4AD9A

Crystal structure of human lactb2.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
288
structure length
288
Chain Sequence
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE-LIKE PROTEIN 2
total genus 86
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF17778 BLACT_WH Beta-lactamase associated winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ad9A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4ad9A01
1QPMA 3BK2A 5ACPA 1JE8A 3BC2A 1BI1A 4XLNF 3F21A 4P5OA 3FHZA 3HHGA 3KFWX 3KL7A 2QYOA 4M72A 3JTHA 3REOA 4MGRA 3F72A 3PY5A 4P96A 5KK1A 5DD8A 1WKMA 2WYMA 1XGSA 2VW8A 4UAMA 4DQ2A 2V6CA 3HSFA 4LGWA 1C0WA 4KN7X 4A2UA 1WQ2A 4R8HA 4Q4ZF 3RPCA 4D1TA 3V8LA 1MQOA 2WC2A 5CLSA 4KFCA 2QDTA 2L02A 2MH2A 3R60A 3R4KA 3KEQA 4ZYEA 5FFZA 1DDNA 3P2UA 4M6YA 4ZH4F 2OQGA 2EFOA 4EYBA 3QU3A 3L6NA 2K4BA 3U2RA 3AF5A 4C09A 1X3UA 3CUQC 4TZEA 1XSXA 4KEQA 4IHSA 3F23A 4MTEA 5KVRA 1ZG1A 3DFGA 2OBPA 2UYXA 2OHJA 3P9CA 2O03A 2NZEA 1H9GA 2QM3A 3KEOA 1REPC 2GFKA 4YSKA 5AYAA 1R1VA 4BHCA 5D5VB 3KCCA 4BYYA 1BOAA 4IJAA 4NQWA 4MQ9F 5FQCA 3WTWC 2IA1A 4NQ4A 3X2XA 1IF1A 2HWVA 3F8NA 4ENNA 4RB1A 3S0ZA 4IXAA 1QH5A 1FYKA 4U0VA 4ZZLA 2HGCA 3E6DA 4AWZA 3T5XA 4Z2YA 4CICA 5DV5A 3AF6A 4L5JA 4G7OF 2NZFA 1ZRDA 2FHXB 5D5XB 2ZNYA 3FMQA 4PCQA 4C1EA 3IKVA 2LSOA 3KP7A 3VB2A 2QVOA 3K0LA 2VT2A 3BK1A 1FYMA 3FXUA 1SFEA 3LWFA 1TQIA 2BFZA 2UXXA 2YSRA 1P2FA 3E5UA 4RGXA 4XSXF 3WU1B 2W25A 1MKMA 2GKLA 2C6YA 2DFIA 4PGHA 4GXOA 6PAXA 2Q0OA 2Y87A 3RI4A 2EA4A 3T8TA 3V7CA 2BG2A 3K1PA 1FBUA 5LHGA 3I15A 3EDPA 3E5XA 5E8IA 1LDKB 2EWNA 2F5EA 3KP2A 1HKTA 2OAZA 4RS8A 2VBYA 5EV8A 2RDPA 1BN5A 1FY7A 1ZAOA 1B4AA 5HIQA 4U88A 2O6GE 5EV6A 1O57A 5A5ZA 2ETHA 4PZJA 1XSDA 2Z99A 1WUOA 4HLYA 2A6EF 5A2QK 5FO5A 4D02A 3EUHA 5AHRA 2FBKA 2D45A 4I01A 4RAYA 2FRHA 5L3EA 2M87A 3RKYA 5LCHA 4CO8A 1H0MA 2FMYA 5F64A 1YTYA 2IP2A 4D1VA 1QGPA 3FMRA 5HH5A 4KA4A 4DIKA 4O5VA 2PBIA 1KYWA 1SFXA 2VC1A 1XB4A 3FM3A 5ILSA 1DP7P 4EGYA 3T3NA 3NQOA 2VONA 5LRSA 4CYDA 1A8TA 1TW3A 4KIBA 2BFZB 2FNAA 1SD7A 1QO0D 4PGGA 1XTOA 3ZMVA 1D8KA 2O3FA 4Y13A 2LF7A 5DCFA 3JXPA 2H6AA 4LD5A 1FT9A 1P6RA 1S8NA 4FX4A 2QINA 4ZO2A 1K79A 3F3XA 1DUXC 3QPHA 3SZPA 3M9AA 4G6DA 4A5MA 2VOPA 5EVKA 3D0SA 3M8FA 1YCFA 2BEOA 4EJWA 3IEKA 1K7AA 3F8CA 3BJAA 5HVQC 2COMA 3L00A 5ICFA 3M8EA 1GVJA 3O3KA 2IA2A 2W84A 3LA2A 2ZNBA 3F22A 1ZN2A 3ZQ7A 3ZR9A 2Y8BA 2EV0A 1KU3A 1XGOA 5LHIA 2YNUA 2QZ8A 2DO7A 4KIGA 2R7FA 3H3UA 4C1FA 2YPRA 2GIVA 4DILA 1S6LA 2R3SA 1PP7U 3BY6A 3IOFA 1HLKA 2MBFA 1LDDA 3MFKA 4KN4X 1KU9A 5BQTA 4RBSA 3O6BB 4HL1A 1BI0A 4UNOA 2Z5UA 4GGGA 3WODF 2VE8A 3K1NA 3BZ6A 2JT1A 2K02A 1K07A 1UFMA 2NXAA 2LDUA 1KQ0A 2IJLA 2FU7A 3RKKA 5FGMA 1HW1A 4RAMA 3LQQA 5FD5A 4ZYGA 2QQ9A 3CDHA 3BWGA 1Q1HA 2DW4A 4FSBA 4RB3C 4Q48A 1W7PB 2GZWA 2Q8KA 1R1TA 3IE1A 3SQNA 1U2WA 4G6QA 1S29A 5E1WA 4UA4A 4MNUA 4P55A 2Z3YA 2Y48A 1LJ9A 4LB5A 5K5RA 3J80Z 5LLQA 3FAIA 1ZREA 1U5TB 2MH9A 3GVAA 2L4MA 3WE3A 4EVIA 4EM0B 2A69F 2ZCWA 2KJBA 1FC3A 4EYLA 1W5SA 3E97A 2VBZA 1OYIA 1TBXA 2RGVA 3IDZA 1SFUA 2DPUA 3DXJF 5AHOA 2FF4A 4I0BA 4ZO3A 3IE0A 1UHMA 2PMUA 3JSPA 3FWEA 3RYRA 2VBXA 3CO7C 4EJTA 4BXUA 4AIKA 4IRIA 5E8GA 4JK1X 2XKPA 1ZG3A 3KZYA 1ZYRF 1XSVA 3RIRA 1O7FA 4M6XA 2ELHA 3KP6A 3FXQA 1IN7A 2KIFA 2NYXA 2IRFG 1LVAA 1XD7A 1EH6A 3ECHA 3JSOA 3MZHA 4A6EA 2J5OA 4BNCA 2X0LA 3ZMUA 4R1HA 5E1XA 1X8HA 3RDIA 4HX8A 2VXZA 3ZQ4A 3HSEA 1SMTA 4WCGA 2BG8B 4OINF 2OA4A 4UV8A 3WTTC 3C1DA 4EJOA 2PLYA 1WW1A 2OHIA 1MD0A 2Q9UA 4UWSB 5ERIA 1HKQA 3HSRA 5ACRA 3RYPA 3MEXA 2FK6A 4OMZA 1BIBA 2Q0JA 4HF1A 2IA0A 2DKFA 3JW4A 3TKYA 5EHTA 5A0VA 2BBYA 4Q47A 3GFLA 2CBNA 5E1ZB 4IRHA 2Q42A 3SRXA 2LF8A 2GA1A 1KO2A 5D6FA 1S7OA 4HQEA 2XGXA 1WUPA 3J81K 5HDNA 2HR3A 1P4XA 5K5QA 2MA3A 1K78B 5ACWA 1ZNBA 1NHAA 3ROUA 3IOGA 4L9VA 3P9KA 1IZ1A 2HOEA 3K69A 1IAWA 5AEBA 2IW5A 4HL2A 4F7ZA 1HW2A 4N9HA 2FU8A 1A04A 4QWQA 5LEJA 2J5PA 4G7HF 4NQ6A 4LK1F 3P9IA 1L0OC 2DBBA 5E17F 1U5TC 5D6EA 1A7TA 2P1EA 3I0VA 2Y0MA 3R6SA 1YS6A 2QJSA 4U4LA 4LMYA 2XAJA 3X30A 3KZZA 3IC7A 5L3FA 4DNCA 4M9ZA 4KDPA 2MLKA 2CWEA 3T8RA 2O61A 2E7WA 3SW3A 2LNBA 1GXQA 2BYVE 1R22A 2G7HA 4EM2A 4U7DA 2NAZA 3GX4X 2XKOA 3BPXA 1FSHA 5JI6A 4Z5YA 5ACTA 1I5ZA 1TLHB 1U78A 5LCAA 4UV9A 3TDUC 4IRGA 2TDXA 4LE6A 2A5YB 3I59B 5LGTA 1Z9CA 1R00A 3J81Z 4LG0A 1BMCA 4XSZF 2UWMA 2H27A 2HKOA 1LNWA 3O2PE 3MQ0A 3KLNA 2Y8AA 1K78A 5ACUA 2A7MA 1L3LA 5EH9A 2FEZA 2P8TA 2BTNA 3BROA 5ILVA 1BI3A 3WTYC 4UWPB 2ZKZA 1FZPB 3PFIA 2XAGA 4KEPA 5D4RA 3HYIA 5B3RA 4CZZA 5J8FA 4WX9A 5DUKA 2BIBA 1KR3A 2JSCA 1IN6A 2EK5A 3ZNBA 3ULQB 2ZFWA 3WU0A 3I71A 4S05A 4IHTA 4HF2A 3OOPA 4A12A 2YNVB 2RNJA 2IT0A 2CGPA 1OYWA 1IXRC 5DPXA 3I58A 4NHJA 3DQVC 2GXBA 5H6QA 3I11A 2Q2EA 3GFJA 1LEBA 1SD4A 3T1BA 4I02A 2HTSA 3RPQA 2KJCA 4FEKA 4KICA 3ZPLA 2GMNA 3L7WA 2HZTA 3X2YA 1ZRCA 1YCGA 5AIPA 1M2XA 1T2KA 4OIPF 4TZFA 1BJAA 3QAHA 1ZH5A 1KU2A 5HLGA 3L2CA 1R36A 3F8MA 5LGNA 2PEXA 2P97A 2NNYA 2AS5F 1D3YA 4YFNF 5FLXZ 1O3SA 3EETA 5LBQA 4YSLA 1MJ9A 2A07F 4Z7RA 2FU9A 3Q9VA 4M73A 2YNVA 4F6HA 2DK8A 5H20A 2AIOA 1Z1DA 1KQ9A 2JPBA 3N4MA 3SZTA 4U0WA 2QBYB 1D8JA 2FE3A 4TYTA 3KP5A 2FMLA 4CGZA 1X8GA 5AXRA 4AIHA 1UB9A 3HHHA 3KLOA 3RKXA 1Z91A 5HLIA 5LRRA 5FB2A 2STWA 3DPTA 3Q9SA 3F8FA 1J7KA 2QQBA 2WYMC 3VEPA 4HDVA 3HOTA 3SFZA 4HW0A 1FOKA 3H3ZA 1U8RA 1BIAA 5CVUA 3IRRA 2PMHA 3GFMA 3F6OA 3BPVA 1LB2A 3PY6A 2L01A 2D1VA 3GEZA 4HBLA 4FT8A 1TQMA 2OQRA 1G3WA 2ESHA 1P9EA 4AX1B 4BAYA 2BFLA 2HYGD 2FA5A 1O3QA 4EJVA 3WTSC 3M7GA 2BE5F 5BS6A 4A6DA 4RAWA 4J5HA 1W7PD 2V79A 4Y17A 2WV0A 4E70A 2ZO4A 4AWXB 3F8BA 2JTVA 3C7JA 1ZLKA 3V7RA 1HKSA 2STTA 4V0HA 2CW0F 3LQRA 2JRTA 3GXOA 2H6CA 2ADUA 5J8CA 5HLHA 4MTDA 3QRFF 1TW2A 1SD5A 4G8XA 5BPDA 3U1DA 3DHBA 2KIMA 3FMSA 5LLDA 3GLXA 1FPQA 4CHLA 5ACQA 2O0YA 3N97A 4ENMA 2DT5A 1IN4A 2FHXA 2ZBKA 2NS0A 4H0DA 5LCFA 3AAFA 2PG4A 1CGPA 5DCMA 4K2EA 3TOBA 3IWZA 3ZMSA 4MHGA 5B1UA 5HISA 1YG2A 3X2ZA 1W4MA 1HXDA 1XCBA 2M30A 2HFHA 3HIFA 2BMIA 5FQBA 4D0PA 1HSJA 4HX4A 1WSUA 5ACXA 1JHFA 3VPEA 5KILA 2V1UA 2DQLA 3W6JB 3R61A 4HDUA 1BC8C 3FXRA 3L9FA 4GO1A 4GYUA 4HF0A 2A3SA 3GO5A 4EXSA 2M8EA 4XBFA 1VJNA 4C1GA 4GCWA 2DU9A 3CLOA 4YFKF 2VODA 4EV0A 1HQCA 1E5DA 4G9YA 2FBHA 2QDSA 2V1DA 2KRFA 5LM6A 3GF2A 1VTNC 5L3CA 5HH4A 3DKWA 1RUOA 2FU4A 1USSA 3KE2A 4G94A 2YNTB 4RGSA 1FBQA 2YU3A 5LS3A 2QQAA 1STZA 4I98B 1J2XA 5EEHA 2B0LA 1W5TA 4QLCU 5LMCA 2M5CA 3I14A 3V8KA 4N9IA 3E6MA 1I1GA 1FP1D 1J5YA 1QZYA 3IWFA 4P9UA 2H6BA 5L3BA 3BJ6A 5FFXA 2ESNA 3CJNA 4LLGF 2HTJA 2RVCA 1O3TA 1G4DA 2XV4S 3LAJA 5ACVA 2E7YA 1G3TA 2XIGA 1EH8A 2HQNA 4LFUA 1T39A 2ZMEA 4A0ZA 1D5VA 4ASNA 3LA7A 3SBLA 4HV6A 4I0AA 3TO9A 1W7PA 3ZN0A 4ENJA 5AIQA 4XRFA 4RGUA 5TJJA 1X8IA 4TZ9A 2OHHA 1ZKPA 3BDDA 4TV7A 2YR2A 4LLNA 4PDKA 5CJ9A 2BR6A 3KP3A 5BOXA 2ZZIA 2QUFA 4YIFA 5KIKA 2EV6A 2HS5A 5EW0A 5E20A 4HYEA 3TO7A 4M9XA 1OPCA 1MDMB 4LB6B 2O8XA 2GA2A 1CF7A 3ZMTA 2XUBA 3AJ3A 1XCVA 2Q0IA 2CFXA 4D1WA 3EYIA 2AZ4A 2QEDA 2LKPA 3DF8A 3SD9A 2L4AA 5EVBA 3BJOA 1XDUA 3LA3A 5D5UB 1QNTA 1J59A 4GYQA 1ULYA 5LHHA 5HDGA 3RJPA 2EJRA 1SMYF 4BH9A 1ODDA 2BG6A 1I27A 4IF4A 3J7AO 3GZ6A 3IE2A 4A0XA 3ML6A 3FZVA 2P6TA 1BM9A 2RC4A 1HSTA 5J6XA 3U9GA 1YW9A 4HX7A 5HIOA 2PI0A 3HOSA 2NRAC 4KMUX 4MEXF 5TRDA 3WGIA 1OR7A 2A6HF 3BP8A 1WWXA 3LFKA 1YS7A 5K4MA 4CDGA 1F5TA 4IVNA 3WTZA 1LQ1A 2HDCA 3SPUA 2CSOA 3BOQA 3QOPA 1Z7UA 2MD5A 5HS9A 3MD7A 5ICCA 5CVIA 2VE9A 3H92A 2A61A 2HB9A 4Z6XA 2VC0A 5A0TA 1QBJA 1L9YA 3F9OA 4EM1A 2OZUA 1JJEA 4HKYA 5A2QZ 1ZHFA 3ESHA 3RKJA 3RTRA 4FR7A 4NQ5A 3ZP5A 1K6OA 5DD4A 1QQIA 3K1MA 1IXSB 2HKXA 1OYYA 1UCRA 1KGSA 1E2XA 3B73A 2L3DA 3IRQA 4YIIA 2DOOA 2OD5A 1EH7A 2EV5A 3MWMA 5FQAA 4BP0A 5JHUA 4LLLA 2L54A 4UVAA 4Q5SF 2W57A 4UBQA 2IPQX 3HRMA 1JJTA 1R1UA 4I2OA 2PN6A 4WD6A 4B87A 4GCVA 4OU0A 1QH3A 2VN2A 3S2WA 2DPDA 5H6RA 1B6AA 2K86A 3TDZC 5LSCA 4BHPA 2OU2A 1F1ZA 1RUNA 1QZZA 4L9JA 4ON0A 4PVTA 4ZZDA 3HRUA 5K1YA 2DK5A 4GYGA 3FX3A 2EFNA 4OMYA 1ZTCA 1ZG5A 5DYMA 3KNSA 4L5IA 4P62A 3ABUA 2F2EA 3A4YA 3QP6A 5CVRA 2I7XA 2WTEA 1LEAA 5FLXK 4MQVA 4KNYA 1JT1A 3P7NA 2I7VA 2OZ6A 3HRTA 2XASA 2EA2A 1KA8A 2P4ZA 3R0JA 4L9TA 3RPUA 2JPCA 2XAQA 5K5OA 3R2UA 5FD6A 2UZKA 2CO5A 4C1HA 1B9NA 1EV7A 1TTYA 1XDSA 2A68F 1XM8A 4CXFA 1P92A 1DD6A 4UVBA 4RL0A 2M1BA 2BGCA 5ED4A 2H09A 4HAMA 4UUVA 1FP2A 2FXAA 2ISYA 3F6VA 3I0TA 4WXCA 3JTGA 2YNWA 2CYYA 2WWYA 1BI2A 2PFBA 2G9WA 2ZXJA 3ZWFA 1B1BA 4XWTA 1H9TA 3CUQA 1FNNA 3DPLC 2NNNA 2FM6A 1T38A 2FBIA 2K4JA 4IPAA 1IW7F 1OMIA 3PQJA 5E18F 3FCZA 1ZGAA 4L0YB 3H3EA 2H94A 3TQNA 4EYFA 4KMFA 1I1SA 2I7TA 2Z33A 1ZGJA 2HQRA 3VQZA 2GAUA 2QWWA 3T0YA 1IUYA 5CVJA 4A5NA 4KYWA 5IQKA 4EJUA 1P4WA 1PP8F 4P9FA 5CVVA 1DPUA 4KUMA 1GXPA 4UHTA 4RB0A 1VMEA 1BC2A 2E1CA 4C1CA 2GQQA 1ZLJA 1SD6A 2P7VB 4XUKA 4WXDA 3HTSB 3C18A 1YYVA 2NYPA 3QPTA 3VOEA 3DHAA 4O6JA 3C3WA 4WXHA 3KNRA 1Z6TA 4Z60A 3WXCA 2XHKA 2K7LA 2VBWA 4EFZA 5DEQA 1S7AA 1U5TA 1G6NA 3IELA 2MC3A 1FBSA 3WTXC 4OIQF 3K2ZA 5LE1A 1XGMA 3WE2A 1G3YA 1HW5A 2FQ3A 1O3RA 2VOOA 5HS7A 4OIRF 2V9VA 3L09A 4L18B 5ICGA 2M45A 2GWRA 2GFJA 1IXCA 3FF5A 2P6SA 4RAZA 5L3DA 3V4GA 3ECOA 3GZ5A 5DCMB 5IT3A 1IRGA 4HLXA 2FOKA 2M5DA 5JR3A 3ADRA 4L9NA 2XR1A 1TNTA 3DEUA 2P5LC 3Q6VA 3QU6A 3CO6C 1G3SA 3KP4A 1LDJA 4O98A 2W24A 4NB5A 3IL2A 5EWAA 4ESFA 2YNTA 3IEMA 2GCUA 2XRNA 4U7BA 5HH6A 4WWCA 3MZYA 2M5WA 3G3ZA 4G7ZF 4M71A 1MJBA 4ZEJA 2YX4A 3CUQB 1FWZA 4B8XA 2F5FA 1WRJA 3DH8A 5DDGA 3SHFA 1RNLA 3FM5A 4N0BA 2E1NA 4CHUA 1YQAA 5ICEA 1WRAA 1MJAA 3E3VA 4XLPF 1IN8A 4AVPA 1USTA 1J75A 4PVOA 1U6GA 4YFXF 2KIUA 3WG9A 5L3GA 3ISPA 4I09A 2DAOA 2AXLA 2BG8A 5DUIA 5BMZA 3ERED 1SMLA 1WI9A 3E6BA 1YO5C 2D1HA 3K9TA 3LAPA 3MAJA 4ENKA 4A0YA 5K0WA 1ONVA 2FSWA 3DHCA 1PDNC 2BGAA 3CTAA 1JGSA 3JAMZ 5IT9Z 4ZYDA 3LVZA 1AOYA 5HIPA 2FU6A 3LSTA 1T6SA 4RM5A 4BQAA 1J9IA 1GHCA 3ZMZA 1FLIA 4TYFA 4OOIA 2RQPA 3TOAA 3HTUA 3GUDA 5D8LB 5ACSA 3T9MA 1JHHA 1CF7B 2P4WA 4KT5C 3VODA 4D1UA 1YLFA 4LK0F 2ZNZA 2YZ3A 4EGZA 2BC2A 2QLZA 2DQRA 1S3JA 5HS8A 5JVTA 1T98A 2HEOA 1KU7A 5D4SA 4KIFA 1XN7A 2G7UA 1YW8A 2XF4A 3COAC 1YFHA 3M1EA 2P5KA 3MCZA 2R2DA 4ESJA 4ZNBA 1V4RA 3B02A 5ILUA 3WGHA 2DTRA 1PUEE 1Y44A 4RGRA 1FYLA 2D2WA 4FX0A 3JAMK 1HBXG 5IT9K 3I13A 4M9SA 1FSEA 2F5CA 3G73A 1KYZA 1F9NA 2DI3A 4AD9A 1I6XA 4BHBA 1F4KA 3EYYA 4H0EA 2ACJA 2QENA 2XROA 4R79A 3IKTA 2XAFA 3I5UA 1O7LA 4RB2C 4S04A 2YCBA 2XAHA 3VFZA 1DDKA 1R5GA 1RZ4A 5D5WB 2P18A 5K4NA 2EFPA 1IN5A 1BBYA 2WYLA 3KETA 4XWWA 3J80K 1AWCA 1SAXA 4TZBA 3I54A 4AX0B 1YW7A 2HYFA 4U0YA 3SXYA 2WHGA 1ON1A 3WTVC 2E7XA 1Y0UA 4Z5ZA 3G1PA 2K27A 2RN7A 3I53A 2PJPA 4LJZF 1UHWA 1TNSA 1B59A 5CYVA 4BZ3A 3E6CC 4O3MA 1JXSA 1DXKA 2V1XA 4HOBA 3HRSA 5EEGA 4HQMA 5EVDA 2GXGA 5LGUA 3GYHX 2F5DA 3OV8A 3E5QA 1R7JA 3ZN1A 2BFKA 1IRFA 3PG4A 3TO6A 5B15A 5A87A 3D5LA 3Q5FA 1P4AA 3PQKA 3HUGA 2EFWA 4GYIA 4ESBA 1OKRA 3GFIA 2RKHA 4HZFA 2VT3A 2WRSA 3NRVA 2BV6A 3BV6A 4UWOB 3T3OA 4MEYF 4B09A 2XVCA 1ZARA 2IVMA 4Y15A 1R58A 3V8JA 3TP9A 2ZMEB 4J5FA 1FX7A 3RKWA 2ZJ2A 1XGNA 5F6FA 4OIOF 2EFQA 1YIOA 2P7CB 4EQQA 4I7HA 4RL2A 1KO3A 2CG4A 3WGGA 5F1RA 4Z67A 4WF2A 1Z6RA 3DP7A 2EB7A 3W6KB 3I64A 2QBYA 4FHTA 4M74A 1XMKA 1KQ8A 4NQ2A 4UWRB 5JFRA 3I4PA 2KKOA 3V7SA 3I59A 5AXOA 1MDMA 3GWZA 3ABTA 1ON2A 1U3EM 2CQKA 2ISZA 4HV5A 5BPIA 2ZWRA 4ZYHA 4F6ZA 5AONA 5K4KA 2RV8A 4UXNA 3GW2A 1ZRFA 2BG7A 2P5VA 4EXYA 1RI7A 4UVCA 4WK8F 4ETSA 3R0AA 1MZBA 1R5HA 4JO0A 2MLGA 5HDKA 1B9MA 3QH8A 2YX7A 2Z9OA 4AIJA 2Y75A 1VGNA 1BC7C 2JZYA 1BVTA 2DLLA 5HOOA 3CUOA 4EY2A 4C1DA 1DPRA 3IHUA 1RIOH 1MGTA 1XMAA 3ZMDA 5LEKA 3ELKA 2R7DA 1E17A 1YCHA 2FNPA 1Z05A 5D8KB 3WTUC 3EQLF 4JQFA 3SFPA 4AWYB 3DV8A 3NEUA 3QP5A 1R23A 2X4HA 1J0RA 4YG2F 4YSBA 4HA8A 1V3FA 2PQ8A 4LG0B 4EMSA 1TQPA 2W85A 3TGNA 2UXNA 4L0ZB 4JBAA 1T0FA
chains in the Genus database with same CATH superfamily
1QPMA 2DMPA 2YUSA 3BK2A 5ACPA 1JE8A 2VJJA 3ZQFA 3BC2A 2CFOA 3DEEA 1BI1A 4XLNF 4F3QA 3IAS2 4P5OA 3F21A 1TC3C 3FHZA 3HHGA 3KFWX 4CSWA 3KL7A 2QYOA 5FROA 3IUOA 3K7AJ 4M72A 3JTHA 2KDZA 3REOA 4MGRA 1Y1WJ 3CCEI 3F72A 3PY5A 4P96A 2Y69H 5KK1A 4XOPA 3NAUA 5DD8A 1Z0XA 2CV0A 1WKMA 2WYMA 1GV5A 1XGSA 2VW8A 4UAMA 4DQ2A 2V6CA 3HSFA 1BR1A 4LGWA 4E7SA 1C0WA 4KN7X 2X51A 3WU2C 4A2UA 4CH7A 1WQ2A 4M3BA 4II3A 4R8HA 2EZHA 4Q4ZF 3RPCA 1Y56A 4D1TA 1LFPA 3V8LA 1MQOA 2WC2A 2IGKA 5CLSA 4KFCA 3GMEA 2QDTA 2L02A 2MH2A 3BG7A 1JUSA 3EUAA 4N4OB 3R60A 2OF7A 3KEQA 3R4KA 1IJWC 2JUGA 4ZYEA 3P5JA 4M6VA 4B47A 2IS2A 5FFZA 2FOWA 5KAFC 1DDNA 1PJRA 2LY2A 2DA4A 3P2UA 4M6YA 4CCJA 4ZH4F 2OQGA 2EFOA 4XRMA 4EYBA 3QU3A 3CCLI 4XKBA 3L6NA 2QA4I 1H8AC 2K4BA 3U2RA 3AF5A 4C09A 1X3UA 3CUQC 1WJEA 3VYRB 3QYBA 4TZEA 1XSXA 4KEQA 4IHVA 4IHSA 5J47A 3F23A 1JT6A 4CZCA 1D1BA 4DGWB 4MTEA 4IOCF 4B3AA 1HDPA 2R93J 5KVRA 3H5NA 1XG1A 1ZG1A 2M8GX 3DFGA 1W36D 1EJ9A 2OBPA 3TEDA 4GRIA 1IDZA 3K2AA 5A23A 2UYXA 2OHJA 3P9CA 2IEKA 2O03A 1YI2I 2NZEA 1H9GA 2K9SA 2QM3A 3KEOA 1REPC 2CU7A 2L2OA 2GFKA 2O7OA 1QRYA 4YSKA 2HVQA 1S72I 3PFYA 5AYAA 1R1VA 4BHCA 5D5VB 3KCCA 4BYYA 1BOAA 2MABA 3X2QH 4IJAA 3K6GA 4II2A 1BOBA 2A6TA 4NDLA 4NQWA 4PSXA 1OCZH 4MQ9F 1YRNB 3DTIA 3RQIA 5J40A 5FQCA 2RAEA 1LE8A 3WTWC 2IA1A 4HEA2 3CF5F 4NQ4A 3X2XA 1IF1A 3CDIA 2HWVA 3F8NA 3G2BA 3ASOH 2K9MA 2LREA 4RB1A 4ENNA 3S0ZA 3DLAA 4IXAA 3FIWA 2V4JC 1QH5A 3Q3SA 3OS2A 2FUG2 4U0VA 1FYKA 4D5CA 4ZZLA 2HGCA 3E6DA 4AWZA 3LMMA 3T5XA 4Z2YA 4CICA 5DV5A 3AF6A 4L5JA 1VQ8I 4G7OF 5E3OA 1XPXA 2NZFA 1ZRDA 1UMQA 4MFEA 2FHXB 5D5XB 1D1AA 1WVRA 2VLAA 2ZNYA 3FMQA 4XNFA 5FKLA 4PCQA 3GTJJ 3HXLA 4C1EA 3IKVA 2LSOA 3CF2A 3KP7A 3VB2A 2QVOA 3HKZN 3DU6A 3K0LA 3MD2A 2VT2A 1E3HA 4XONA 4JOMA 3BK1A 1TL8A 1FYMA 1RESA 3FXUA 5CQEA 1SFEA 2VB6A 3LWFA 1TQIA 1G8XA 2BFZA 2UXXA 2YSRA 4DW6A 1P2FA 3CJQB 3E5UA 3FISA 4RGXA 3MVPA 4XSXF 3WU1B 1W36C 4LG3A 1WH5A 1MIJA 2W25A 3K4NA 5LD2C 1MKMA 3QOEA 3E1SA 2GKLA 4B43A 2C6YA 2DFIA 4PGHA 4GXOA 6PAXA 2Q0OA 1R5ID 3RI4A 2Y87A 2EA4A 3NWTA 2QKLB 3T8TA 3V7CA 2BG2A 2XGCA 3K1PA 1FBUA 3HOZJ 5LHGA 3I15A 3D1NI 4F55A 4XICA 3EDPA 3S8PA 3OS0A 3E5XA 5E8IA 1LDKB 3AG3H 2EWNA 2F5EA 2KRCA 5GTHC 3WHCA 4BQNA 1ZELA 1VQ6I 3KP2A 1HKTA 2OAZA 1DGRM 4D5FA 5IP6A 4RS8A 2JA8J 2VBYA 5EV8A 2RDPA 1IRZA 2V9PA 2GXAA 1BN5A 4E6KG 1FY7A 5DM6F 5C3EJ 3OYLA 1ZAOA 1B4AA 2MD0A 1ZKGA 4FE7A 4N4NB 3TBIA 4U88A 5HIQA 1GDTA 2O6GE 4YRVA 5EV6A 1O57A 5A5ZA 3ZQQA 2ETHA 4PZJA 1TWCJ 2Z99A 1XSDA 1R71A 1WUOA 4HLYA 2A6EF 4XL9A 5A2QK 4BQOA 2R7UA 5FO5A 4D02A 2WADA 2LD5A 3EUHA 5AHRA 4BEHB 4X0GA 4XOTA 4ABZA 2FBKA 4LIUA 2D45A 4I01A 1ETKA 4RAYA 2FRHA 4KITB 5L3EA 2VPLA 2M87A 3RKYA 5LCHA 4CO8A 1H0MA 2FMYA 5F64A 1YTYA 2IP2A 4D1VA 1QGPA 3FMRA 2XF6A 5HH5A 3JR9A 4KA4A 4DIKA 1BR2A 4O5VA 1OLTA 2PBIA 1KYWA 4XKWA 5IP9J 1SFXA 2VC1A 1XB4A 3FM3A 5ILSA 1DP7P 4EGYA 3LSHA 5DTDA 3OS1A 3T3NA 3NQOA 2VONA 2Q2EB 5LRSA 1YRNA 4CYDA 1A8TA 1TW3A 2CRGA 3FHNA 4KIBA 2BFZB 1A6QA 2FNAA 2JVGA 1SD7A 3S1QJ 1ERDA 1QO0D 4UUSB 4PGGA 1XTOA 3ZMVA 5BNGA 5F08A 1D8KA 4E7IA 1P7JA 2O3FA 4Y13A 3D5RC 2LF7A 3OIPA 4OAYA 4A3EJ 5DCFA 5EZGA 3JXPA 2A05A 4LD5A 2H6AA 1FT9A 2ID6A 1P6RA 1S8NA 4FX4A 2QINA 3PIPF 2BOLA 4BQQA 1K79A 4ZO2A 3OL3A 3M8JA 3F3XA 1DUXC 3A02A 3FXJA 2CQNA 3QPHA 4MO7A 3VYSB 1QA6A 3SZPA 1A36A 2Y0SN 3M9AA 4D7NA 1G2HA 4G6DA 3VPRA 3DPUA 4A5MA 2BY0A 2VOPA 5EVKA 3D0SA 3I55I 5LFAA 1YJ9I 2VQCA 3M8FA 1YCFA 2BEOA 2WAFA 4EJWA 1H88C 3IEKA 1K7AA 3F8CA 3BJAA 5HVQC 3OYAA 2COMA 3B6CA 4AXHA 3BTLA 3L00A 3F9KA 2BZTA 4IHWA 5ICFA 3M8EA 4GDFA 1QU3A 1GVJA 3DWLE 3O3KA 2IA2A 2W84A 3LA2A 2ZNBA 3LSPA 3F22A 3S3OA 3PNTA 1T95A 5K7ZA 2L5QA 1ZN2A 3ZQ7A 2D5VA 1GVDA 3SEQA 3ZR9A 1OJLA 2Y8BA 2VUMJ 4F93B 2EV0A 1KU3A 1XGOA 2HNHA 5LHIA 2YNUA 2ZMEC 2PX9A 1W5CC 2QZ8A 2DO7A 3BG5A 4KIGA 4LIVA 1ZGWA 2R7FA 3ONQA 5E79C 3H3UA 5GPAA 1MBEA 3QQAA 4C1FA 2YPRA 2GM4A 2GIVA 4FETA 4DILA 4A3JJ 1S6LA 2MSYA 2R3SA 1IUFA 1X1PA 1PP7U 1K4TA 3BY6A 3IOFA 2LY9A 1VNDA 1HLKA 2CW8A 5HODA 2MBFA 4M3FA 4XM3A 1LDDA 3TP3A 5F0HA 3MFKA 1LE8B 2X48A 2IS4A 4KN4X 1KU9A 4PFPA 5BQTA 2CQQA 3CCMI 3O6BB 4RBSA 4HL1A 2H8RA 1BI0A 1Z21A 2Z5UA 4UNOA 2R7WA 4GGGA 3WODF 2VE8A 3K1NA 4J19A 1ETYA 3BZ6A 2JT1A 2K02A 1K07A 1UFMA 2NXAA 2LDUA 2CUFA 3LNQA 1KQ0A 2IJLA 1DP3A 2FU7A 3RPUD 3RKKA 4Y52J 2JUCA 5FGMA 1HW1A 2KPMA 3E7LA 3ZQGA 3DEWA 5CKTA 1HA8A 4PDXA 4RAMA 3LQQA 5FD5A 4ZYGA 2QQ9A 3MKZA 1N25A 4DYRA 2YHEA 3CDHA 3BWGA 1DU6A 2HDDA 1Q1HA 4A93J 4A69C 2DW4A 4FSBA 3NWSA 4Q48A 4RB3C 1W7PB 3ZR8X 2GZWA 1R49A 2Q8KA 1R1TA 2K9NA 1AKHA 3IE1A 3SQNA 3AFHA 1U2WA 4G6QA 1S29A 4IEJA 5E1WA 3G6EI 4UA4A 4MNUA 4P55A 4BJTA 2VJIA 2Y48A 2Z3YA 3NARA 1WH7A 1LJ9A 1V55H 4LB5A 1MNDA 5K5RA 2NOGA 2F4MB 3J80Z 1R6RA 5LLQA 3FAIA 1ZREA 1U5TB 2MH9A 1RR8C 3GVAA 2L4MA 3WE3A 4EVIA 4EM0B 2A69F 2ZCWA 4EATA 2KJBA 3ZQCA 4Y4RA 1FC3A 4EYLA 1MSEC 1W5SA 3E97A 2VBZA 1OYIA 1TBXA 2RGVA 2LYCA 2LTPA 3IDZA 1SFUA 4DBQA 4BE0A 2KP6A 2X6OA 4PUSA 1XS9A 2DPUA 3DXJF 3L2UA 2FF4A 5AHOA 4I0BA 4ZO3A 3IE0A 1UHMA 2PMUA 3JSPA 3FWEA 3RYRA 4BU2A 3AL0B 2VBXA 3OYNA 3CO7C 2QSHX 2JK3A 3PUBA 3A4CA 3C2BA 4BXUA 4EJTA 1WZ2A 3JRBA 4AIKA 3S1RJ 4IRIA 2RREA 5E8GA 4JK1X 2W48A 2XKPA 1LFBA 1ZG3A 3BR6A 3KZYA 1ZYRF 1XSVA 3RIRA 3BLYA 1O7FA 3SJMA 4M6XA 1ZQ3P 2ELHA 3KP6A 2JA6J 2L9NA 3FXQA 1IN7A 1FJLA 2KIFA 1MH3A 2JWTA 2NYXA 1BL0A 2IRFG 3PO3J 1LVAA 4DJAA 4DOZA 1XD7A 2PJRA 3HKZA 3JRDA 2WBMA 1FTTA 1EH6A 3ECHA 3JSOA 1HCRA 3MZHA 4A6EA 2J5OA 2NVXJ 4BKXA 2DOEA 2WAQA 4BNCA 2X0LA 1YHQI 3ZMUA 4R1HA 5E1XA 4XN3A 3H0DA 1X8HA 4RM2A 3RDIA 2DT7B 2XF7A 3K4KA 2VXZA 4HX8A 3JRIA 4BBRJ 3ZQ4A 3JCUC 3HSEA 2AO9A 1SMTA 4WCGA 1D0ZA 2NS8A 2BG8B 2K3PA 4Y3OA 4OINF 2O9LA 2OA4A 4UV8A 3WTTC 4F92B 3C1DA 3OOUA 4EJOA 2R7ZJ 3TW6A 2PLYA 1WW1A 2BXZA 2OHIA 1MD0A 2Q9UA 4UWSB 5B66C 4E7JA 5ERIA 1HKQA 3BZCA 2XSDC 3HSRA 4MIMA 5ACRA 1RPWA 3RYPA 3BCAA 3MEXA 2FK6A 2LBFA 4OMZA 1BIBA 3OYIA 2ZJRF 2Q0JA 4HF1A 3K70C 2IA0A 2DKFA 3JW4A 3TKYA 4V2GA 5EHTA 5A0VA 2BBYA 4Q47A 2N8GA 1FOYA 3GFLA 1HC8A 2CBNA 5E1ZB 2GBYA 5K7HA 4IRHA 2Q42A 1JT0A 3SRXA 1E3OC 4C3IJ 2LF8A 4RAFA 3M1CA 3K4JA 3BR0A 2GA1A 1KO2A 5B3SH 5D6FA 1S7OA 3LL7A 4HQEA 1MNMC 2XGXA 1WUPA 3J81K 5HDNA 1SEUA 4JP0A 2PMZN 1HDDC 3K4CA 2HR3A 3KPHA 2P81A 1P4XA 5K5QA 2MA3A 4NC8A 1K78B 5ACWA 1A5JA 1ZNBA 1NHAA 1X19A 3BQZA 4QPQA 3K70D 3ROUA 1HOMA 3IOGA 4L9VA 5J4VA 3P9KA 2M4KA 1NH3A 1IZ1A 2JA5J 2VQLA 2HOEA 3K69A 2IAIA 1IAWA 1ZR4A 1U9NA 5AEBA 2IW5A 4XN0A 4F52A 4HL2A 1KONA 4C9YA 4F7ZA 1HW2A 4N9HA 1PUFA 2FU8A 1A04A 1I3QJ 3BG3A 5GAHJ 2K9LA 4QWQA 5LEJA 2J5PA 2M3AA 3JREA 4G7HF 3EUHC 4NQ6A 4LK1F 3P9IA 1L0OC 4BJ5C 2DBBA 4HPQA 1U5TC 5D6EA 5HNFA 5E17F 1A7TA 1IV8A 3I4NJ 2P1EA 3FBIB 2WAEA 2Y0MA 1YITI 3I0VA 3R6SA 4H4KC 1UG2A 4HSTA 1YS6A 2QJSA 3DCFA 4E4HA 5KAIC 2JSPA 4U4LA 4LMYA 1VQ4I 2XAJA 3X30A 3ABKH 3KZZA 4ZYAA 1EA3A 2QSFX 1UG0A 2HI3A 3IC7A 3VYTB 5GTIC 4DNCA 5L3FA 4M9ZA 1RR7A 5EG0B 2X1CA 1TT0A 4KDPA 2MLKA 4HSRA 1MNEA 2CWEA 3T8RA 2LMDA 2O61A 2E7WA 2KDOA 3SW3A 2LNBA 1ETOA 1GXQA 3C2HA 3TL4X 5GADJ 2BYVE 1R22A 3S2HJ 2G7HA 2AQEA 4EM2A 3DTKA 2NAZA 5F1JA 4U7DA 3OWTA 3GX4X 2XKOA 3BPXA 1FSHA 5JI6A 4Z5YA 1TP4A 5ACTA 5FRMA 1I5ZA 3U1KA 1TLHB 1X58A 1U78A 5LCAA 1JUPA 4UV9A 4BY7J 1RRJA 3TDUC 3W2WA 2CV2A 2GOMA 2CG2A 1MMAA 3A1YA 1P7IA 1G59A 1AHDP 4IRGA 2TDXA 1X1DA 4LE6A 2A5YB 1WHUA 3VSLA 4FE4A 3I59B 5LGTA 3PNYA 1Z9CA 1W1WE 2DDBA 1R00A 3J81Z 4LG0A 2F5VA 4XSZF 1BMCA 2UWMA 2H27A 2HKOA 1LNWA 1FOXA 5J3LA 1I50J 3O2PE 3MQ0A 1RKWA 3KLNA 2HXOA 2Y8AA 2GIZA 1K78A 5ACUA 2A7MA 2BY3A 1MSFC 1L3LA 5EH9A 1Y8RB 2FEZA 3CC2I 1OCCH 2P8TA 2BTNA 3BROA 5ILVA 1BI3A 4FCYA 2AXTC 2BW3B 1WFXA 3HM5A 5IOYA 3WTYC 4UWPB 2ZKZA 3MKLA 1W0TA 1FZPB 3PFIA 2XAGA 4KEPA 3FXMA 5D4RA 2XB5A 1AKHB 5EZHA 2M0CA 2HQ5A 2XPVA 3HYIA 1WGXA 2Y9YA 4JX5A 5B3RA 2R5YB 1FOWA 4CZZA 5JHFA 5J8FA 4WX9A 3M07A 2VPRA 5DUKA 4CUGA 5FLVA 1KR3A 2BIBA 2JSCA 1IN6A 3AKZA 3GZNB 3PUFA 2EK5A 3RZOJ 3ZNBA 3ULQB 2ZFWA 3QPLA 5J4YA 1Q1VA 3WU0A 5EYRA 3I71A 4S05A 4IHTA 4HF2A 4HNTA 3OOPA 4A12A 2YNVB 2RNJA 2IT0A 2X9DA 2CGPA 1OYWA 1IXRC 3IH2A 5DPXA 4XLFA 3ZQLA 1WJBA 4YIRX 3I58A 1XX5A 2XB0X 2ZJQF 4NHJA 2E1OA 3DQVC 2ZJPF 3KX2A 5KCMA 3H9GA 4RMNA 2GXBA 5H6QA 3I11A 2Q2EA 3GFJA 5M3MJ 1LEBA 1SD4A 4XIDA 3T1BA 2ELJA 1CQTA 4I02A 2HTSA 3H1CA 3HEFA 3RPQA 1X3WB 2KJCA 4CCKA 3DBRB 4FEKA 3S17J 4KICA 2TCTA 2K40A 3RSNA 3ZPLA 2GMNA 4M3EA 4ZDPA 2HQAA 4E7ZA 3L7WA 2Y30A 2HZTA 3DBHB 3X2YA 3OYKA 4E7LA 1X2NA 2EINH 1ZRCA 1YCGA 1ITYA 3JRGA 4IHXA 5AIPA 1M2XA 2M34A 2V9KA 1T2KA 4XKVA 4OIPF 4TZFA 4AU7A 2Z1DA 2LVSA 3PJRA 1BJAA 3QAHA 1ZH5A 2R7VA 3HGGA 3S14J 1JKRC 1VQKI 3LSJA 1KU2A 1V54H 5HLGA 3L2CA 2M9HA 1R36A 3F8MA 5LGNA 2PEXA 4J01A 4NC6A 2P97A 2X1DA 2NNYA 2AS5F 2OV7A 1JTYA 2QSGX 5KNLA 4XMYA 3RKQA 1B8IA 1Y8QB 2VIXA 1D3YA 5GAGJ 4YFNF 5FLXZ 2O5RA 1O3SA 3JRHA 3EETA 2E5NA 3ZXSA 3HDDA 5LBQA 4YSLA 1MJ9A 2CUJA 2A07F 4Z7RA 2FU9A 2EZIA 3Q9VA 3QYFA 4M73A 2YNVA 4F6HA 2DK8A 3E0JB 5H20A 4BE2A 2AIOA 1Z1DA 4PJMA 3PSIA 2QKMB 3A01B 5M5WJ 2R7TA 2QCOA 3BG9A 1KQ9A 2NXNB 4W97A 2JPBA 2LC2A 3OSFA 3N4MA 4RLFA 3SZTA 4U0WA 1T0FC 1ENHA 2HU9A 2QBYB 1D8JA 2FE3A 4TYTA 3KP5A 2FMLA 2QGUA 4CGZA 1X8GA 5AXRA 3HHHA 1UB9A 1MH4A 1MMNA 3KLOA 2WAQN 3RKXA 1Z91A 4AIHA 4NURA 3BR3A 3KZIC 5HLIA 2ME0A 5LRRA 4UY8I 5FB2A 3HUGB 2STWA 4C30A 1IDYA 3DPTA 3BTJA 3Q9SA 1JUMA 3F8FA 2QQBA 1J7KA 2DA3A 2WYMC 2OC6A 2EIJH 3VEPA 3ZQIA 4QTRA 4HDVA 3HOTA 2OTLI 1ORKA 2EZKA 3SFZA 1I6HJ 4HW0A 1OR7C 2DN0A 1FOKA 3H3ZA 2DA7A 2IGMA 3CESA 1VQOI 1ETQA 1BIAA 2MG4A 3HBLA 5CVUA 1U8RA 1LVKA 5E3LA 2R7SA 3IV5A 3IRRA 3CJRB 3GFMA 2PMHA 4QSHA 3F6OA 3BPVA 1LB2A 4A3KJ 4RAGA 3PO2J 1PVEA 4E7HA 3PY6A 2L01A 2W82A 2D1VA 3GEZA 4B4CA 2Y31A 3HPGA 1EKEA 4HBLA 2KISA 2M7AA 4FT8A 1D5YA 1TQMA 2OQRA 1G3WA 2ESHA 1P9EA 4AX1B 2M4GA 1OISA 4BAYA 2BFLA 3CD6I 2HYGD 4IL6C 4AUXA 2FA5A 2Y9ZA 1O3QA 4EJVA 4IHYA 5TISC 3WTSC 3CCQI 3M7GA 2BE5F 5BS6A 4A6DA 4D9JA 4RAWA 2NVYJ 4J5HA 4IKFA 1W7PD 5DM7F 3KIOA 4D7MA 2LH9A 2NS7A 2CFZA 4P1WA 2V79A 4Y17A 3OR1C 1IGNA 2WV0A 1WJDA 4S0HB 4E70A 4CYCB 2ZO4A 3ZRGA 2H1LA 1UHSA 3U21A 2RQQA 4AWXB 3F8BA 2JTVA 3C7JA 1ZLKA 3V7RA 1HKSA 1Y1VJ 2STTA 4V0HA 2CW0F 3LQRA 2CMPA 3GXOA 2JRTA 2H6CA 3H36A 5FKKA 2ADUA 5J8CA 5HLHA 4MTDA 1D0YA 3QRFF 1TW2A 4F91B 2Y0SA 3SEZA 2WA0A 1BA5A 4ZC3A 1SD5A 3S32A 1QHHD 1D0XA 3GLLA 4G8XA 5BPDA 3U1DA 3DHBA 2KIMA 3FMSA 5CPRB 5LLDA 3GTPJ 3GLXA 1FPQA 1X3ZB 3W2AA 4CHLA 5ACQA 2CW7A 1WPKA 2O0YA 3N97A 4ENMA 2DYRH 2DT5A 4IO9F 3BR5A 1IN4A 5HNHA 2ZBKA 2FHXA 1UZCA 2NS0A 2CFUA 3H35A 1OCOH 1WJ5A 2G0EA 4H0DA 1TWHJ 5LCFA 2EBIA 3AAFA 2PG4A 4Y33A 1CGPA 5DCMA 2R0QC 3OYEA 1OCTC 4K2EA 4I6ZA 1F36A 2XRLA 3IWZA 3TOBA 4MHGA 3ZMSA 2JA2A 5B1UA 4C2TA 1YG2A 5HISA 3X2ZA 1W4MA 1HXDA 1XCBA 1ZTRA 2LLKA 2M30A 2HFHA 3HIFA 2BMIA 5FQBA 1A31A 4D0PA 3G1LA 1HSJA 4HX4A 4XLCA 3RZDJ 1WSUA 5ACXA 4RA2A 1JHFA 4IX7A 2YU9J 3VPEA 5KILA 2V1UA 2IS6A 2DQLA 4C3JJ 1NG7A 3W6JB 5JLXA 2QF7A 1ETWA 3R61A 4HDUA 3SZGA 3GTOJ 1BC8C 3CCSI 3FXRA 3L9FA 2TRTA 4QPOA 3PM1A 1JI8A 2UUZA 2HVSA 3PIOF 4A3BJ 3GTKJ 4GO1A 3QWLA 4GYUA 1Z77A 2LBFB 2X6WA 4HF0A 5B1BH 2A3SA 3HC7A 4PJJA 3A0BC 3FKJA 3CMAI 3GO5A 1BW5A 4EXSA 2IGNA 2M8EA 4XBFA 3J7AY 1VJNA 4NC7A 4C1GA 1SVLA 4GCWA 2DU9A 3CLOA 4YFKF 5M5XJ 2VODA 3HOVJ 4EV0A 1HQCA 1E5DA 4NNJA 4G9YA 4M3GA 4ITVA 4DZPA 5J1UA 4CCNA 2FBHA 2QDSA 3IH3A 2V1DA 2KRFA 5LM6A 2DODA 2JN6A 3GF2A 4A3LJ 3HOXJ 1SAUA 4XKCA 5L3CA 1VTNC 1Y6IA 4BL0B 1E3PA 1QVTA 5FLMJ 5HH4A 3DKWA 1B72A 2CG3A 1RUOA 3DKXA 2FU4A 1USSA 2JVHA 3KE2A 3MN2A 4G94A 5IYCJ 2YNTB 4Y7NJ 5IYBJ 4XQFA 1QVUA 4RGSA 1FBQA 2YU3A 3W6VA 5LS3A 3KYLA 2QQAA 4RBOA 1STZA 4I98B 1J2XA 4BDZA 2DTZA 5EEHA 2B0LA 1W5TA 4AC0A 4QLCU 4G6TB 1DQUA 5LMCA 2DMQA 2VKVA 2R7OA 2M5CA 3I14A 3V8KA 3HJEA 4N9IA 1SC7A 3E6MA 1KZHA 1I1GA 1FP1D 2VKEA 5F0CA 5EJCA 1J5YA 1QZYA 2DA1A 3IWFA 4P9UA 4LOCA 4B48A 1MW7A 4AM3A 2H6BA 5L3BA 3BJ6A 5FFXA 3MKWB 2EILH 3SDGA 2DJNA 2ESNA 3CJNA 4LLGF 2HTJA 2RVCA 1HF0A 3I9V2 3IP4B 1O3TA 1G4DA 2XV4S 2Y2ZA 2I5UA 3LAJA 4FTHA 5ACVA 5JLWA 1T56A 2E7YA 1G3TA 1FTZA 2XIGA 1EH8A 2KLOA 2HQNA 1P9QC 4LFUA 1T39A 2ZMEA 4A0ZA 1D5VA 4ASNA 3LA7A 3SBLA 1F43A 4HV6A 4I0AA 3TO9A 1W7PA 3ZN0A 2F4IA 3BT9A 2CUZA 4ENJA 5AIQA 4XRFA 4RGUA 5TJJA 1X8IA 4TZ9A 4M3DA 2Z2SB 5F0FA 2OHHA 2E19A 1Z3XA 2E5ZA 1ZKPA 3BDDA 3CLQA 4TV7A 4BY1J 3IAM2 2YR2A 4LLNA 3HZJA 4PDKA 5CJ9A 4ZDLA 1A35A 2BR6A 2DFEA 3KP3A 3BR2A 5BOXA 2ZZIA 2HPMA 4MLOA 2QUFA 4YIFA 5KIKA 2EV6A 2HS5A 1DU0A 1GV2A 3OYJA 2OUMA 5EW0A 1BJZA 2YS9A 5E20A 3L2VA 2W00A 2ME6A 4HYEA 3TO7A 1VQNI 9ANTA 4M9XA 1YOVB 3CCRI 1OPCA 1MDMB 4LB6B 1FMWA 2O8XA 2GA2A 3M3YJ 1CF7A 1IV6A 3ZMTA 2XUBA 3AJ3A 4RM3A 5FKNA 3LSIA 4A3MJ 1XCVA 2Q0IA 3ERMA 2CUEA 2CFXA 2VKHA 3LOCA 3EYIA 4D1WA 3RCOA 3QODA 3LSRA 2PJRB 2ECCA 2K85A 2AZ4A 2QEDA 2LKPA 3DF8A 3OYFA 3OSGA 3SD9A 2L4AA 5EVBA 2BXYA 3BJOA 1XDUA 3LA3A 5EF6A 3FXOA 1QNTA 5D5UB 1J59A 3GTMJ 1ULYA 4GYQA 4XRSA 5LHHA 3QYEA 5HDGA 3RJPA 2EJRA 1SMYF 4BH9A 2ZC2A 1ODDA 2BG6A 1I27A 3CMYA 4IF4A 5EEAA 3J7AO 3GZ6A 1JKOC 1WCMJ 2E34A 3IE2A 1O4XA 4A0XA 3ML6A 3FZVA 2P6TA 2RC4A 1BM9A 4B3XA 1HSTA 2FJ1A 3G71I 5J6XA 3U9GA 1WJFA 1YW9A 4HX7A 3MZ8A 5HIOA 2PI0A 3HOSA 4BGDA 3JRAA 1S9HA 4EEFG 3WG7H 2NRAC 3HOWJ 4KMUX 1X2MA 4MEXF 3H9JA 4BXFA 5TRDA 3WGIA 1OR7A 3H0GJ 2A6HF 4U87A 5KHDA 2KT0A 3BP8A 1WWXA 2PMZA 3TMOA 3LFKA 3FK7A 1YS7A 5K4MA 4CDGA 1F5TA 5E3NA 3N05A 4IVNA 3WTZA 1LQ1A 2HDCA 3SPUA 1I3AA 2MYSA 2CSOA 3BOQA 3QOPA 1Z7UA 2MD5A 5HS9A 3MD7A 2L7FP 5ICCA 5CVIA 4ZTJA 2OPTA 2XSJC 1RKTA 2VE9A 1Z67A 2KFDA 4JX6A 4DYQA 4D1QA 3UKGA 2IBDA 3H92A 3AG1H 3DLLF 2A61A 2R7RA 2HB9A 2FD5A 4PJNA 1HLVA 1XC5A 1W0UA 4JX4A 4Z6XA 2VC0A 5A0TA 1QBJA 1L9YA 2A5WA 2CQ7A 3AG4H 5IPAA 1SFKA 3F9OA 1DGWY 4EM1A 1B8IB 2OZUA 2R5ZB 4Z6YA 1JJEA 4HKYA 5A2QZ 1ZHFA 3ESHA 3RKJA 3RTRA 4FR7A 4NQ5A 3ZP5A 1K6OA 5DD4A 1QQIA 2DJIA 3K1MA 5EGOB 2DYSH 1IXSB 3S3MA 3GTGJ 2HKXA 1SFOJ 1OYYA 2X6YA 1UCRA 1KGSA 1E2XA 3B73A 3FXLA 5C4JJ 2L3DA 3BG6A 3IRQA 3L2WA 4YIIA 2DOOA 2OD5A 1EH7A 4CYCA 2EV5A 3MWMA 5FQAA 4BP0A 2UV1A 5JHUA 1V5GA 4LLLA 2L54A 2NVQJ 3BTCA 4PJLA 4UVAA 2XC7A 2W57A 2DT6A 3A01A 4Q5SF 3PSFA 2H8WA 5E3MA 2LFBA 2IPQX 4UBQA 3HRMA 1JJTA 1UAAA 1R1UA 4I2OA 2DOAA 2HXIA 2PN6A 4WD6A 4B87A 4GCVA 4OU0A 1QH3A 2VN2A 3O8HA 3S2WA 2DPDA 2LKXA 4AIDA 5H6RA 1NG6A 1VQPI 1JJ8C 1B6AA 2K86A 3TDZC 2M7BA 4FASD 2KIQA 5LSCA 2E35A 2L9SA 4BHPA 2OU2A 4BACA 1F1ZA 3C2GA 3SFIA 2OJED 1RUNA 1QZZA 3BTIA 4L9JA 4ON0A 4PVTA 4ZZDA 3GCMA 5IYDJ 2E60A 3HRUA 4YEJA 5K1YA 2H1KA 2DK5A 3S2DJ 2VJ4A 2XPUA 4GYGA 3FX3A 3OYCA 2EFNA 4OMYA 1ZTCA 1OCPA 1ZG5A 5DYMA 3KNSA 4L5IA 2CH0A 2WB1N 4AYBA 3V42A 4P62A 3ABUA 2F2EA 3A4YA 2WV1A 3QP6A 5AIJA 1RC9A 5CVRA 1ETVA 2I7XA 2WTEA 1LEAA 4GFBA 5FLXK 4BEHA 4MQVA 4KNYA 1JT1A 3P7NA 5C44J 4HRIA 2I7VA 2OZ6A 3HRTA 2XASA 2EA2A 4ZJZA 1KA8A 2ECBA 3S15J 2ZB9A 3R0JA 2P4ZA 1LUJB 1VQLI 4L9TA 3RPUA 2JPCA 2XAQA 3OYGA 3CC7I 3G1MA 5K5OA 5JVGF 2E71A 1YIJI 4V19K 2OCCH 2ID3A 3OYMA 2E36A 2BW3A 3DKYA 1TWGJ 5GP9A 3SYTA 5FD6A 5GPCA 3R2UA 2HYJA 2CO5A 2UZKA 4C1HA 1B9NA 1EV7A 1TTYA 3KYDB 5FKMA 1YE9A 3K4BA 1XDSA 2A68F 1XM8A 3WHBA 4CXFA 1Z7LA 1P92A 1DD6A 4UVBA 4C2UA 1TT5B 3A2KA 4RL0A 2M1BA 2BGCA 5ED4A 4I99C 2XGEA 2H09A 4HAMA 2B63J 4HNUA 4UUVA 1FP2A 2VASA 2FXAA 1E0EA 1V5FA 1IO2A 2ISYA 3F6VA 3I0TA 4WXCA 3JTGA 2YNWA 1YX5A 2CYYA 2WWYA 1BI2A 2PFBA 2G9WA 2ZXJA 1K83J 3ZWFA 1B1BA 4XWTA 1H9TA 1X1BA 3CUQA 2ZXIA 1FNNA 2HVRA 3DPLC 4UUTA 3I3LA 2NNNA 2FM6A 2M2EA 2FBIA 3MMYB 2K4JA 4IPAA 4RDUA 1T38A 1B72B 3S1NJ 1IW7F 4IQJA 1OMIA 4XLEA 3PQJA 5E18F 3FCZA 3ABMH 1ZGAA 4L0YB 1A6IA 1I39A 2H94A 3TQNA 3H3EA 2L7MP 4EYFA 4KMFA 1IRXA 2X1EA 4BJ6C 3J7YJ 2LG4A 2P0WA 2LK2A 2E1MC 4PK4A 2DCEA 1TZLA 2F6CA 4FISA 4YELA 1I1SA 4HG2A 5J1YA 2EZLA 2I7TA 2Z33A 1ZGJA 2HQRA 3CCVI 3VQZA 2GAUA 2DMTA 2QWWA 3T0YA 1IUYA 2ZXWH 5CVJA 4A5NA 4CCMA 4DZJA 4BXXJ 3FBNB 3OL4A 4KYWA 5IQKA 2B7EA 4EJUA 1P4WA 2V6EA 1PP8F 2AHQA 1JKPC 4HNVA 2B9SA 4P9FA 5CVVA 1DPUA 4KUMA 3LSGA 1GXPA 2F4OB 2BHYA 4UHTA 1OFCX 4RB0A 2W1OA 2QQ8A 1VMEA 4BS9A 2R5YA 4XORA 2E1CA 3GTLJ 1BC2A 2HOAA 4AV7A 4C1CA 1ZLJA 2GQQA 4IOAF 1SD6A 2EIKH 2P7VB 1U9OA 4XUKA 4WXDA 3HB9A 3HTSB 2MFZA 3C18A 4X6AJ 2DA2A 1YYVA 3ZCOA 3S16J 3ZQHA 2NYPA 3QPTA 3VOEA 3J7ZI 3L2QA 3DHAA 3DTEA 1POGA 3LSMA 4X1EA 4O6JA 3C3WA 1QPIA 4WXHA 1PUFB 1VQ9I 4KISA 2WY8Q 3KNRA 1Z6TA 2DMUA 4Z60A 3WXCA 1PYVA 2XHKA 3K4LA 3HOYJ 1ACIA 2K7LA 2VBWA 4EFZA 2DA6A 5DEQA 3DU5A 2KRHA 1S7AA 1U5TA 1G6NA 3IELA 1H89C 2MC3A 1Y0NA 1FBSA 4UUSA 2L9RA 3WTXC 2F48A 2DFFA 2XPWA 3K2ZA 1LFUP 4OIQF 2E2IJ 2IS1A 1XGMA 3K4MA 3WE2A 5LE1A 1G3YA 5CQGA 4A3IJ 1HW5A 1X1AA 2FQ3A 5TGTA 2L7ZA 1O3RA 2EIMH 2JA7J 3CCJI 5HS7A 2NVTJ 2VOOA 4OIRF 3JRFA 2V9VA 1GT0C 2FX0A 4KT6A 1VI0A 3L09A 3K10A 3S1MJ 1K6YA 4L18B 5ICGA 2M45A 1SANA 2GWRA 2GFJA 1IXCA 2VJ5A 3FF5A 1FEXA 5J1RA 1TWFJ 4AVZA 4PFOA 2DMNA 2P6SA 4RAZA 5L3DA 3V4GA 2DFHA 3ECOA 3GZ5A 5DCMB 1IC8A 4XRSG 5IT3A 4E7KA 1IRGA 1Y39A 4HLXA 1APLC 2FOKA 2M5DA 5JR3A 1VF9A 4L9NA 3ADRA 2XR1A 1TNTA 2Z16A 3DEUA 2P5LC 3Q6VA 3QU6A 5EGOA 3CO6C 1G3SA 3L2RA 3MKYB 3KP4A 1BW6A 1GLNA 1LDJA 1D1CA 4O98A 2W24A 4NB5A 3IL2A 1WJAA 1MBGA 5EWAA 3CDLA 2EPFA 1TWAJ 2BY1A 4ESFA 2YNTA 5H2FC 3CJTB 3IH4A 3G4SI 2GCUA 2XRNA 4U7BA 5HH6A 3IEMA 4WWCA 3MZYA 2M5WA 3G3ZA 4G7ZF 4M71A 1MJBA 4ZEJA 2YX4A 3CUQB 1FWZA 4B8XA 3DBLB 2F5FA 1WRJA 3DH8A 1VQ5I 2WY7Q 3OIQA 5DDGA 2K5CA 3SHFA 1BR4A 1RNLA 3FM5A 4N0BA 2E1NA 4CHUA 2VXDA 1YQAA 5ICEA 2R7XA 1WRAA 1MJAA 3E3VA 4XLPF 3OYHA 4BUPA 1IN8A 4KJZA 1USTA 4AVPA 1J75A 4PVOA 1U6GA 4YFXF 3FDYA 3S93A 2CV1A 2KIUA 3WG9A 2COBA 5L3GA 3I56I 3ISPA 1NTCA 4I09A 2DAOA 2AXLA 2BG8A 2CS3A 5DUIA 4A3GJ 1MMDA 2Q1ZB 5BMZA 3ERED 4C3HJ 1S5LC 2HOTA 1WI9A 3D5SC 1SMLA 5HLTA 3W2VA 3CP2A 3E6BA 3BCBA 3CCUI 1YO5C 3M4OJ 1X4PA 2D1HA 3K9TA 3LAPA 2KZVA 4FQGA 3MAJA 1SVMA 4ENKA 3CMEI 4A0YA 3OR2C 1ONVA 4JYKA 5K0WA 2FSWA 3DHCA 3VYUB 2DOFA 1PDNC 2E1MB 2BGAA 1J09A 3CTAA 1JGSA 4ZTFA 3JAMZ 1XTAA 5IT9Z 4ZYDA 4CCOA 1FMVA 5IP7J 1X1CA 5M5YJ 4NBQA 5EDNA 3LVZA 1AOYA 5HIPA 2FU6A 3LSTA 3HL2A 1T6SA 2CJJA 4RM5A 3EPZA 4BQAA 1Z3YA 5FRNA 1J9IA 3VSKA 1GHCA 3ZMZA 1FLIA 4TYFA 3H5RA 4G12A 4OOIA 2VQHA 3GBGA 1K61A 2RQPA 2KMUA 1MMSA 3TOAA 3HTUA 3GUDA 4W1UA 5D8LB 3BZKA 5ACSA 2AQFA 3T9MA 4UB8C 1JHHA 2LP0A 3A03A 1CF7B 2P4WA 4KT5C 5IY5H 3AL0C 2LR8A 3VODA 4D1UA 3CP8A 1YLFA 4LK0F 2ZNZA 1GUUA 2YZ3A 1X4OA 4EGZA 2BC2A 2QLZA 4CA0A 2BY2A 4QIWN 2DQRA 1S3JA 5HS8A 5JVTA 1T98A 2HEOA 1KU7A 5D4SA 4KIFA 3S3NA 1XN7A 2K9QA 2G7UA 3O8GA 2BVMA 4PSWA 1QHGA 1YW8A 3I4MJ 1SVOA 3HOUJ 3COAC 2XF4A 3Q0WA 1YFHA 2WB1A 3M1EA 2K3FA 2EQRA 2P5KA 3MCZA 2R2DA 2L7KA 3KYCB 5IOZA 1V4RA 4ESJA 4ZNBA 3B02A 5ILUA 3WGHA 2DTRA 1PUEE 1Y44A 5K7FA 2NVUB 4DBRA 4RGRA 3BQYA 5EG0A 3PNVA 1FYLA 1NK3P 4BBSJ 2D2WA 2EH3A 4FX0A 3JAMK 4BE1A 1HBXG 5IT9K 2BVLA 1T08B 3F0CA 3I13A 2NOJB 4M9SA 1FSEA 1LKXA 2F5CA 4LITA 1MBJA 3G73A 3CMMA 1KYZA 1F9NA 1T33A 2DI3A 4AD9A 2FQ4A 1I6XA 2DXIA 3GTQJ 4BHBA 1F4KA 1XMXA 3EYYA 4H0EA 2ACJA 2QENA 2XROA 4R79A 1YJWI 2I8DA 3CZ6A 3IKTA 2XAFA 1S7EA 3I5UA 1O7LA 4I76A 4RB2C 4S04A 2YCBA 2XAHA 3VFZA 1DDKA 1R5GA 1V5EA 2KQRA 1RZ4A 2DA5A 5D5WB 2GLOA 1UJ8A 4B44A 1T8IA 2P18A 3OY9A 5K4NA 2EFPA 1IN5A 1BBYA 2JMWA 2HOSA 1ZK8A 2M0MA 2WYLA 3KETA 4IZZA 4XWWA 3J80K 2V26A 1AWCA 1SAXA 3BC8A 3HGYA 3Q0UA 1WJCA 2XAUA 4TZBA 3CCYA 3I54A 5F27A 4AX0B 1YW7A 2LY1A 2ZSHB 4XK4A 2HYFA 4U0YA 3SXYA 4RLQA 3OYDA 1AU7A 1FIAA 4ANJA 2WHGA 1QZEA 1ON1A 3WTVC 2E7XA 1Y0UA 4Z5ZA 3UR3C 3G1PA 2K27A 2RN7A 3OIOA 3W3CA 2LRDA 1LPQA 2IGOA 3I53A 2PJPA 4LJZF 1UHWA 1TNSA 1B59A 5CYVA 1FIPA 4BZ3A 4OAZA 3E6CC 4O3MA 1JXSA 1DXKA 2VL8A 2GOXB 2V1XA 3FK6A 3SDBA 4HOBA 3HRSA 5EEGA 4HQMA 5EVDA 2GXGA 1N75A 3QPSA 5LGUA 4BDYA 3GYHX 2F5DA 4L5EA 2MGQA 3OV8A 3E5QA 1R9TJ 1R7JA 3CC4I 3ZN1A 2BFKA 1IRFA 3PG4A 3TO6A 1JGGA 5B15A 2KL4A 3OYBA 1WI3A 4A3DJ 4MFDA 4DYCA 5A87A 3D5LA 3Q5FA 1MBFA 1P4AA 1VFCA 2KHMA 3PQKA 2R7QA 4V2FA 3HUGA 2LOOA 2EFWA 4GYIA 4ESBA 3LFUA 1OKRA 5F04A 2VKDA 2IXSA 3OMYA 1YX3A 1MBKA 3GFIA 2W7NA 3B6AA 2RKHA 2ZSIB 4HZFA 2VT3A 2E2JJ 2WRSA 3NRVA 2XDVA 4UB6C 2BV6A 3BV6A 3RQ4A 4UWOB 3T3OA 4MEYF 1JTXA 4B09A 1U8BA 2XVCA 1JKQC 3PL8A 1NK2P 1ZARA 3UNGC 2IVMA 3H3VK 4IQ4A 2I10A 3TW7A 4Y15A 1R58A 2L0KA 4OWRB 1YJNI 3V8JA 3TP9A 2ZXHA 2ZMEB 4J5FA 1FX7A 1R4NB 4NUBA 2CQXA 3RKWA 2ZJ2A 1XGNA 5F6FA 4OIOF 4DIQA 2EFQA 1AA7A 1YIOA 3L1PA 4CCLA 2MW8A 2P7CB 3LSKA 2ELKA 4EQQA 4I7HA 3TP0A 1MBHA 4RL2A 3BR1A 1KO3A 2CG4A 2QEXI 3WGGA 2BHZA 5F1RA 4Z67A 4WF2A 1VQMI 1Z6RA 3DP7A 2EB7A 3W6KB 4A3FJ 2O8KA 3I64A 2QBYA 2X85A 4FHTA 1R4MB 2X6XA 2DDAA 5B1AH 1ZR2A 3VWBA 5AJLA 2HDWA 3ABLH 4M74A 3KEYA 1XMKA 1KQ8A 2R4GA 1N78A 4NQ2A 5B5EC 4UWRB 2L9VA 5JFRA 5GAEJ 2ZFUA 2KKOA 3I4PA 3I59A 2MC4A 3V7SA 1MDMA 2E2HJ 5AXOA 4J00A 3GWZA 1M1EB 2KZGA 2XGDA 3CQZJ 5M3FJ 3FKIJ 3ABTA 1N77A 1ON2A 1U3EM 2CQKA 2JRMA 1MMGA 2ISZA 4HV5A 5BPIA 4XLAA 2ZWRA 4ZYHA 4F6ZA 5C4XJ 2LKSA 5AONA 5K4KA 2RV8A 3ASNH 4UXNA 3GW2A 5FKOA 5DS9A 1UELB 2P5VA 1ZRFA 2VI6A 4XLHA 2JQ7A 2BG7A 4EXYA 2VQGA 4PJ0C 2ICWG 1RI7A 1ETXA 4UVCA 4WK8F 3Q0VA 3R0AA 4B1RA 4ETSA 3H9QA 1OCRH 1MZBA 2OCEA 3A0HC 1R5HA 1IG7A 4JO0A 1RETA 2MLGA 5HDKA 2HPIA 1B9MA 2V7FA 3QH8A 2HZDA 2YX7A 3ESWB 2Z9OA 4AIJA 2XF5A 3ZGKA 3H5AA 1U0JA 2Y75A 3FXKA 1BC7C 1VGNA 2JZYA 1BVTA 2R92J 2DLLA 4A3CJ 5HOOA 1JJ6C 2R5ZA 3CUOA 4C2MJ 1VZ0A 1K4SA 4EY2A 3HPHA 3VDXA 4C1DA 1DPRA 3IHUA 1RIOH 1MGTA 2V1NA 1XMAA 3AG2H 3ZMDA 1EF4A 3HG9A 5LEKA 1OQYA 3ELKA 3JRCA 2R7DA 5FJ8J 1E17A 1YCHA 2FNPA 3ZOBA 1Z05A 2JJ7A 2OTJI 5D8KB 4NQWB 4XR6A 3WTUC 3EQLF 4JQFA 3SFPA 4AWYB 3DV8A 3G1OA 3NEUA 2W4SA 3QP5A 1R23A 2X4HA 1VQ7I 1J0RA 4YG2F 4ZDOA 4YSBA 4HA8A 1V3FA 2PQ8A 2RNGA 4LG0B 3EUKL 4AYBN 4EMSA 1TQPA 2W85A 3TGNA 2UXNA 4L0ZB 4JBAA 1T0FA
chains in the Genus database with same CATH topology
1QPMA 3BK2A 5ACPA 1JE8A 3BC2A 1BI1A 4XLNF 3F21A 4P5OA 3FHZA 3HHGA 3KFWX 3KL7A 2QYOA 4M72A 3JTHA 3REOA 4MGRA 3F72A 3PY5A 4P96A 5KK1A 5DD8A 1WKMA 2WYMA 1XGSA 2VW8A 4UAMA 4DQ2A 2V6CA 3HSFA 4LGWA 1C0WA 4KN7X 4A2UA 1WQ2A 4R8HA 4Q4ZF 3RPCA 4D1TA 3V8LA 1MQOA 2WC2A 5CLSA 4KFCA 2QDTA 2L02A 2MH2A 3R60A 3R4KA 3KEQA 4ZYEA 5FFZA 1DDNA 3P2UA 4M6YA 4ZH4F 2OQGA 2EFOA 4EYBA 3QU3A 3L6NA 2K4BA 3U2RA 3AF5A 4C09A 1X3UA 3CUQC 4TZEA 1XSXA 4KEQA 4IHSA 3F23A 4MTEA 5KVRA 1ZG1A 3DFGA 2OBPA 2UYXA 2OHJA 3P9CA 2O03A 2NZEA 1H9GA 2QM3A 3KEOA 1REPC 2GFKA 4YSKA 5AYAA 1R1VA 4BHCA 5D5VB 3KCCA 4BYYA 1BOAA 4IJAA 4NQWA 4MQ9F 5FQCA 3WTWC 2IA1A 4NQ4A 3X2XA 1IF1A 2HWVA 3F8NA 4ENNA 4RB1A 3S0ZA 4IXAA 1QH5A 1FYKA 4U0VA 4ZZLA 2HGCA 3E6DA 4AWZA 3T5XA 4Z2YA 4CICA 5DV5A 3AF6A 4L5JA 4G7OF 2NZFA 1ZRDA 2FHXB 5D5XB 2ZNYA 3FMQA 4PCQA 4C1EA 3IKVA 2LSOA 3KP7A 3VB2A 2QVOA 3K0LA 2VT2A 3BK1A 1FYMA 3FXUA 1SFEA 3LWFA 1TQIA 2BFZA 2UXXA 2YSRA 1P2FA 3E5UA 4RGXA 4XSXF 3WU1B 2W25A 1MKMA 2GKLA 2C6YA 2DFIA 4PGHA 4GXOA 6PAXA 2Q0OA 2Y87A 3RI4A 2EA4A 3T8TA 3V7CA 2BG2A 3K1PA 1FBUA 5LHGA 3I15A 3EDPA 3E5XA 5E8IA 1LDKB 2EWNA 2F5EA 3KP2A 1HKTA 2OAZA 4RS8A 2VBYA 5EV8A 2RDPA 1BN5A 1FY7A 1ZAOA 1B4AA 5HIQA 4U88A 2O6GE 5EV6A 1O57A 5A5ZA 2ETHA 4PZJA 1XSDA 2Z99A 1WUOA 4HLYA 2A6EF 5A2QK 5FO5A 4D02A 3EUHA 5AHRA 2FBKA 2D45A 4I01A 4RAYA 2FRHA 5L3EA 2M87A 3RKYA 5LCHA 4CO8A 1H0MA 2FMYA 5F64A 1YTYA 2IP2A 4D1VA 1QGPA 3FMRA 5HH5A 4KA4A 4DIKA 4O5VA 2PBIA 1KYWA 1SFXA 2VC1A 1XB4A 3FM3A 5ILSA 1DP7P 4EGYA 3T3NA 3NQOA 2VONA 5LRSA 4CYDA 1A8TA 1TW3A 4KIBA 2BFZB 2FNAA 1SD7A 1QO0D 4PGGA 1XTOA 3ZMVA 1D8KA 2O3FA 4Y13A 2LF7A 5DCFA 3JXPA 2H6AA 4LD5A 1FT9A 1P6RA 1S8NA 4FX4A 2QINA 4ZO2A 1K79A 3F3XA 1DUXC 3QPHA 3SZPA 3M9AA 4G6DA 4A5MA 2VOPA 5EVKA 3D0SA 3M8FA 1YCFA 2BEOA 4EJWA 3IEKA 1K7AA 3F8CA 3BJAA 5HVQC 2COMA 3L00A 5ICFA 3M8EA 1GVJA 3O3KA 2IA2A 2W84A 3LA2A 2ZNBA 3F22A 1ZN2A 3ZQ7A 3ZR9A 2Y8BA 2EV0A 1KU3A 1XGOA 5LHIA 2YNUA 2QZ8A 2DO7A 4KIGA 2R7FA 3H3UA 4C1FA 2YPRA 2GIVA 4DILA 1S6LA 2R3SA 1PP7U 3BY6A 3IOFA 1HLKA 2MBFA 1LDDA 3MFKA 4KN4X 1KU9A 5BQTA 4RBSA 3O6BB 4HL1A 1BI0A 4UNOA 2Z5UA 4GGGA 3WODF 2VE8A 3K1NA 3BZ6A 2JT1A 2K02A 1K07A 1UFMA 2NXAA 2LDUA 1KQ0A 2IJLA 2FU7A 3RKKA 5FGMA 1HW1A 4RAMA 3LQQA 5FD5A 4ZYGA 2QQ9A 3CDHA 3BWGA 1Q1HA 2DW4A 4FSBA 4RB3C 4Q48A 1W7PB 2GZWA 2Q8KA 1R1TA 3IE1A 3SQNA 1U2WA 4G6QA 1S29A 5E1WA 4UA4A 4MNUA 4P55A 2Z3YA 2Y48A 1LJ9A 4LB5A 5K5RA 3J80Z 5LLQA 3FAIA 1ZREA 1U5TB 2MH9A 3GVAA 2L4MA 3WE3A 4EVIA 4EM0B 2A69F 2ZCWA 2KJBA 1FC3A 4EYLA 1W5SA 3E97A 2VBZA 1OYIA 1TBXA 2RGVA 3IDZA 1SFUA 2DPUA 3DXJF 5AHOA 2FF4A 4I0BA 4ZO3A 3IE0A 1UHMA 2PMUA 3JSPA 3FWEA 3RYRA 2VBXA 3CO7C 4EJTA 4BXUA 4AIKA 4IRIA 5E8GA 4JK1X 2XKPA 1ZG3A 3KZYA 1ZYRF 1XSVA 3RIRA 1O7FA 4M6XA 2ELHA 3KP6A 3FXQA 1IN7A 2KIFA 2NYXA 2IRFG 1LVAA 1XD7A 1EH6A 3ECHA 3JSOA 3MZHA 4A6EA 2J5OA 4BNCA 2X0LA 3ZMUA 4R1HA 5E1XA 1X8HA 3RDIA 4HX8A 2VXZA 3ZQ4A 3HSEA 1SMTA 4WCGA 2BG8B 4OINF 2OA4A 4UV8A 3WTTC 3C1DA 4EJOA 2PLYA 1WW1A 2OHIA 1MD0A 2Q9UA 4UWSB 5ERIA 1HKQA 3HSRA 5ACRA 3RYPA 3MEXA 2FK6A 4OMZA 1BIBA 2Q0JA 4HF1A 2IA0A 2DKFA 3JW4A 3TKYA 5EHTA 5A0VA 2BBYA 4Q47A 3GFLA 2CBNA 5E1ZB 4IRHA 2Q42A 3SRXA 2LF8A 2GA1A 1KO2A 5D6FA 1S7OA 4HQEA 2XGXA 1WUPA 3J81K 5HDNA 2HR3A 1P4XA 5K5QA 2MA3A 1K78B 5ACWA 1ZNBA 1NHAA 3ROUA 3IOGA 4L9VA 3P9KA 1IZ1A 2HOEA 3K69A 1IAWA 5AEBA 2IW5A 4HL2A 4F7ZA 1HW2A 4N9HA 2FU8A 1A04A 4QWQA 5LEJA 2J5PA 4G7HF 4NQ6A 4LK1F 3P9IA 1L0OC 2DBBA 5E17F 1U5TC 5D6EA 1A7TA 2P1EA 3I0VA 2Y0MA 3R6SA 1YS6A 2QJSA 4U4LA 4LMYA 2XAJA 3X30A 3KZZA 3IC7A 5L3FA 4DNCA 4M9ZA 4KDPA 2MLKA 2CWEA 3T8RA 2O61A 2E7WA 3SW3A 2LNBA 1GXQA 2BYVE 1R22A 2G7HA 4EM2A 4U7DA 2NAZA 3GX4X 2XKOA 3BPXA 1FSHA 5JI6A 4Z5YA 5ACTA 1I5ZA 1TLHB 1U78A 5LCAA 4UV9A 3TDUC 4IRGA 2TDXA 4LE6A 2A5YB 3I59B 5LGTA 1Z9CA 1R00A 3J81Z 4LG0A 1BMCA 4XSZF 2UWMA 2H27A 2HKOA 1LNWA 3O2PE 3MQ0A 3KLNA 2Y8AA 1K78A 5ACUA 2A7MA 1L3LA 5EH9A 2FEZA 2P8TA 2BTNA 3BROA 5ILVA 1BI3A 3WTYC 4UWPB 2ZKZA 1FZPB 3PFIA 2XAGA 4KEPA 5D4RA 3HYIA 5B3RA 4CZZA 5J8FA 4WX9A 5DUKA 2BIBA 1KR3A 2JSCA 1IN6A 2EK5A 3ZNBA 3ULQB 2ZFWA 3WU0A 3I71A 4S05A 4IHTA 4HF2A 3OOPA 4A12A 2YNVB 2RNJA 2IT0A 2CGPA 1OYWA 1IXRC 5DPXA 3I58A 4NHJA 3DQVC 2GXBA 5H6QA 3I11A 2Q2EA 3GFJA 1LEBA 1SD4A 3T1BA 4I02A 2HTSA 3RPQA 2KJCA 4FEKA 4KICA 3ZPLA 2GMNA 3L7WA 2HZTA 3X2YA 1ZRCA 1YCGA 5AIPA 1M2XA 1T2KA 4OIPF 4TZFA 1BJAA 3QAHA 1ZH5A 1KU2A 5HLGA 3L2CA 1R36A 3F8MA 5LGNA 2PEXA 2P97A 2NNYA 2AS5F 1D3YA 4YFNF 5FLXZ 1O3SA 3EETA 5LBQA 4YSLA 1MJ9A 2A07F 4Z7RA 2FU9A 3Q9VA 4M73A 2YNVA 4F6HA 2DK8A 5H20A 2AIOA 1Z1DA 1KQ9A 2JPBA 3N4MA 3SZTA 4U0WA 2QBYB 1D8JA 2FE3A 4TYTA 3KP5A 2FMLA 4CGZA 1X8GA 5AXRA 4AIHA 1UB9A 3HHHA 3KLOA 3RKXA 1Z91A 5HLIA 5LRRA 5FB2A 2STWA 3DPTA 3Q9SA 3F8FA 1J7KA 2QQBA 2WYMC 3VEPA 4HDVA 3HOTA 3SFZA 4HW0A 1FOKA 3H3ZA 1U8RA 1BIAA 5CVUA 3IRRA 2PMHA 3GFMA 3F6OA 3BPVA 1LB2A 3PY6A 2L01A 2D1VA 3GEZA 4HBLA 4FT8A 1TQMA 2OQRA 1G3WA 2ESHA 1P9EA 4AX1B 4BAYA 2BFLA 2HYGD 2FA5A 1O3QA 4EJVA 3WTSC 3M7GA 2BE5F 5BS6A 4A6DA 4RAWA 4J5HA 1W7PD 2V79A 4Y17A 2WV0A 4E70A 2ZO4A 4AWXB 3F8BA 2JTVA 3C7JA 1ZLKA 3V7RA 1HKSA 2STTA 4V0HA 2CW0F 3LQRA 2JRTA 3GXOA 2H6CA 2ADUA 5J8CA 5HLHA 4MTDA 3QRFF 1TW2A 1SD5A 4G8XA 5BPDA 3U1DA 3DHBA 2KIMA 3FMSA 5LLDA 3GLXA 1FPQA 4CHLA 5ACQA 2O0YA 3N97A 4ENMA 2DT5A 1IN4A 2FHXA 2ZBKA 2NS0A 4H0DA 5LCFA 3AAFA 2PG4A 1CGPA 5DCMA 4K2EA 3TOBA 3IWZA 3ZMSA 4MHGA 5B1UA 5HISA 1YG2A 3X2ZA 1W4MA 1HXDA 1XCBA 2M30A 2HFHA 3HIFA 2BMIA 5FQBA 4D0PA 1HSJA 4HX4A 1WSUA 5ACXA 1JHFA 3VPEA 5KILA 2V1UA 2DQLA 3W6JB 3R61A 4HDUA 1BC8C 3FXRA 3L9FA 4GO1A 4GYUA 4HF0A 2A3SA 3GO5A 4EXSA 2M8EA 4XBFA 1VJNA 4C1GA 4GCWA 2DU9A 3CLOA 4YFKF 2VODA 4EV0A 1HQCA 1E5DA 4G9YA 2FBHA 2QDSA 2V1DA 2KRFA 5LM6A 3GF2A 1VTNC 5L3CA 5HH4A 3DKWA 1RUOA 2FU4A 1USSA 3KE2A 4G94A 2YNTB 4RGSA 1FBQA 2YU3A 5LS3A 2QQAA 1STZA 4I98B 1J2XA 5EEHA 2B0LA 1W5TA 4QLCU 5LMCA 2M5CA 3I14A 3V8KA 4N9IA 3E6MA 1I1GA 1FP1D 1J5YA 1QZYA 3IWFA 4P9UA 2H6BA 5L3BA 3BJ6A 5FFXA 2ESNA 3CJNA 4LLGF 2HTJA 2RVCA 1O3TA 1G4DA 2XV4S 3LAJA 5ACVA 2E7YA 1G3TA 2XIGA 1EH8A 2HQNA 4LFUA 1T39A 2ZMEA 4A0ZA 1D5VA 4ASNA 3LA7A 3SBLA 4HV6A 4I0AA 3TO9A 1W7PA 3ZN0A 4ENJA 5AIQA 4XRFA 4RGUA 5TJJA 1X8IA 4TZ9A 2OHHA 1ZKPA 3BDDA 4TV7A 2YR2A 4LLNA 4PDKA 5CJ9A 2BR6A 3KP3A 5BOXA 2ZZIA 2QUFA 4YIFA 5KIKA 2EV6A 2HS5A 5EW0A 5E20A 4HYEA 3TO7A 4M9XA 1OPCA 1MDMB 4LB6B 2O8XA 2GA2A 1CF7A 3ZMTA 2XUBA 3AJ3A 1XCVA 2Q0IA 2CFXA 4D1WA 3EYIA 2AZ4A 2QEDA 2LKPA 3DF8A 3SD9A 2L4AA 5EVBA 3BJOA 1XDUA 3LA3A 5D5UB 1QNTA 1J59A 4GYQA 1ULYA 5LHHA 5HDGA 3RJPA 2EJRA 1SMYF 4BH9A 1ODDA 2BG6A 1I27A 4IF4A 3J7AO 3GZ6A 3IE2A 4A0XA 3ML6A 3FZVA 2P6TA 1BM9A 2RC4A 1HSTA 5J6XA 3U9GA 1YW9A 4HX7A 5HIOA 2PI0A 3HOSA 2NRAC 4KMUX 4MEXF 5TRDA 3WGIA 1OR7A 2A6HF 3BP8A 1WWXA 3LFKA 1YS7A 5K4MA 4CDGA 1F5TA 4IVNA 3WTZA 1LQ1A 2HDCA 3SPUA 2CSOA 3BOQA 3QOPA 1Z7UA 2MD5A 5HS9A 3MD7A 5ICCA 5CVIA 2VE9A 3H92A 2A61A 2HB9A 4Z6XA 2VC0A 5A0TA 1QBJA 1L9YA 3F9OA 4EM1A 2OZUA 1JJEA 4HKYA 5A2QZ 1ZHFA 3ESHA 3RKJA 3RTRA 4FR7A 4NQ5A 3ZP5A 1K6OA 5DD4A 1QQIA 3K1MA 1IXSB 2HKXA 1OYYA 1UCRA 1KGSA 1E2XA 3B73A 2L3DA 3IRQA 4YIIA 2DOOA 2OD5A 1EH7A 2EV5A 3MWMA 5FQAA 4BP0A 5JHUA 4LLLA 2L54A 4UVAA 4Q5SF 2W57A 4UBQA 2IPQX 3HRMA 1JJTA 1R1UA 4I2OA 2PN6A 4WD6A 4B87A 4GCVA 4OU0A 1QH3A 2VN2A 3S2WA 2DPDA 5H6RA 1B6AA 2K86A 3TDZC 5LSCA 4BHPA 2OU2A 1F1ZA 1RUNA 1QZZA 4L9JA 4ON0A 4PVTA 4ZZDA 3HRUA 5K1YA 2DK5A 4GYGA 3FX3A 2EFNA 4OMYA 1ZTCA 1ZG5A 5DYMA 3KNSA 4L5IA 4P62A 3ABUA 2F2EA 3A4YA 3QP6A 5CVRA 2I7XA 2WTEA 1LEAA 5FLXK 4MQVA 4KNYA 1JT1A 3P7NA 2I7VA 2OZ6A 3HRTA 2XASA 2EA2A 1KA8A 2P4ZA 3R0JA