF4A 3EYIA 3H92A 5HIPA 4HX4A 3TO9A 3R6SA 1T2KA 3O6BB 4HL1A 4YFXF 4MHGA 4EGYA 1IXRC 2RDPA 3C7JA 3VPEA 2FMLA 3RJPA 3BV6A 3GW2A 4MEYF 3BPXA 3K1MA 5HS9A 4L0ZB 2Y0MA 4N0BA 2VC1A 4RL2A 1DD6A 3J80K 3SFPA 3SXYA 2FA5A 4EJVA 3LWFA 2AS5F 2ACJA 1KQ8A 4K2EA 2JT1A 3WGHA 2OQRA 4TZ9A 1D8KA 4O3MA 4HLXA 3IL2A 2D45A 1IAWA 2M8EA 4M71A 2VBYA 3NRVA 4UWOB 3RIRA 1ZGJA 4HV5A 2IW5A 2OHHA 3IEMA 4HOBA 4NQ2A 3WE3A 5CJ9A 1VTNC 3T8RA 4P62A 5LGUA
chains in the Genus database with same CATH superfamily
1X2NA 5E3LA 1DP3A 4F3QA 2CFUA 1P2FA 4C3IJ 4L9VA 3W2WA 3HKZA 2BY1A 1OYIA 4L5EA 1IDZA 2BY2A 3QQAA 3KFWX 5FFZA 5LEJA 5TRDA 4XR6A 1G3WA 3PIOF 3MN2A 1MSFC 2K9MA 3C2HA 3CJQB 5JLXA 4U87A 5K4KA 3MKLA 3CC4I 2BHYA 2Z2SB 4GYUA 3I11A 1G6NA 1LJ9A 3LSHA 3JREA 4CYCB 3CTAA 1IN8A 4PCQA 5E20A 5FKKA 3WE2A 3FZVA 3KP3A 2L0KA 1B72B 4HSRA 2DFEA 3T0YA 2EQRA 2WAQA 3HDDA 5CVJA 3EDPA 4CICA 3MZHA 2LC2A 2W00A 2VJIA 3RYRA 3GTKJ 3S15J 2ZSHB 1BR1A 4KUMA 1I6HJ 5K5OA 1ONVA 2RV8A 1VQLI 2VLAA 1X2MA 3HXLA 5ILSA 4ZDLA 3ZQGA 4A5NA 3FXOA 1AU7A 4RMNA 3ZGKA 4XIDA 3OYBA 5EVBA 4EYBA 1RKWA 1K78A 2RKHA 3QU6A 1QBJA 2RQQA 4M6YA 4ZO3A 4LLNA 2CSOA 3ZPLA 4EM1A 3M1EA 3PIPF 3PL8A 1LNWA 3K10A 1WPKA 2MYSA 4B48A 5ED4A 4XRMA 3KLOA 4A3BJ 4CCNA 1BOAA 4JQFA 4CUGA 1KZHA 3SHFA 1FOYA 4FX0A 3ZQLA 4A3EJ 1Q1HA 4N9HA 4FQGA 5HLGA 3LSRA 1QPMA 4CZZA 4YELA 1J5YA 2M7AA 4BKXA 5ICGA 3DLLF 4M3BA 3HPGA 1IV8A 1K79A 3JRBA 3ZN0A 2XAFA 1WRJA 1YITI 4U0VA 1GV5A 2W4SA 3KPHA 4L18B 2ZXHA 4HRIA 4HDUA 5DD8A 5E3OA 1O3RA 3H3EA 4J5FA 2EA2A 4C3HJ 3TKYA 2WTEA 4ZYEA 1WCMJ 2I8DA 2VL8A 4LITA 4EJUA 4UY8I 4EGZA 2LD5A 2KFDA 1XCVA 1PP8F 3HHGA 3JRCA 3GO5A 1ETQA 5HS7A 3KP6A 3F6VA 3PQJA 2ZXIA 3FF5A 4AU7A 3D1NI 1VQNI 2NVQJ 1A7TA 3ZR8X 5HIQA 1HLVA 3P9CA 3QPLA 1W1WE 2GOXB 1Y56A 3ZWFA 2DQRA 1UELB 4G8XA 2P0WA 2E7XA 4AWYB 2IS1A 3DU6A 2R7FA 1OQYA 3BP8A 2QBYA 2CQXA 1LE8B 3ABLH 1B8IA 4KT5C 2V6CA 3TMOA 4NQ5A 4KEPA 2FQ3A 3T9MA 1Y1VJ 2K02A 2F5FA 4RAFA 4IX7A 2Z5UA 3DCFA 1FP1D 1OPCA 5D4RA 2HZDA 4XL9A 3ZQHA 2VPLA 2G7UA 4C30A 5FQBA 2R7XA 3CLQA 3E5QA 1XPXA 2XPVA 4DGWB 1VQKI 4Y52J 4YSBA 1USSA 3HGGA 1W5TA 4W97A 1MIJA 3V8JA 3L9FA 4KN4X 5CVUA 3GZ6A 4HW0A 3TBIA 3ADRA 2L4MA 2DPUA 4F6ZA 5A0VA 1WH7A 3BY6A 1JT1A 2V9VA 2HDCA 5AYAA 1HCRA 2CQNA 3IE2A 2DYRH 3I0TA 5IT3A 1YX5A 2Z3YA 5EVDA 5DUIA 5F0FA 3AF6A 2EINH 3JSPA 2CW8A 1YS7A 5E1ZB 3G71I 1JUSA 5AXOA 2XROA 2HOTA 1SANA 4BS9A 2DLLA 1DDNA 2LP0A 3DEEA 3IELA 3FIWA 2HU9A 5FO5A 2EFNA 4CYCA 4AX1B 2M1BA 5LEKA 1IV6A 2WC2A 3HOVJ 3JRAA 1ZR4A 1R5GA 3H0DA 4RAWA 2XSDC 2V9PA 4AX0B 3OYFA 4BY1J 2K4BA 4ZC3A 3J7AY 2YNVA 1FOWA 4N9IA 3GEZA 2NAZA 4Z67A 2VE8A 5HDNA 2IGNA 2GCUA 2F5EA 2IA1A 2FOWA 4EVIA 3K4CA 2OHIA 2KP6A 4EJOA 3I4NJ 3WODF 2YU9J 5F0CA 1PJRA 1EH8A 2MFZA 2L2OA 5HODA 1W36D 1T95A 4WK8F 1AKHB 3TP9A 2L9SA 1LKXA 3ABMH 2EIJH 1KU2A 2TDXA 4BAYA 1UCRA 1D0YA 2EBIA 1EKEA 1I50J 2P8TA 2MW8A 4UXNA 1RR7A 2EIMH 3IUOA 5J4VA 3WTXC 5ILUA 1TTYA 2XDVA 3HRUA 2HTSA 2EIKH 1Z0XA 2L7ZA 2BXZA 3DKYA 4L9TA 4EXSA 2FMYA 2JUGA 3TDUC 4B43A 2RC4A 1Z6RA 2Y0SN 4HLYA 4E7IA 3A01A 2DA1A 5HVQC 3RKKA 4CCJA 1QZZA 1WGXA 3CJNA 3EUAA 2R5YA 4HF1A 3FK6A 1MQOA 2QDSA 5ACVA 2M0CA 2XRLA 3F8NA 3H36A 4DBQA 3CO7C 5L3GA 4HSTA 1HBXG 2R7ZJ 2X85A 3ASNH 1R22A 1TWGJ 2MLKA 4RBOA 1KU7A 4BXUA 3F3XA 3A1YA 2IGOA 3BZ6A 2DT7B 4XSZF 1EH6A 4LIVA 1LFBA 2OPTA 2ZB9A 3DBHB 4QSHA 5LRSA 1GDTA 1XM8A 1BR2A 3S0ZA 3BZCA 5F1JA 1TBXA 2FU9A 4NURA 3BR1A 3QYFA 2Q8KA 3M3YJ 1K07A 2NZFA 1U9NA 2X0LA 3A02A 3TO7A 1LQ1A 2LFBA 4LD5A 1F5TA 2LK2A 2F4MB 1HW1A 1PUFB 4IHWA 3IWZA 3EYYA 2E2JJ 1O7FA 4RDUA 1VF9A 1W7PA 3JRHA 2KHMA 2IS4A 1OJLA 1YIJI 1VQMI 2G7HA 5JI6A 2GAUA 3QP6A 3U1DA 2Y87A 2DT5A 2P7VB 4FEKA 1HC8A 5EV6A 4FETA 1H9GA 3H5NA 1V55H 2V6EA 3ESWB 2BG8B 4FR7A 2E5NA 4GCWA 1IDYA 2XAQA 3G1MA 1F36A 2Q2EB 1ZGAA 3GXOA 3RPCA 5LS3A 4CHUA 1HSJA 2EV6A 2QENA 3W2VA 4F7ZA 3L2UA 3ZMDA 4CYDA 3HSRA 3NQOA 1LVAA 4NC8A 1TQIA 2K27A 2WV0A 2I7XA 3BC2A 2IJLA 3MFKA 3EETA 1ZTRA 1Y8QB 2P5KA 1P92A 1SAUA 3I9V2 4BDZA 2PI0A 4II2A 2J5OA 2VOOA 1BC2A 4XOPA 4XORA 2KIQA 5F08A 4S0HB 3OYIA 2DOOA 2ZCWA 4OMYA 4UVBA 5LLDA 1GUUA 5TISC 3JW4A 3ZMSA 4C2MJ 3TP3A 3R0AA 2AIOA 2YNUA 1KQ9A 2H8WA 5M5XJ 2V4JC 4CZCA 2VBWA 1JE8A 4F52A 2OUMA 1OYYA 1VJNA 2YU3A 4E7HA 5K7FA 3N4MA 4UA4A 1NG7A 2KMUA 3LSGA 5LD2C 3QOPA 2HVQA 5EH9A 1DGWY 4KIGA 5ERIA 4FX4A 3V4GA 3GUDA 5LHIA 5GAGJ 4YIRX 5EEGA 2RNGA 3CCLI 2BOLA 3QYBA 5LRRA 2HS5A 1LEBA 1X3WB 4BEHA 1ZKGA 1YLFA 1BIAA 4IQJA 2O9LA 4XWTA 5HDKA 3PUBA 2PMZA 3LSKA 1JUMA 3H5AA 5LGTA 4FISA 2HYJA 4I76A 1TL8A 3JR9A 5AHRA 1S5LC 3I53A 1X1DA 2CU7A 1HQCA 4RAGA 5B3RA 4B44A 2DK5A 2WYMC 2VQGA 1O4XA 1STZA 1FJLA 5HS8A 4ZYDA 1CGPA 3BG5A 4XMYA 3RKQA 1UZCA 5K1YA 1G4DA 1X1PA 2DJIA 1O3QA 1VQPI 4XQFA 4J00A 3L09A 1SFKA 3IKVA 3L2CA 3WTYC 2ZWRA 4ESBA 4PFOA 3S16J 1DUXC 5ICCA 2KRCA 5ICFA 2GQQA 3CDIA 3EUHC 3M9AA 1YHQI 1P9EA 4IHTA 4J19A 1J09A 3S2WA 1QHHD 4CCMA 5IYCJ 2IS6A 3KNRA 3X2QH 1UJ8A 3I59B 4B09A 2KIFA 3IWFA 1W0TA 2E1CA 3L2QA 3HSFA 5L3EA 1MMDA 1OCOH 2JRTA 4I01A 2ZJRF 2Q0OA 3A03A 4MNUA 1M1EB 1FMVA 2NOGA 1ZHFA 3HJEA 4XLPF 1EF4A 1V5EA 2HEOA 3BR0A 1A6QA 4OMZA 2BBYA 1WI9A 1MMAA 3U21A 1DU0A 2A7MA 1F1ZA 3MKZA 2DMUA 2DK8A 4DZPA 1XMXA 2E36A 1N25A 3LAPA 2XV4S 2DOFA 2FE3A 3RSNA 3PUFA 5F64A 1Z21A 3S14J 3BG3A 5DEQA 1ODDA 2BGCA 2K40A 2XF7A 4JX6A 2O5RA 4ZYHA 1Z7UA 1P9QC 2H6CA 1QU3A 3TOBA 2OTJI 1T33A 2KPMA 1QO0D 3VB2A 4B8XA 3FCZA 3T5XA 1YCGA 2DMPA 1MNEA 2XIGA 2RN7A 3IKTA 1RR8C 2DBBA 2JA2A 3LA7A 2M8GX 4AUXA 4UAMA 3Q6VA 2BVMA 2DMQA 3FM5A 4XKBA 5IYBJ 4MTDA 2XGEA 5JVTA 3UNGC 2FM6A 4BGDA 2BG6A 2LNBA 3FWEA 3HRTA 3HBLA 3WTWC 2LREA 4A5MA 1I3QJ 2M34A 2QYOA 1OFCX 5CPRB 5A2QK 1B72A 2RAEA 1WJEA 2P5LC 3K0LA 2VPRA 1OCRH 4A3GJ 1MJAA 2LKXA 4GO1A 4A3JJ 1XGOA 3SD9A 2PLYA 3ZQIA 1WRAA 2VBXA 1XCBA 5H2FC 3HOTA 2BYVE 2X9DA 2A68F 4DW6A 2Y9ZA 3J7ZI 4KT6A 3GTMJ 1J0RA 2O3FA 3ZRGA 4OIOF 2W57A 2R93J 2V26A 3ZQFA 4YG2F 4M3DA 4A2UA 3VYTB 4GDFA 1GT0C 1TT5B 3IV5A 4PDXA 1S6LA 1WQ2A 2I7VA 3FISA 4ENJA 4MEXF 2FEZA 4HA8A 1WJCA 3AF5A 3UR3C 2WAFA 3K2AA 1MJBA 4G12A 2W85A 2R7RA 2HOAA 3M8FA 1XSXA 1OMIA 1FMWA 4ENKA 3A0HC 4B4CA 3BOQA 3CJRB 3NEUA 1U8BA 1TC3C 3I54A 4AVPA 5D5WB 4D5CA 4IJAA 2E7WA 1JJ8C 3BPVA 2VKVA 3BTLA 2VQHA 3L00A 1R58A 2O6GE 4UVCA 2L7KA 2DQLA 2FHXA 3GFJA 2DTRA 3KZIC 2XB0X 3PSIA 4CO8A 2CJJA 1QVUA 3GFLA 2ME0A 4C3JJ 3M07A 1ACIA 5DD4A 2M87A 3HUGA 4BU2A 2HOSA 1T39A 2NVYJ 1BI0A 3FHZA 4ENMA 1JTYA 3IDZA 4PJLA 2VE9A 1PUFA 2DU9A 2NVUB 1QZEA 1ZLJA 4BACA 1YI2I 3I71A 5FLXK 1FX7A 5D5VB 3BTIA 2DDAA 4MLOA 4NC7A 3M7GA 2K5CA 4IQ4A 4J01A 2CFZA 2FUG2 2G0EA 1MNMC 3PO2J 1Z1DA 1ZRFA 4E7LA 2YCBA 1RZ4A 2EA4A 3RZDJ 4PFPA 3F8MA 3ML6A 1V4RA 4GYIA 4BJTA 3ZR9A 2G9WA 4LOCA 4Z60A 2TCTA 2MH9A 4HX8A 3JXPA 2HQRA 2DOEA 4YIIA 3EQLF 2ZFWA 1BI3A 5LMCA 2NYPA 5J40A 3WG9A 3FBNB 3A2KA 5KCMA 3RCOA 1B59A 3OL4A 3LSIA 2CW7A 3IOFA 3CMEI 1BMCA 5D8KB 5HDGA 1E3OC 2WRSA 2V9KA 4LLGF 4NQWA 1RPWA 3WXCA 1X8HA 3I5UA 4A6EA 2V1NA 2JUCA 4L5IA 2VW8A 3H9QA 3K2ZA 4V19K 4BXXJ 3DWLE 2AZ4A 2HI3A 2LR8A 5K7ZA 1WKMA 3HRSA 1K4SA 4EJTA 2PFBA 4G94A 4EY2A 1CF7B 2FOKA 1B9NA 5TJJA 2NRAC 1UG2A 2H6BA 1CQTA 5FKMA 2L4AA 2KRFA 1HA8A 1KQ0A 1ETOA 1V3FA 4I99C 4TV7A 1FP2A 1G3YA 3O8GA 4ZYAA 5EG0A 1WW1A 2WWYA 5M5WJ 4OIRF 1TWCJ 2M5CA 5B1UA 3FXRA 4D02A 3CDLA 4A69C 4I98B 2BXYA 3CMMA 1X58A 4X0GA 4UB6C 3SQNA 1X1BA 2DKFA 5EYRA 4RB1A 2RGVA 2IGKA 4L5JA 2E1OA 4RAYA 5IQKA 4OOIA 4AYBA 1FEXA 1TZLA 1DDKA 2IXSA 5JLWA 3IE1A 3BWGA 1RESA 3ERED 3MEXA 3OYLA 2H09A 4RGSA 3RI4A 1E17A 3EPZA 1VMEA 2ZNBA 3WG7H 2KDOA 5D6FA 5GTHC 3K4LA 4AC0A 3J80Z 4QLCU 1YO5C 1C0WA 2F4IA 4AWXB 4ESFA 5BS6A 5FLMJ 3FXKA 2DFHA 1ZG3A 3DH8A 1T08B 2PBIA 3GVAA 2XKOA 2JMWA 2Y2ZA 1U5TB 5FGMA 3IRQA 5JVGF 3G6EI 2YPRA 3I15A 4AXHA 3NAUA 1VQ7I 5F04A 1FIAA 4BQQA 5E79C 2HTJA 5ILVA 5BNGA 3Q9VA 3M8JA 1I1SA 3SEQA 4KMFA 4Z7RA 2DDBA 1JKPC 5AIPA 4EQQA 2BFZA 3HM5A 3ULQB 2H1LA 5AIJA 4Q5SF 3MCZA 2HXIA 3AG1H 4XICA 3TGNA 4NDLA 2VKEA 2XHKA 1W4MA 2FJ1A 3FMSA 1DU6A 2CW0F 2ICWG 4BDYA 4B1RA 2D1HA 3CUQB 1RRJA 2GLOA 3CC2I 2WYLA 2CUZA 1SD6A 2ZKZA 3OR2C 2R7TA 2VI6A 3T3NA 2DFIA 3GTPJ 2E34A 1D1AA 3H1CA 1ZN2A 2HDDA 3KL7A 4PGHA 2LF7A 3NWSA 5DUKA 4KA4A 4IKFA 5B3SH 5LCAA 4AM3A 3LSMA 1WI3A 4XK4A 2GKLA 4HG2A 3WTZA 1JJEA 3WGGA 4IRIA 4CHLA 2OF7A 2QQ8A 2EZHA 1LFUP 2JZYA 4G6DA 1A36A 1XGSA 3DU5A 1FBSA 3TO6A 2W24A 2BG2A 4BZ3A 1LVKA 3KE2A 2OV7A 5FFXA 2BFKA 5BQTA 1ZYRF 4GGGA 3S3MA 4FASD 3FAIA 3P2UA 2NS7A 4YSLA 2QQBA 2KT0A 2RVCA 3I4PA 3BDDA 3CQZJ 4NBQA 1P7IA 2Q1ZB 1PDNC 4DZJA 1FZPB 1USTA 3K70D 2OJED 2VXZA 2R92J 1IN7A 3BR6A 3OMYA 4HV6A 5E8GA 4P1WA 4I02A 2VODA 4P96A 4PGGA 3BR2A 1VQ4I 4W1UA 4IRHA 4DYRA 5C4JJ 1Y0UA 4IPAA 2DODA 1R36A 4TYTA 4PK4A 4TZFA 4EXYA 2LMDA 1B9MA 5K5QA 2JPCA 2WV1A 2LBFB 1JJ6C 1G8XA 2E2HJ 3HTSB 2E2IJ 3W3CA 4PSXA 3U9GA 1K6OA 3RQ4A 5K7HA 1HKSA 2E1MB 1YIOA 4LG3A 3OYGA 5DTDA 4BNCA 2JPBA 4H0DA 2DA5A 4TZBA 5EW0A 2EB7A 5H20A 5J6XA 3HSEA 3CCYA 5GTIC 4A0YA 1E3HA 2DXIA 1MDMA 1VQ5I 2M4KA 1FSEA 3H3ZA 3T3OA 5HH6A 3PY5A 2O8XA 1B8IB 3W6VA 1K78B 2LKSA 4RM2A 1BJAA 1JHFA 2DA2A 4IO9F 3AL0C 1ZRDA 2ZJQF 2BY0A 2FNPA 1QGPA 2CV0A 2DI3A 3GF2A 1XSDA 2CQQA 3UKGA 4J5HA 2LF8A 2Y8AA 3MKWB 3I14A 2OCEA 3K6GA 2ZJ2A 3H9GA 3JTHA 4HDVA 4BQAA 2BIBA 5FRNA 4EYFA 2AXTC 3E3VA 5FRMA 2D5VA 2FBIA 3WTTC 1DXKA 1DPRA 3DKXA 4A3FJ 1Z67A 2MG4A 2UXNA 3P9IA 2QJSA 1LDJA 3WU0A 5FKOA 2LY9A 3D5LA 2R0QC 5IPAA 4C9YA 3JAMZ 2FHXB 3L2RA 3BK2A 4D1UA 4RLFA 2HQAA 1OYWA 3H3VK 4NHJA 3ZQ4A 2IA0A 2Q0IA 1MBEA 5JFRA 3DXJF 2WYMA 2NZEA 3J81Z 4PZJA 2OBPA 1S8NA 1BVTA 3CCUI 2TRTA 4LK1F 5ACPA 4Y3OA 1J7KA 2YX7A 2ID6A 2XB5A 1JI8A 2GXBA 1YFHA 1LUJB 3HL2A 4E4HA 2ESHA 1FY7A 2ESNA 2EZKA 1LE8A 3CESA 3X2ZA 4YRVA 2Y48A 3N05A 1X3UA 1ETVA 2NOJB 4CXFA 4HNVA 3JSOA 2FBKA 1ZRCA 4RGUA 2EFWA 1V5FA 1X3ZB 2PN6A 2I5UA 2PX9A 3C18A 1MBFA 2MC4A 2P4WA 1LB2A 1A6IA 3H35A 3W2AA 3ZQQA 3ECOA 4EM2A 5J8FA 1ZG5A 3GTJJ 1SC7A 1B1BA 2PJRA 3ELKA 3R61A 1VZ0A 2IBDA 4WX9A 3QODA 1F4KA 5LE1A 4I0AA 5CQGA 4ZZDA 4FTHA 2HFHA 4IHSA 2E19A 4OAYA 1TNTA 3M4OJ 4D1WA 1ULYA 1Y6IA 3RPUD 5K5RA 2VN2A 4DJAA 4XSXF 2KQRA 4M9SA 4XLHA 3V7SA 2F5VA 2A6HF 2OQGA 2GIVA 1Z7LA 2LRDA 1OCCH 3SBLA 1K6YA 3OR1C 4KIBA 2CFOA 4BBRJ 2K3FA 3F23A 5L3CA 2V79A 1XC5A 3FXQA 2F5DA 4U4LA 3PM1A 2QEDA 1VGNA 2VONA 5E1XA 2VKHA 5EV8A 4ZJZA 2Z16A 5JHUA 2H1KA 2FK6A 1YOVB 5H6QA 2CBNA 3SFIA 1ZELA 2EZLA 4IHVA 2O61A 4KISA 3PNVA 5B1BH 3KLNA 1IXSB 4IVNA 1EA3A 2L7MP 5ACUA 4RM3A 4MQVA 4NUBA 3K1NA 2M4GA 5C44J 4MO7A 1JXSA 4UV8A 2M45A 1WH5A 2ZBKA 3LSJA 2BZTA 3R60A 4BUPA 1UHWA 2XVCA 4OU0A 3L2WA 3QH8A 4C1HA 2XPWA 2R5ZA 1SFUA 4KYWA 2X48A 4U7DA 2CFXA 1K83J 3KEYA 1BR4A 1TWHJ 1S9HA 2X1EA 4A3IJ 4AV7A 2MH2A 1FNNA 1S29A 4Y17A 2ZNZA 5IT9Z 1BN5A 2R2DA 2Z9OA 2M3AA 3V7CA 3IHUA 2VXDA 4PVTA 3AL0B 2HKXA 3DKWA 5JHFA 3RKXA 4LB6B 1Z9CA 4BJ5C 2OD5A 4KJZA 1NK3P 3FX3A 4BQOA 1U8RA 1G3SA 2R7SA 3W6JB 3BTJA 2D2WA 2ZZIA 3FDYA 4Y13A 5C3EJ 3DFGA 2CS3A 4YIFA 2GA2A 1FBQA 1E0EA 1MMSA 1IRZA 1IN5A 4EJWA 3P7NA 4O5VA 1P7JA 1KGSA 5A23A 1SFEA 4EM0B 2DAOA 4R79A 2DFFA 1B6AA 1RI7A 3ZN1A 3CP2A 3JRFA 4Z2YA 2P81A 3A0BC 5CLSA 4LB5A 2BFLA 2JK3A 3TOAA 1IRFA 2ECCA 1JKQC 4ZO2A 1TW3A 1SFXA 5LGNA 4UUSA 5HIOA 2XGXA 1X4PA 1QA6A 2JTVA 3R2UA 4H4KC 5LGUA 3MWMA 3RKJA 3ECHA 5B5EC 3W6KB 3TL4X 4ZDOA 4QTRA 5B1AH 5FKLA 3Q0UA 1D1CA 1MJ9A 2RQPA 1ZNBA 1ZK8A 1KR3A 2GXAA 2CQKA 3KEQA 2K7LA 1H8AC 5HLIA 4P9UA 5LHHA 1T8IA 2M5DA 1JUPA 9ANTA 2IGMA 2GA1A 2P4ZA 2UZKA 2O03A 2EZIA 2DMTA 3VEPA 4YFKF 2ZC2A 1W7PB 1YCHA 3FMRA 2QSFX 3HOSA 4PJMA 4Z5ZA 1BL0A 1OCPA 3JTGA 2Q42A 2QM3A 5M5YJ 5IP7J 1ENHA 1Z3XA 2BV6A 5DV5A 2QA4I 3GZNB 2DA3A 3OIQA 4D0PA 2GFKA 3K4MA 3ZCOA 2HPMA 3SZGA 2B0LA 2FBHA 3FXLA 4ETSA 3F8CA 1HDDC 1QH3A 4XKWA 1R5HA 1YRNA 2XAJA 4X6AJ 2GIZA 1MKMA 4CCLA 1VQOI 2CH0A 1YCFA 2W48A 5LCFA 3LOCA 5HH4A 2XAHA 1APLC 3EUHA 3T8TA 4R8HA 3WHCA 3CMYA 3HOXJ 4HX7A 1ZGWA 3SRXA 1E5DA 2A07F 1FYMA 3S1MJ 3CCRI 3BQZA 1W5SA 3WTUC 5F1RA 1ZARA 2F6CA 3REOA 2LTPA 3IH2A 3FHNA 4I0BA 3L6NA 2JN6A 2X6XA 4LIUA 2BW3B 4M6XA 2PG4A 4DIQA 1TT0A 3CF2A 4UWRB 4HF0A 3J7YJ 2ZJPF 4O98A 4A3LJ 4XLCA 5HOOA 4M72A 2BG7A 2DW4A 4KFCA 3FMQA 1VQ8I 3FXJA 1V54H 3CP8A 5CQEA 2MC3A 3KZYA 1OISA 1PVEA 4D9JA 3VSLA 3G3ZA 2V1UA 1XDSA 4I7HA 1I5ZA 3F22A 3VQZA 4B3XA 2L02A 3LA3A 4XOTA 2GBYA 2VJJA 3RYPA 1LFPA 5KNLA 5AEBA 2MLGA 3TDZC 3VYSB 3ONQA 2LLKA 2FU6A 3DHBA 5LHGA 3OYDA 4EATA 3BZKA 2NNNA 3L2VA 1D3YA 1U3EM 1FPQA 3KCCA 3GWZA 5BPIA 3GX4X 3OYKA 4CGZA 2CGPA 2A3SA 2K85A 1D0ZA 5CVRA 4BXFA 1VNDA 3KEOA 4HAMA 3RPUA 2KDZA 2H6AA 1XDUA 2IP2A 1VQ9I 2W1OA 3DEWA 4AVZA 1IN4A 3VYRB 4C2UA 2R7QA 3I58A 2OTLI 2WAQN 4XN0A 1W0UA 5CYVA 2MBFA 5CKTA 2K9QA 1Y39A 4XWWA 1Y1WJ 4FSBA 4KICA 1JGGA 4XLFA 4CA0A 3HB9A 1IUFA 3E6DA 1AHDP 2WBMA 4Z5YA 3K69A 1AOYA 1RKTA 3KP2A 1JKOC 4NQWB 4KITB 4C1FA 2P6TA 2MGQA 2QLZA 2B63J 1TWFJ 4C2TA 1IUYA 5EWAA 2OHJA 3Q3SA 2WB1A 2F48A 4NC6A 5EZGA 2LH9A 1YG2A 3H0GJ 1SVMA 4E6KG 1GXQA 4GXOA 1TQMA 5E1WA 3RDIA 3ZMUA 3P5JA 1LPQA 3K70C 2JA5J 2NXAA 2KIMA 3KP7A 2VQLA 3SFZA 2MABA 2QBYB 2COMA 1YW9A 4OIQF 5B66C 1LEAA 2NYXA 4LGWA 4GYGA 2JVGA 5GAEJ 3I13A 3O3KA 5HLTA 1MD0A 5FROA 2PJPA 5AHOA 4C1CA 1DPUA 4I6ZA 2BY3A 1Z6TA 5IT9K 3ZMVA 4A3MJ 1XN7A 2E35A 1LDKB 1U2WA 3OS2A 4A12A 4JX4A 1E3PA 4OINF 1FYKA 3I64A 4XRSA 5HNHA 3GFMA 1R71A 1WHUA 3CCJI 1L3LA 1D8JA 3PY6A 3H9JA 4PJJA 1WZ2A 5F0HA 4U7BA 4I2OA 2Q0JA 1TLHB 2LDUA 4BY7J 3FM3A 5KIKA 4D5FA 1POGA 2WAEA 2GOMA 1WJ5A 4KEQA 2R7DA 3OV8A 4DIKA 2R5ZB 2MD0A 1U5TC 1XSVA 2JWTA 4PJNA 4UUSB 2GFJA 3HOYJ 5DCMA 4WWCA 5KAFC 2BR6A 5LCHA 5BMZA 3SDGA 4FCYA 2R3SA 4MFDA 5EVKA 3ABUA 4ON0A 1WUOA 3OOUA 1Z77A 2VB6A 2W7NA 4NQ6A 3DBLB 4WXDA 5EEAA 3CUQC 4ZTFA 1S3JA 1YTYA 5L3BA 1QH5A 3IEKA 2Y9YA 4FHTA 1VQ6I 2UXXA 3G1LA 2X6YA 2K9SA 5IY5H 2OC6A 2JRMA 2E1MC 4KMUX 4E70A 1ZG1A 4XRFA 5ACWA 1GXPA 3WGIA 2UV1A 3OYJA 2ME6A 3E0JB 1BC7C 1IN6A 5DCMB 1ITYA 4RB3C 3FXUA 4BL0B 3AG3H 4UB8C 2IA2A 4ZH4F 2DTZA 1TNSA 2F4OB 2H27A 3CO6C 5IP9J 2E71A 4JBAA 3Q0VA 1Z91A 4Y4RA 5EZHA 2EJRA 2OA4A 2ID3A 3HUGB 1MBGA 2AQFA 2X1CA 2UYXA 2FXAA 2L9VA 5GADJ 4WXHA 2CG2A 3RPQA 2STWA 4LK0F 1BW5A 2QVOA 2GM4A 4HL2A 4B87A 1RUNA 3CF5F 2PQ8A 1UHSA 3F21A 1X19A 3DV8A 2N8GA 1P4WA 2V1DA 3DTIA 3RKYA 4ZEJA 4B3AA 4MTEA 2KLOA 2DCEA 4M3GA 3DEUA 4GFBA 2STTA 4E7ZA 1QQIA 4Q4ZF 2Y30A 4AIJA 1FTTA 3B73A 3FBIB 2PMZN 2H94A 1R1TA 2HDWA 5M3FJ 1IC8A 3CC7I 1SD4A 1ETWA 5DYMA 3R4KA 2BVLA 2HR3A 4B47A 3WTVC 4C1DA 4F6HA 3X30A 4GYQA 3ZXSA 3GTOJ 3DF8A 1IW7F 1O3SA 2LBFA 1BBYA 3CZ6A 2L9RA 3BTCA 2DO7A 5ACSA 2W84A 1DP7P 4WD6A 4LG0A 1EH7A 2BEOA 2F5CA 1YW8A 2HYFA 1X8GA 1SD7A 2KZVA 4PDKA 3ZNBA 5BPDA 2Y0SA 2GWRA 3QPHA 3G73A 3OSGA 4UNOA 2EV0A 4XUKA 3U2RA 3PFIA 2CUJA 1A31A 2IPQX 3DTEA 2C6YA 1W36C 3Q0WA 2PMHA 1I1GA 2Y8BA 1BI1A 3GLXA 2JQ7A 1L0OC 3C3WA 4KN7X 1ZTCA 4O6JA 2BC2A 5IOZA 4V0HA 5B15A 4A6DA 4C09A 1KO2A 2FD5A 1E2XA 3SEZA 3E6CC 3HC7A 2KKOA 1XTOA 5D5XB 2QKLB 3SYTA 2BGAA 1YW7A 2XSJC 1S7OA 3DLAA 3RTRA 3Q9SA 3ZOBA 1WVRA 1SD5A 3GMEA 2AXLA 1G2HA 1U78A 1SMLA 4LLLA 1ZAOA 2CUFA 4IF4A 3CUQA 4IXAA 1R49A 1HW2A 2A5YB 1OCTC 1KU3A 1PYVA 1MW7A 1GHCA 1Z3YA 4KNYA 1A5JA 4NB5A 3KYCB 3LMMA 3BROA 5KILA 4HBLA 3K1PA 1A04A 4AIKA 2XGDA 4S05A 1IF1A 4EMSA 1FOKA 4UHTA 1FIPA 2J5PA 5A0TA 4XRSG 3LFKA 2K9LA 3V42A 1REPC 1UAAA 4L9JA 3LQRA 3SPUA 3DBRB 1T6SA 2FU4A 1IRXA 3S1RJ 3BR3A 4XNFA 3DTKA 4HQMA 2FSWA 2R7OA 1NHAA 5IP6A 4OIPF 3IH4A 3VOEA 2ZXJA 4Q47A 4F93B 3S32A 4A93J 1BI2A 3I59A 2GXGA 1FLIA 2ETHA 2HWVA 1R00A 4XONA 4ZTJA 1YJNI 4PSWA 2VJ4A 4YEJA 5D5UB 2VASA 3LSPA 5ACQA 3K4KA 1SVLA 3U1KA 1DQUA 3MAJA 2E5ZA 3E6MA 3NARA 3VFZA 3L7WA 4ENNA 1RIOH 3E97A 2P18A 4QIWN 1P6RA 4MQ9F 1K61A 2YNVB 4UVAA 3IAS2 1P4AA 1MBKA 3LVZA 4JK1X 2ISZA 3I4MJ 4I09A 3KZZA 2ELHA 2AO9A 2CRGA 3WU1B 2BTNA 3IE0A 1MGTA 4UWSB 1HDPA 4M3FA 2M30A 4ITVA 3ZQ7A 3OYMA 5FQCA 1OKRA 3CCVI 1X4OA 1OCZH 1ON2A 1W7PD 1HLKA 4RBSA 1IGNA 4BP0A 3ABTA 2BE5F 2CWEA 2WY8Q 1I6XA 2X1DA 4XKCA 3G4SI 5KAIC 3D0SA 3S2HJ 4ZNBA 1D5VA 1R1VA 3GYHX 1HSTA 4F92B 1XB4A 3PFYA 2FF4A 4CH7A 4LFUA 4WCGA 5GP9A 2VIXA 3SZPA 2ADUA 1HW5A 2V7FA 1K7AA 5ICEA 2DA7A 3LAJA 3BG7A 3DPLC 1MBHA 3EUKL 1MH4A 4P5OA 1JT6A 4LJZF 2HGCA 1MNDA 2HPIA 4OWRB 3O2PE 1L9YA 3LA2A 5ACRA 1R6RA 2KISA 3ABKH 2BG8A 2W25A 4KDPA 2ISYA 5LBQA 5DS9A 3B6AA 4QWQA 5E8IA 5L3DA 4P9FA 2QINA 5KVRA 2QEXI 3H5RA 5K4MA 3FXMA 2ZMEB 4BHPA 3B02A 4Z6YA 4DQ2A 3IRRA 5CVIA 1X1CA 4HEA2 4IRGA 3ROUA 3QU3A 4A0ZA 1TQPA 5D8LB 4DILA 3VPRA 5A2QZ 3F6OA 2XKPA 2R7WA 2QGUA 1XMAA 1EJ9A 2Z1DA 3LNQA 1GVDA 2RREA 3GTGJ 2F2EA 3TW7A 1SEUA 3Q5FA 2DA6A 3KP5A 3BG9A 2X51A 4HKYA 3D5SC 4UWPB 2YUSA 3BJ6A 5EDNA 1N75A 2ECBA 4YSKA 3AFHA 2ZXWH 3C1DA 4DBRA 1XGNA 3ZP5A 2JJ7A 2X6OA 2IRFG 2ZMEA 4IZZA 3OS1A 1R4MB 2YNTA 3HEFA 5FJ8J 2XRNA 1ETKA 2L9NA 5LSCA 2OCCH 5FD6A 2OZUA 5BOXA 2V1XA 3ESHA 4JO0A 1TP4A 2R5YB 1BC8C 2EPFA 3OYNA 3MQ0A 3OYAA 3VODA 2QUFA 1IJWC 1KO3A 3OIOA 2X4HA 4ABZA 3QWLA 2LG4A 1EV7A 2CMPA 2NXNB 3QRFF 3X2XA 2DA4A 1J2XA 2K86A 2M2EA 1O7LA 2VT2A 4E7SA 5HH5A 1G59A 1H9TA 1CF7A 4U0WA 3ZMZA 5E3MA 3GBGA 4LG0B 3HG9A 4ASNA 3CUOA 3JRDA 1R9TJ 1X1AA 2KIUA 2XAGA 1ON1A 3TQNA 3VSKA 3PG4A 4RAMA 3QPTA 4Y7NJ 3V8KA 2P7CB 3CCSI 1T0FC 2MSYA 2OU2A 2R7VA 3ASOH 5J4YA 3KX2A 3LQQA 4FE7A 4AIDA 5DM7F 3V7RA 3IH3A 2VKDA 3BC8A 2O7OA 3PJRA 4F55A 3S17J 5K4NA 1JKRC 3F9OA 4HNTA 4M74A 1FWZA 3GLLA 1U6GA 3I0VA 1YRNB 4U88A 1ZKPA 2P5VA 3OS0A 5DDGA 5J3LA 1UHMA 5DPXA 5HISA 2NNYA 3WHBA 4FT8A 2YX4A 4BH9A 3RQIA 4M9ZA 4G9YA 2XUBA 1HKQA 2BMIA 4D1VA 2B7EA 1S7EA 4GCVA 4KIFA 3QP5A 2QQAA 1WJBA 1UG0A 1JTXA 2A61A 1IRGA 1V5GA 2XR1A 4BHCA 1XX5A 1QVTA 2Y75A 2EFOA 4HZFA 3S93A 5FLXZ 1PUEE 2P97A 5A87A 5A5ZA 2AHQA 5DM6F 1AWCA 3FKIJ 4HNUA 1X8IA 3CJTB 5H6RA 1UFMA 2BHZA 2PJRB 2A69F 3GCMA 2M7BA 3DHAA 3E6BA 3KNSA 2QCOA 4V2FA 2DJNA 1KA8A 5KHDA 1TWAJ 1XS9A 4RL0A 3QYEA 4BYYA 1HXDA 5E17F 1T0FA 4DNCA 3PNTA 2HQNA 1JGSA 2LOOA 3AJ3A 3F9KA 1J75A 6PAXA 1TW2A 1Y44A 4XLAA 5IOYA 4WF2A 3HTUA 1WJFA 2OZ6A 4D1TA 3G1OA 2LY1A 4C1EA 4A0XA 3DP7A 2WY7Q 1G3TA 4BHBA 2HB9A 2E60A 1FT9A 3TP0A 4IOCF 2VC0A 4CDGA 3COAC 3JRIA 1PP7U 2XF5A 3AKZA 4JOMA 3S1NJ 1FTZA 3CDHA 1A8TA 2DT6A 5FQAA 4ZYGA 2LYCA 1NTCA 1H88C 3LFUA 2CG4A 3MZ8A 3S3NA 5L3FA 3JRGA 2WB1N 3M1CA 3KYDB 5ACXA 3NWTA 2KL4A 4CSWA 1P4XA 2FU7A 3GZ5A 4P55A 2ZMEC 1KU9A 3BCAA 2E7YA 4Y15A 2UUZA 2HOEA 3MD2A 1LDDA 1SVOA 3QAHA 1BA5A 3AAFA 3VWBA 5EGOA 1Q1VA 5K0WA 3PSFA 4WXCA 3CD6I 3D5RC 3OOPA 5FB2A 2YR2A 3K9TA 4L9NA 2L54A 2X6WA 3F72A 4YFNF 2JA8J 1I3AA 1IXCA 3BK1A 5EEHA 1Y8RB 4H0EA 1DGRM 1HKTA 4XN3A 1UB9A 3E1SA 4M9XA 4TYFA 2DYSH 1YJ9I 1XTAA 2VBZA 2EILH 1W5CC 3M8EA 5TGTA 5FKNA 3KIOA 1FC3A 3QPSA 2NS8A 4XBFA 3I56I 4BJ6C 2M0MA 2QSHX 1YE9A 3OYCA 5HNFA 1BM9A 2IS2A 4QPQA 3ERMA 2XGCA 4D7NA 5D4SA 1ETXA 1RETA 2XPUA 4M3EA 5GAHJ 4PJ0C 3OL3A 1J9IA 4RB0A 4RAZA 3X2YA 1MMGA 3OY9A 1IO2A 1FBUA 1HOMA 2GMNA 1WSUA 3GTQJ 4GRIA 3VYUB 3B6CA 4L0YB 1A35A 3WTSC 2K4JA 3L1PA 2I10A 1SMYF 4G7OF 1ERDA 2LY2A 2CO5A 4UUTA 1T98A 3OIPA 3DQVC 2EK5A 1VFCA 1S7AA 3H3UA 3HRMA 4D7MA 3OYHA 5E18F 4JX5A 2GZWA 5J1UA 3BT9A 5F27A 3N97A 4XLNF 1IG7A 1RUOA 2XF6A 1F9NA 2QQ9A 3C2BA 4ESJA 4EFZA 2CQ7A 1WFXA 3E7LA 2OAZA 1RC9A 3MMYB 3J7AO 2YSRA 2UWMA 1BIBA 1N78A 5JR3A 2Y31A 3F8BA 3CMAI 2O0YA 3ZMTA 5EGOB 2ZNYA 4ZDPA 3KP4A 4BE1A 1VI0A 4FE4A 2A6EF 1QHGA 3SW3A 1F43A 1Z05A 1YQAA 2IT0A 1MSEC 4RS8A 2O8KA 4Q48A 3P9KA 4OAZA 1HF0A 3TEDA 2NVXJ 2KJBA 1FYLA 1R1UA 4BQNA 3BJOA 4CCOA 3VDXA 3AG2H 4UV9A 1ZH5A 4HPQA 3S1QJ 4TZEA 1JHHA 4JYKA 5FD5A 2FQ4A 3I55I 1R23A 2HZTA 4EYLA 1O57A 1ETYA 4U0YA 1QRYA 2WHGA 2QDTA 1MMNA 1D1BA 3F0CA 2L5QA 4EEFG 3A4YA 2MA3A 2RNJA 3IOGA 3FK7A 3DPUA 4PUSA 3SZTA 4IHYA 2HYGD 2LVSA 2M5WA 2Q9UA 2VT3A 1I27A 2JSCA 4ANJA 1ZQ3P 4Y33A 3DHCA 4LE6A 1SMTA 4BEHB 2H8RA 3JCUC 2QF7A 2PEXA 1R5ID 1YX3A 2FRHA 2ELJA 3CCMI 2CUEA 2P1EA 4HQEA 2CYYA 4S04A 1XMKA 2AQEA 3CLOA 4LMYA 3KETA 2YNWA 2YNTB 3BLYA 2EWNA 3QOEA 2HVRA 3A4CA 2M9HA 4XLEA 1XG1A 1N77A 5LLQA 4IHXA 1UMQA 5DCFA 5EJCA 4UUVA 2EFQA 2KRHA 1WJDA 1FSHA 3DPTA 1NG6A 1D0XA 1XD7A 2JVHA 5M3MJ 4C1GA 4MGRA 5GPCA 5KK1A 3HGYA 1J59A 4NQ4A 2WA0A 2K9NA 3JAMK 1MBJA 1MDMB 1WUPA 2A5WA 4DOZA 2CV1A 2FNAA 5C4XJ 2VOPA 3S3OA 1RNLA 4DYQA 4V2GA 4AD9A 2HXOA 2QZ8A 4ZZLA 4E7JA 2JSPA 3BJAA 2L7FP 2PMUA 1KONA 3MVPA 2Z33A 1XGMA 1QPIA 1OLTA 5AXRA 1QNTA 1ZLKA 1R4NB 2JA7J 2EV5A 4EV0A 3BR5A 4XKVA 1QZYA 4N4OB 3RZOJ 2BFZB 2JA6J 4RM5A 2EH3A 1ZR2A 3OYEA 5J47A 3PO3J 5ACTA 4AIHA 5AONA 4RLQA 1KYZA 2YHEA 1WWXA 1IZ1A 1YS6A 3HYIA 4G7HF 3S8PA 2NS0A 3AG4H 4MIMA 1GVJA 4PVOA 3GTLJ 4M6VA 5D6EA 1MZBA 1U5TA 1R7JA 2Q2EA 1YYVA 2L3DA 5J8CA 3J81K 1JT0A 1U0JA 4RGRA 1YJWI 1H89C 5AJLA 2XASA 3K4BA 2BW3A 5J1YA 1OR7A 2P6SA 2VJ5A 2DPDA 2FX0A 3T1BA 3GFIA 4G6QA 2DN0A 3HPHA 2KJCA 5E3NA 3F8FA 3PQKA 1Y0NA 4Z6XA 4HF2A 3R0JA 3G1PA 4RB2C 3OWTA 1H0MA 2QWWA 3IC7A 2QSGX 5GPAA 3K4NA 4XM3A 2I7TA 4RGXA 1FOXA 2HQ5A 4IOAF 4MFEA 2MD5A 1D5YA 4X1EA 1T38A 2COBA 4E7KA 2HKOA 1BOBA 2Z99A 5AIQA 1WJAA 4JP0A 1BJZA 1B4AA 5F6FA 2HVSA 4AWZA 3HOZJ 2LSOA 3IAM2 5CVVA 2YZ3A 2VQCA 2L01A 3E5UA 4HYEA 3MZYA 4UBQA 4BE2A 3HHHA 3MKYB 3BG6A 4A3CJ 1NH3A 4BBSJ 3V8LA 3E5XA 1JJTA 5EHTA 4R1HA 5HLHA 2FU8A 5LM6A 3MD7A 4G7ZF 3WU2C 2IVMA 2ZO4A 2D1VA 3RKWA 1M2XA 3OSFA 2K3PA 3LSTA 2LKPA 3HKZN 4D1QA 4A3KJ 2R7UA 2EFPA 3BQYA 3A01B 2QKMB 4G6TB 1MH3A 1T56A 4RA2A 1O3TA 4M73A 2E1NA 1AA7A 3HIFA 3ISPA 3O8HA 1KYWA 1SAXA 4IEJA 1ZREA 1I39A 2XF4A 3EYIA 3H92A 5HIPA 2IAIA 4HX4A 2A6TA 2Y69H 3TO9A 3R6SA 3O6BB 1T2KA 4HL1A 1BW6A 3G2BA 4IL6C 4YFXF 4CCKA 4MHGA 4EGYA 3ZQCA 1GLNA 2ZSIB 4NNJA 1AKHA 1IXRC 3PNYA 2RDPA 3C7JA 3VPEA 2FMLA 3RJPA 5FLVA 3BV6A 3GW2A 4AYBN 4MEYF 1SFOJ 3BPXA 2W82A 3K1MA 5HS9A 4L0ZB 3K7AJ 2Y0MA 4QPOA 4N0BA 2VC1A 4RL2A 1DD6A 3J80K 3K4JA 3SFPA 2XC7A 3SXYA 3HZJA 5LFAA 3SDBA 2FA5A 4N4NB 3SJMA 4II3A 4EJVA 4F91B 3LWFA 2AS5F 3CCQI 2CG3A 2A05A 2DOAA 2ACJA 1KQ8A 1NK2P 4K2EA 1S72I 2JT1A 2KZGA 3HOWJ 2R4GA 3WGHA 2OQRA 2YS9A 4TZ9A 1D8KA 3IP4B 4O3MA 2HNHA 4HLXA 1K4TA 5EG0B 2ZFUA 3IL2A 1ORKA 2D45A 1IAWA 4A3DJ 3C2GA 2M8EA 3I3LA 5IYDJ 3FKJA 4M71A 2VBYA 2B9SA 3LL7A 3NRVA 3S2DJ 3TW6A 4UWOB 3RIRA 1ZGJA 4HV5A 2IW5A 4BE0A 5J1RA 4DYCA 2OHHA 3IEMA 1U9OA 1OR7C 4HOBA 3CCEI 2CV2A 2VUMJ 4NQ2A 3WE3A 2ELKA 2DMNA 3HOUJ 2IEKA 5CJ9A 1VTNC 3T8RA 3KYLA 3BCBA 1GV2A 4P62A 5EF6A 2WADA 2XAUA 2NVTJ
chains in the Genus database with same CATH topology
1P2FA 4L9VA 1OYIA 5FFZA 3KFWX 5TRDA 5LEJA 1G3WA 5K4KA 4GYUA 3I11A 1G6NA 1LJ9A 3CTAA 1IN8A 4PCQA 5E20A 3WE2A 3FZVA 3KP3A 3T0YA 5CVJA 3EDPA 4CICA 3MZHA 3RYRA 4KUMA 5K5OA 1ONVA 2RV8A 5ILSA 4A5NA 5EVBA 4EYBA 1K78A 2RKHA 3QU6A 1QBJA 4M6YA 4ZO3A 4LLNA 2CSOA 3ZPLA 4EM1A 3M1EA 1LNWA 5ED4A 3KLOA 1BOAA 4JQFA 3SHFA 4FX0A 1Q1HA 4N9HA 5HLGA 1QPMA 4CZZA 1J5YA 5ICGA 1K79A 3ZN0A 2XAFA 1WRJA 4U0VA 4L18B 4HDUA 5DD8A 1O3RA 3H3EA 2EA2A 3TKYA 2WTEA 4ZYEA 4EJUA 4EGZA 1XCVA 1PP8F 3HHGA 3GO5A 5HS7A 3KP6A 3F6VA 3PQJA 3FF5A 1A7TA 5HIQA 3P9CA 3ZWFA 2DQRA 4G8XA 2E7XA 4AWYB 2R7FA 3BP8A 2QBYA 4KT5C 2V6CA 4NQ5A 4KEPA 2FQ3A 3T9MA 2K02A 2F5FA 2Z5UA 1FP1D 1OPCA 5D4RA 2G7UA 5FQBA 3E5QA 4YSBA 1USSA 1W5TA 3V8JA 3L9FA 4KN4X 5CVUA 3GZ6A 4HW0A 3ADRA 2L4MA 2DPUA 4F6ZA 5A0VA 3BY6A 1JT1A 2V9VA 2HDCA 5AYAA 3IE2A 3I0TA 5IT3A 2Z3YA 5EVDA 5DUIA 3AF6A 3JSPA 1YS7A 5E1ZB 5AXOA 2XROA 2DLLA 1DDNA 3IELA 5FO5A 2EFNA 4AX1B 2M1BA 5LEKA 2WC2A 1R5GA 4RAWA 4AX0B 2K4BA 2YNVA 4N9IA 3GEZA 2NAZA 4Z67A 2VE8A 5HDNA 2GCUA 2F5EA 2IA1A 4EVIA 2OHIA 4EJOA 3WODF 1EH8A 4WK8F 3TP9A 1KU2A 2TDXA 4BAYA 1UCRA 2P8TA 4UXNA 3WTXC 5ILUA 1TTYA 2HTSA 3HRUA 4EXSA 4L9TA 2FMYA 3TDUC 2RC4A 1Z6RA 4HLYA 5HVQC 3RKKA 1QZZA 3CJNA 4HF1A 1MQOA 2QDSA 5ACVA 3F8NA 3CO7C 1HBXG 5L3GA 1R22A 2MLKA 1KU7A 4BXUA 3F3XA 3BZ6A 4XSZF 1EH6A 5LRSA 1XM8A 3S0ZA 1TBXA 2FU9A 2Q8KA 1K07A 2NZFA 2X0LA 3TO7A 1LQ1A 4LD5A 1F5TA 1HW1A 3IWZA 3EYYA 5HH6A 1O7FA 1W7PA 2G7HA 5JI6A 2GAUA 3QP6A 3U1DA 2Y87A 2DT5A 2P7VB 4FEKA 5EV6A 1H9GA 2BG8B 4FR7A 4GCWA 2XAQA 1ZGAA 3GXOA 3RPCA 5LS3A 4CHUA 1HSJA 2EV6A 2QENA 4F7ZA 3ZMDA 4CYDA 3HSRA 3NQOA 1LVAA 1TQIA 2K27A 2WV0A 2I7XA 3BC2A 2IJLA 3MFKA 3EETA 1P92A 2P5KA 2PI0A 2J5OA 2VOOA 1BC2A 2DOOA 5LLDA 2ZCWA 4OMYA 4UVBA 3JW4A 3ZMSA 3R0AA 2AIOA 2YNUA 1KQ9A 1JE8A 2VBWA 1OYYA 1VJNA 2YU3A 3N4MA 4UA4A 3QOPA 5EH9A 4KIGA 5ERIA 4FX4A 3V4GA 3GUDA 5LHIA 5EEGA 5LRRA 2HS5A 1LEBA 1YLFA 1BIAA 4XWTA 5HDKA 5LGTA 5AHRA 3I53A 1HQCA 5B3RA 2DK5A 2WYMC 1STZA 5HS8A 4ZYDA 1CGPA 5K1YA 1G4DA 1O3QA 3L09A 3IKVA 3L2CA 3WTYC 2ZWRA 4ESBA 1DUXC 5ICCA 5ICFA 2GQQA 3M9AA 1P9EA 4IHTA 3S2WA 3KNRA 3I59B 4B09A 2KIFA 3IWFA 2E1CA 3HSFA 5L3EA 2JRTA 4I01A 2Q0OA 4MNUA 2A7MA 1ZHFA 4XLPF 2HEOA 4OMZA 2BBYA 1WI9A 1F1ZA 2DK8A 3LAPA 2XV4S 2FE3A 5F64A 5DEQA 1ODDA 2BGCA 4ZYHA 1Z7UA 2H6CA 3TOBA 3VB2A 1QO0D 4B8XA 3FCZA 3T5XA 1YCGA 2XIGA 2RN7A 3IKTA 2DBBA 3LA7A 4UAMA 3Q6VA 3FM5A 2FM6A 4MTDA 5JVTA 2BG6A 2LNBA 3FWEA 3HRTA 3WTWC 4A5MA 2QYOA 5A2QK 2P5LC 3K0LA 1MJAA 4GO1A 1XGOA 3SD9A 2PLYA 1WRAA 2VBXA 1XCBA 3HOTA 2BYVE 2A68F 1J0RA 2O3FA 4OIOF 2W57A 4YG2F 4A2UA 1S6LA 1WQ2A 2I7VA 4ENJA 4MEXF 2FEZA 4HA8A 3AF5A 1MJBA 2W85A 3M8FA 1XSXA 1OMIA 4ENKA 3BOQA 3NEUA 3I54A 4AVPA 5D5WB 4IJAA 2E7WA 3BPVA 3L00A 1R58A 2O6GE 4UVCA 2DQLA 2FHXA 3GFJA 2DTRA 4CO8A 3GFLA 5DD4A 2M87A 3HUGA 1T39A 1BI0A 3FHZA 4ENMA 3IDZA 2VE9A 2DU9A 1ZLJA 3I71A 5FLXK 1FX7A 5D5VB 3M7GA 1Z1DA 1ZRFA 2YCBA 1RZ4A 2EA4A 3F8MA 3ML6A 1V4RA 4GYIA 3ZR9A 2G9WA 4Z60A 2MH9A 4HX8A 3JXPA 2HQRA 4YIIA 2ZFWA 3EQLF 1BI3A 5LMCA 2NYPA 3WG9A 1B59A 3IOFA 1BMCA 5D8KB 5HDGA 2WRSA 4LLGF 4NQWA 3WXCA 1X8HA 3I5UA 4A6EA 4L5IA 2VW8A 3K2ZA 2AZ4A 1WKMA 3HRSA 4EJTA 2PFBA 4G94A 4EY2A 1CF7B 2FOKA 1B9NA 5TJJA 2NRAC 2H6BA 2L4AA 2KRFA 1KQ0A 1V3FA 4TV7A 1FP2A 1G3YA 1WW1A 2WWYA 4OIRF 5B1UA 2M5CA 4D02A 3FXRA 4I98B 3SQNA 2DKFA 4RB1A 2RGVA 4L5JA 5IQKA 4RAYA 4OOIA 1DDKA 3IE1A 3BWGA 3ERED 3MEXA 2H09A 4RGSA 3RI4A 1E17A 1VMEA 2ZNBA 5D6FA 3J80Z 4QLCU 1YO5C 1C0WA 4AWXB 4ESFA 5BS6A 1ZG3A 3DH8A 2PBIA 3GVAA 2XKOA 3IRQA 1U5TB 5FGMA 2YPRA 3I15A 2HTJA 5ILVA 3Q9VA 1I1SA 4KMFA 4Z7RA 5AIPA 4EQQA 2BFZA 3ULQB 4Q5SF 3MCZA 3TGNA 2XHKA 1W4MA 3FMSA 2CW0F 2D1HA 3CUQB 2WYLA 1SD6A 2ZKZA 3T3NA 2DFIA 3KL7A 1ZN2A 4PGHA 2LF7A 5DUKA 4KA4A 5LCAA 2GKLA 3WTZA 1JJEA 3WGGA 4IRIA 4CHLA 2JZYA 4G6DA 1XGSA 1FBSA 3TO6A 2W24A 2BG2A 4BZ3A 3KE2A 5FFXA 2BFKA 5BQTA 1ZYRF 4GGGA 3FAIA 3P2UA 4YSLA 2QQBA 2RVCA 3I4PA 3BDDA 1PDNC 1FZPB 1USTA 2VXZA 1IN7A 4HV6A 5E8GA 4I02A 2VODA 4P96A 4PGGA 4IRHA 1Y0UA 4IPAA 1R36A 4TYTA 4TZFA 4EXYA 5K5QA 1B9MA 2JPCA 3HTSB 3U9GA 1K6OA 1HKSA 1YIOA 4BNCA 2JPBA 4H0DA 4TZBA 5EW0A 2EB7A 5H20A 5J6XA 3HSEA 4A0YA 1MDMA 1FSEA 3H3ZA 3T3OA 3PY5A 2O8XA 1K78B 1BJAA 1JHFA 1ZRDA 2FNPA 1QGPA 2DI3A 3GF2A 1XSDA 4J5HA 2LF8A 2Y8AA 3I14A 2ZJ2A 3JTHA 4HDVA 4BQAA 2BIBA 4EYFA 3E3VA 2FBIA 3WTTC 1DXKA 1DPRA 2UXNA 3P9IA 2QJSA 1LDJA 3WU0A 3D5LA 3JAMZ 4D1UA 2FHXB 3BK2A 1OYWA 4NHJA 3ZQ4A 2IA0A 2Q0IA 5JFRA 3DXJF 2WYMA 2NZEA 3J81Z 4PZJA 2OBPA 1S8NA 1BVTA 4LK1F 5ACPA 1J7KA 2YX7A 2GXBA 1YFHA 2ESHA 1FY7A 2ESNA 3X2ZA 2Y48A 1X3UA 4CXFA 3JSOA 2FBKA 1ZRCA 4RGUA 2EFWA 2PN6A 3C18A 2P4WA 1LB2A 3ECOA 4EM2A 5J8FA 1ZG5A 1B1BA 3ELKA 1F4KA 3R61A 4WX9A 5LE1A 4I0AA 4ZZDA 2HFHA 4IHSA 4D1WA 1TNTA 1ULYA 5K5RA 2VN2A 4XSXF 4M9SA 3V7SA 2A6HF 2OQGA 2GIVA 3SBLA 4KIBA 3F23A 5L3CA 2V79A 3FXQA 2F5DA 4U4LA 2QEDA 1VGNA 2VONA 5E1XA 5EV8A 5JHUA 2FK6A 5H6QA 2CBNA 2O61A 3KLNA 1IXSB 4IVNA 5ACUA 4MQVA 3K1NA 1JXSA 4UV8A 2M45A 2ZBKA 3R60A 1UHWA 2XVCA 4OU0A 3QH8A 4C1HA 1SFUA 4KYWA 4U7DA 2CFXA 2MH2A 1FNNA 1S29A 4Y17A 2ZNZA 5IT9Z 1BN5A 2R2DA 2Z9OA 3V7CA 3IHUA 4PVTA 2HKXA 3DKWA 3RKXA 4LB6B 1Z9CA 2OD5A 3FX3A 1U8RA 1G3SA 3W6JB 2D2WA 2ZZIA 4Y13A 3DFGA 4YIFA 2GA2A 1FBQA 1IN5A 4EJWA 3P7NA 4O5VA 1KGSA 1SFEA 4EM0B 2DAOA 4R79A 1B6AA 1RI7A 3ZN1A 4Z2YA 5CLSA 4LB5A 2BFLA 3TOAA 1IRFA 4ZO2A 1TW3A 1SFXA 5LGNA 5HIOA 2XGXA 2JTVA 3R2UA 3MWMA 3RKJA 3ECHA 3W6KB 1MJ9A 2RQPA 1ZNBA 1KR3A 2CQKA 3KEQA 2K7LA 5HLIA 4P9UA 5LHHA 2M5DA 2GA1A 2P4ZA 2UZKA 2O03A 3VEPA 4YFKF 1W7PB 1YCHA 3FMRA 3HOSA 4Z5ZA 3JTGA 2Q42A 2QM3A 2BV6A 5DV5A 4D0PA 2GFKA 2B0LA 2FBHA 4ETSA 3F8CA 1QH3A 1R5HA 2XAJA 1MKMA 1YCFA 5LCFA 5HH4A 2XAHA 3EUHA 3T8TA 4R8HA 4HX7A 3SRXA 1E5DA 2A07F 1FYMA 1W5SA 3WTUC 5F1RA 1ZARA 3REOA 4I0BA 3L6NA 4M6XA 2PG4A 4UWRB 4HF0A 4O98A 5HOOA 4M72A 2BG7A 2DW4A 4KFCA 3FMQA 2MC3A 3KZYA 3G3ZA 2V1UA 1XDSA 4I7HA 1I5ZA 3F22A 3VQZA 2L02A 3LA3A 3RYPA 5AEBA 2MLGA 3TDZC 2FU6A 3DHBA 5LHGA 2NNNA 1D3YA 1U3EM 1FPQA 3KCCA 3GWZA 5BPIA 3GX4X 4CGZA 2CGPA 2A3SA 5CVRA 3KEOA 4HAMA 3RPUA 2H6AA 1XDUA 2IP2A 1IN4A 3I58A 5CYVA 2MBFA 4XWWA 4FSBA 4KICA 3E6DA 4Z5YA 3K69A 1AOYA 3KP2A 4C1FA 2P6TA 2QLZA 5EWAA 1IUYA 2OHJA 1YG2A 1GXQA 4GXOA 1TQMA 5E1WA 3RDIA 3ZMUA 2NXAA 2KIMA 3KP7A 3SFZA 2QBYB 2COMA 1YW9A 4OIQF 1LEAA 2NYXA 4LGWA 4GYGA 3I13A 3O3KA 1MD0A 2PJPA 5AHOA 4C1CA 1DPUA 1Z6TA 5IT9K 3ZMVA 1XN7A 1LDKB 1U2WA 4A12A 4OINF 1FYKA 3I64A 3GFMA 1L3LA 1D8JA 3PY6A 4U7BA 4I2OA 2Q0JA 1TLHB 2LDUA 3FM3A 5KIKA 4KEQA 2R7DA 3OV8A 4DIKA 1U5TC 1XSVA 2GFJA 5DCMA 4WWCA 2BR6A 5LCHA 5BMZA 2R3SA 5EVKA 3ABUA 4ON0A 1WUOA 4NQ6A 4WXDA 3CUQC 1S3JA 1YTYA 5L3BA 1QH5A 3IEKA 4FHTA 2UXXA 4KMUX 4E70A 1ZG1A 4XRFA 5ACWA 1GXPA 3WGIA 1BC7C 1IN6A 5DCMB 4RB3C 3FXUA 2IA2A 4ZH4F 1TNSA 2H27A 3CO6C 4JBAA 1Z91A 2EJRA 2OA4A 2UYXA 2FXAA 4WXHA 3RPQA 2STWA 4LK0F 2QVOA 4HL2A 4B87A 1RUNA 2PQ8A 4J5FA 3F21A 3DV8A 4ZEJA 1P4WA 2V1DA 3RKYA 4MTEA 3DEUA 2STTA 1QQIA 4Q4ZF 4AIJA 3B73A 2H94A 1R1TA 1SD4A 5DYMA 3R4KA 3WTVC 2HR3A 4C1DA 4F6HA 3X30A 4GYQA 3DF8A 1IW7F 1O3SA 1BBYA 2DO7A 5ACSA 2W84A 1DP7P 4WD6A 4LG0A 1EH7A 2BEOA 2F5CA 1YW8A 2HYFA 1X8GA 1SD7A 4PDKA 3ZNBA 5BPDA 2GWRA 3QPHA 3G73A 4UNOA 2EV0A 4XUKA 3U2RA 3PFIA 2IPQX 2C6YA 2Y8BA 2PMHA 1I1GA 1BI1A 3GLXA 1L0OC 3C3WA 4KN7X 1ZTCA 4O6JA 2BC2A 4V0HA 5B15A 4A6DA 4C09A 1KO2A 1E2XA 3E6CC 2KKOA 1XTOA 5D5XB 2BGAA 1YW7A 1S7OA 3RTRA 3Q9SA 1SD5A 2AXLA 1U78A 1SMLA 4LLLA 1ZAOA 4IF4A 3CUQA 4IXAA 1HW2A 2A5YB 1KU3A 1GHCA 4KNYA 4NB5A 3BROA 5KILA 4HBLA 3K1PA 1A04A 4AIKA 4S05A 1FOKA 1IF1A 4EMSA 4UHTA 2J5PA 5A0TA 3LFKA 1REPC