4AD9A

Crystal structure of human lactb2.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
288
structure length
288
Chain Sequence
b'MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE-LIKE PROTEIN 2
publication title Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 86
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF17778 BLACT_WH Beta-lactamase associated winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ad9A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4ad9A01
4RB1A 1YIOA 1GXPA 2JTVA 1YCGA 2LNBA 4GYGA 3P9KA 1WUOA 2BGCA 4UXNA 3GYHX 4C1GA 3BROA 4L0ZB 4BNCA 3WE2A 3U9GA 1O3TA 1YS7A 4LMYA 3TDUC 3R61A 1LEBA 3I71A 5BPDA 3F8BA 3KEQA 5ICEA 3TP9A 4HZFA 3FHZA 5EV6A 4HDUA 2FHXB 3SBLA 4U4LA 5BQTA 3L6NA 2FNAA 1FPQA 4BH9A 4WXDA 3I59B 1MJBA 4RL0A 4OINF 3WG9A 2K02A 5F64A 2MA3A 3LAJA 3QAHA 1WI9A 4MTEA 4YFNF 5ILVA 5LGUA 5EWAA 2YNVA 5LSCA 1ZYRF 2YX7A 1OKRA 3HRMA 4EJOA 3GZ6A 3WTTC 3FMQA 3X2XA 2VOPA 4LLNA 3U2RA 4BAYA 3FF5A 2HEOA 3RDIA 4Y17A 4D0PA 5L3EA 4KFCA 3F21A 2WYMA 5LGTA 2QDTA 2M45A 3CUOA 1TBXA 1UB9A 2WHGA 3FXQA 4GYIA 2R7DA 5LEKA 3IE0A 4EFZA 2KRFA 1V4RA 4K2EA 2A07F 3QH8A 2M87A 3S0ZA 3H92A 2XGXA 2ZXJA 3N97A 3I58A 2VBYA 4PGHA 3DPTA 3WXCA 2BIBA 5ACUA 1ULYA 1A04A 4EV0A 4RAYA 4LG0A 4EJUA 1FYKA 4EGZA 3GEZA 4IXAA 1J2XA 3C18A 3WTVC 3VPEA 1FSHA 5HIOA 1JHFA 5KILA 4PVTA 1OYIA 1EH7A 3KP7A 1Z7UA 4AWYB 5HH5A 3REOA 4FR7A 2KJCA 4M72A 3LA2A 5HISA 4KT5C 2GFKA 5ACRA 3MZYA 4G6QA 4EXYA 1W7PD 1S3JA 1ZG3A 1L0OC 3JTHA 4A5NA 2QQ9A 4R1HA 2M5WA 4A5MA 2XAHA 5FFZA 3P9IA 2HTJA 3ZWFA 1WKMA 4UVCA 2EA4A 4JK1X 1R1TA 3V7CA 4BHCA 3JSOA 2XHKA 3H3UA 3C7JA 4KMUX 3IEMA 4Q5SF 2DPUA 4ZYEA 1X8IA 5DCMA 1K6OA 2DPDA 4UAMA 4FX0A 3QU3A 1E17A 1HW2A 2NZEA 3T1BA 3F23A 1MZBA 2QZ8A 4L9TA 3HIFA 1XSXA 4M9SA 4EM2A 4XSXF 3M8FA 2IT0A 2DLLA 1QZZA 5K1YA 2BG6A 4ETSA 2BTNA 2Q2EA 1FZPB 1QH3A 2L54A 2Q0JA 3GWZA 2WRSA 5L3FA 1T38A 4YG2F 2V1UA 3RTRA 4D02A 1ON1A 2IW5A 2MH9A 1J9IA 4KA4A 1ZH5A 4NQ2A 5HLGA 2BE5F 2LKPA 3I14A 1W4MA 3SZTA 1JJTA 3ULQB 5HS8A 1FSEA 2ZFWA 5K4KA 4YIIA 3SHFA 1QO0D 1JXSA 2YZ3A 3CO7C 1NHAA 1J75A 4L0YB 4ZYHA 3HSEA 4RS8A 1H9TA 2JPBA 3DEUA 3I0VA 1HW1A 5FLXK 1O3SA 3IEKA 4F6ZA 4MQ9F 4L9VA 3K69A 3SZPA 3BPXA 2JRTA 4RGXA 2GIVA 5CLSA 1Y0UA 4ESBA 1K78A 5FGMA 3CLOA 2L4MA 2RDPA 2ISYA 4ZYGA 4I0AA 3CUQB 1HKTA 3CJNA 2UWMA 3X30A 4RB2C 5H6RA 2ESHA 3PG4A 3SD9A 4IRIA 3RPCA 2VONA 3DP7A 1KQ0A 1R22A 3F22A 3BK1A 3GW2A 1ZKPA 5D4SA 3HRTA 2G7UA 4G94A 1ZLJA 4LE6A 5D8LB 1O7FA 3E97A 1WQ2A 1BC2A 2Y8AA 5LGNA 3MEXA 1DDNA 4KEQA 2M30A 4O5VA 3L09A 2MBFA 2WYLA 1HSJA 4UWOB 1BN5A 2F5FA 1G6NA 2STWA 5K4NA 4WXCA 2VN2A 1B6AA 3RPQA 2RQPA 4BHBA 1WSUA 1AWCA 3J81Z 4IHTA 2I7VA 1G4DA 4RGSA 2L01A 5FO5A 4G7OF 4EJTA 4I2OA 5A0TA 4XLNF 1KU2A 2MLKA 4RB0A 4UVAA 2OD5A 5LHHA 4TZBA 3SFPA 1X8HA 2MD5A 3RYPA 1FP1D 3ZQ7A 2GA2A 2D45A 5D5VB 2XR1A 5TRDA 3M8EA 4ENNA 3QRFF 4GCVA 4CZZA 1R7JA 2A5YB 2EV0A 5DCFA 2QVOA 2CW0F 3ZNBA 1BIBA 1U5TA 1JT1A 4UV9A 2PN6A 1P4AA 3U1DA 2AIOA 3KP3A 2ZCWA 3PFIA 4MGRA 5CVVA 2E7XA 1D3YA 2QUFA 3PQJA 5LHIA 2H09A 1T6SA 1DDKA 5LLDA 4XLPF 2M5DA 3MAJA 2F5DA 3I53A 2DK5A 1FY7A 4NQWA 2QJSA 4AX0B 3CTAA 2P4ZA 1S29A 4C1FA 3TDZC 1KA8A 3R6SA 5HH6A 2KKOA 1QPMA 2K4BA 1K79A 4U7BA 1UCRA 5D6EA 2Z3YA 3HSFA 2MLGA 1F1ZA 3P7NA 1ODDA 1J5YA 5FQBA 2P5VA 2DK8A 4NQ4A 5LM6A 4Q48A 2LF8A 1P4WA 5HVQC 1LVAA 2VOOA 3DHAA 3ISPA 4MTDA 2YR2A 1H9GA 3WTSC 1MJAA 3QP6A 1OYWA 4BYYA 4HQEA 3FCZA 5B15A 4L18B 1Y44A 4ENMA 5CVIA 2CSOA 4IHSA 3R2UA 3HYIA 1SD5A 4RAWA 1P4XA 2UYXA 2Z5UA 2WYMC 2H6CA 3T3OA 4J5HA 4P9FA 3I13A 1KQ9A 3CO6C 5IT9K 3Q9VA 1HW5A 3Q6VA 4HL2A 1ZHFA 3G1PA 1XSVA 4HV6A 3G73A 2ZWRA 4D1TA 2L4AA 1SFEA 2ZNZA 3EDPA 5FB2A 2IJLA 5IQKA 2FU6A 3BV6A 4LD5A 2CWEA 2RN7A 3LVZA 3BZ6A 5ACWA 3K1PA 4GXOA 1I27A 3X2ZA 3FX3A 3EYIA 1XCBA 4HF1A 4WK8F 1ZG5A 3L2CA 4P96A 1BI1A 2OQGA 2QQAA 5K5QA 4UHTA 3QP5A 1J59A 3JSPA 1CF7A 2FM6A 1R1UA 4N9IA 1IXRC 1TQMA 4Z5ZA 3W6KB 3BDDA 4GGGA 3F8FA 1UHMA 4TZFA 1FOKA 5J8FA 1UHWA 1XCVA 4UNOA 3EETA 5E1XA 2GA1A 2K7LA 2Y75A 1HKQA 4GYQA 4L9JA 1KU7A 4OU0A 3ZMTA 5DD4A 2HKOA 2BG8B 1BJAA 3V8JA 1YYVA 2XV4S 2GWRA 4DIKA 1KYZA 4EJWA 1BIAA 3IOFA 4LLLA 3QPTA 3TO6A 5AHRA 2EFQA 3ZMUA 4ENKA 2ACJA 3GFJA 1UFMA 2DQLA 3NQOA 2FHXA 2VT3A 4HBLA 1S7OA 2L3DA 2IVMA 1P92A 1OR7A 3SFZA 3BP8A 4RAMA 3RKYA 3CUQC 4GO1A 2EFNA 3WGGA 4R79A 1VGNA 2BGAA 2BFZA 3ZN1A 2P6SA 2FNPA 1YW7A 2FMYA 3FMRA 2ZZIA 2HKXA 4LK1F 3E5QA 4PCQA 5D5XB 4AWXB 2YNUA 3ZR9A 3E6CC 1ZRDA 2XIGA 4RBSA 4G8XA 4ZH4F 5ACVA 3ZMDA 2AXLA 2FBIA 4OIQF 5HLHA 4AX1B 5ICGA 2VXZA 2OAZA 4M9ZA 3GVAA 2OZ6A 2GZWA 3AJ3A 2FXAA 4G7HF 3BC2A 5ERIA 4UVBA 1TW3A 3NEUA 2IRFG 2O0YA 4FX4A 5CYVA 3RKKA 1DPUA 4OMYA 2P6TA 2M1BA 1FNNA 4OOIA 1BOAA 1I5ZA 1W7PB 3TKYA 3KEOA 2Q8KA 4A0XA 2OHIA 3PY6A 1FX7A 4H0EA 1T2KA 3MD7A 4U7DA 4EVIA 1DUXC 2NYXA 2KJBA 4M73A 1YS6A 1J7KA 5LEJA 3QU6A 4WD6A 3T3NA 5DD8A 2PLYA 1P2FA 1XGSA 4EQQA 2RNJA 3NRVA 3AAFA 4RAZA 1WRAA 3DHCA 2NZFA 4D1VA 5ICCA 2HDCA 2W85A 4HDVA 1LDDA 3VEPA 4NQ6A 5AYAA 2Z9OA 3ZMSA 1QNTA 3LAPA 2A6HF 1L3LA 1SD6A 3IKVA 4AWZA 2CQKA 3J7AO 4C1HA 5E1ZB 2VODA 1S6LA 1ZTCA 1BVTA 2HOEA 2NRAC 2QINA 2WC2A 2P97A 3F6VA 1IN8A 3HRUA 2OA4A 1LJ9A 3GFLA 1L9YA 2QLZA 2EV5A 3A4YA 3S2WA 3ZN0A 5FQCA 3LSTA 3HOSA 4MEXF 4KEPA 1G3YA 2YNVB 4ZO2A 4JO0A 2FF4A 3MWMA 2X4HA 3OV8A 2D2WA 4G6DA 3TO7A 2FSWA 5CVJA 2EFOA 2BG2A 4KUMA 5AEBA 3WGIA 2E7WA 3GUDA 1KO3A 3VODA 4XSZF 1RUOA 2CFXA 3KZYA 1SD4A 1JHHA 2DOOA 5JR3A 4ENJA 1ZARA 2XAFA 4AIHA 2NNYA 2ZJ2A 2P7CB 2WWYA 1A7TA 2DW4A 1O7LA 3E3VA 1G3TA 5JFRA 4HL1A 3E5UA 1TTYA 1ZRCA 3F6OA 2XROA 2Z33A 2FA5A 1PP8F 2A3SA 2K86A 5HDGA 1ZG1A 3W6JB 2BC2A 3COAC 2GMNA 3K9TA 4M9XA 1XMKA 4D1WA 2KIFA 2MC3A 2OU2A 1OYYA 1ZREA 3M1EA 2Y87A 1YQAA 2C6YA 1JGSA 3I0TA 2DU9A 4YSLA 1WUPA 1PUEE 3HTUA 3T8TA 4N9HA 2YNTB 1BMCA 4XBFA 4CDGA 1RNLA 4HKYA 5JI6A 2KIUA 2ISZA 3RPUA 2AZ4A 1A8TA 2Y0MA 5LCAA 2I7TA 5LCFA 1Z05A 4ZO3A 1Z9CA 1USTA 3D0SA 2GFJA 4KMFA 4I7HA 2Q0IA 1G3WA 2BFKA 1FC3A 1OPCA 2DAOA 2GAUA 2YNWA 1XGMA 3R4KA 1IN4A 4XWWA 3ESHA 1R00A 3TQNA 4ESFA 3MFKA 1REPC 2O8XA 4WXHA 2XAJA 1KU3A 5ACTA 2AS5F 1JJEA 3LA7A 5D4RA 2JSCA 3HSRA 2LF7A 3LA3A 2ETHA 2G7HA 2IA1A 3T8RA 2P5LC 4XUKA 2QQBA 5LBQA 2HYGD 4Q4ZF 2R7FA 1TNSA 1F5TA 4FT8A 1LDKB 1GXQA 4TYFA 2FRHA 5D5WB 5ED4A 4WF2A 2F5CA 3VOEA 4Q47A 1FWZA 1XDSA 3DQVC 3DV8A 3J81K 4P55A 1LB2A 4BHPA 1R5HA 2ESNA 2ZBKA 3EQLF 2RGVA 2R2DA 1QQIA 2ADUA 3DF8A 1MKMA 4KYWA 3FM5A 2R3SA 4HF2A 5JHUA 3F9OA 5E8IA 2E1NA 4IF4A 1T0FA 3FWEA 1SMYF 4AIJA 4YSBA 4P5OA 2GQQA 1KO2A 2LDUA 3KL7A 1SFXA 3BPVA 2QBYB 3GFMA 3HHHA 4I98B 2VBXA 1WW1A 5A87A 5B3RA 4EGYA 3HHGA 1LQ1A 4WWCA 4Z60A 3MZHA 1IXSB 4CXFA 5AIQA 5BPIA 2RC4A 1CGPA 3I64A 1XMAA 1SD7A 3IRRA 1ZRFA 3L9FA 3JAMZ 3WTUC 3ML6A 3HTSB 1I1SA 3RI4A 2FQ3A 3GF2A 5L3BA 4HLXA 3I11A 3JXPA 2K4JA 1IAWA 2V1XA 2QM3A 2BR6A 2YPRA 1XN7A 5AXRA 3WU0A 2RKHA 5HDNA 3F3XA 3M7GA 1IF1A 4O98A 2W24A 2XASA 4YFKF 2OHJA 3GO5A 4Y15A 1XD7A 2G9WA 2RVCA 1PP7U 2Z99A 4G9YA 2FEZA 4TV7A 5LCHA 5HIQA 4B09A 3K1NA 3AF6A 4EYLA 3RKXA 5E1WA 3BJ6A 4U0WA 3V4GA 4CHUA 2L02A 1KR3A 2J5PA 3GLXA 4AIKA 1ZLKA 2DT5A 5ACXA 2NS0A 5ILUA 5ACPA 4OIOF 3LWFA 1B59A 2J5OA 5K5RA 3B02A 4YIFA 3KNSA 5HIPA 4MQVA 1HBXG 2CO5A 5DDGA 4GYUA 1IN5A 4CHLA 1VTNC 4G7ZF 5FQAA 3GX4X 1FYLA 1EV7A 3VFZA 2PJPA 1HSTA 3KNRA 1YG2A 3DPLC 2H94A 3I5UA 2FE3A 3F8MA 2NXAA 3X2YA 4M74A 4A6EA 4EYBA 5JVTA 4HX8A 5D5UB 2BG8A 3DXJF 1P6RA 1DXKA 2W57A 5ACSA 2HFHA 4ZZLA 4B87A 4OIPF 2FK6A 3E6DA 4IRGA 4JBAA 1DD6A 1ZGAA 4Z7RA 5ILSA 4A0ZA 2FU7A 2EB7A 2VBZA 2OHHA 5ACQA 4KN4X 5F1RA 3C3WA 3RKWA 1B1BA 1X3UA 4I09A 4KN7X 2OQRA 3K1MA 4CICA 2PMUA 1QGPA 1HQCA 1EH6A 1HKSA 1G3SA 4WX9A 2B0LA 1SMTA 4P62A 1TLHB 5HOOA 2HQNA 4O6JA 4TZEA 2EK5A 3IHUA 1FP2A 4FHTA 3D5LA 1K07A 1JE8A 3IWFA 3ZMVA 2GXBA 1MQOA 1I6XA 2EJRA 5EVDA 2M5CA 2HWVA 4PVOA 2ZMEB 2COMA 1KYWA 2IP2A 4GCWA 1IN6A 2NAZA 1FLIA 1STZA 4RGRA 1W7PA 5F6FA 3I59A 1BC8C 1BI2A 1RIOH 3QPHA 2PG4A 4UWPB 2RV8A 3O6BB 5KIKA 1USSA 4M71A 3N4MA 5LHGA 3WTZA 3ROUA 2HYFA 2Q42A 3F8CA 3IOGA 1GVJA 4UBQA 4HQMA 4ZZDA 5TJJA 3I15A 3KCCA 1CF7B 4BQAA 4S04A 4KIFA 3IE2A 1F9NA 3KLNA 1WRJA 5HLIA 3WU1B 2ELHA 3GZ5A 2BEOA 2XVCA 2VE8A 1ZAOA 3WE3A 2QYOA 3ABTA 1IXCA 1R23A 5HDKA 1ON2A 3MQ0A 5EEGA 2LSOA 4LFUA 4KNYA 5FD5A 4A12A 2QDSA 2V79A 3ZMZA 4QWQA 5CJ9A 1BC7C 4HX7A 1B9NA 2O3FA 3O2PE 2O61A 4C1CA 3P9CA 2PMHA 2FU8A 3H3EA 4WCGA 3ELKA 5K4MA 1BI3A 2WV0A 3F8NA 3IWZA 4PGGA 1D8KA 2Q9UA 2MH2A 2FBKA 2W25A 3IRQA 3FZVA 2BMIA 4EYFA 4U0VA 2UXXA 1RZ4A 3FM3A 4H0DA 1YO5C 1ZGJA 4U0YA 1W5TA 4IRHA 3KFWX 1YCFA 2BFZB 3DFGA 2A6EF 2XKPA 2I7XA 2F5EA 1MDMB 3P2UA 2DI3A 2EV6A 2HS5A 3R0AA 3L7WA 1ZN2A 3MCZA 2HTSA 1BM9A 3BOQA 1C0WA 1YW9A 3V7SA 1E5DA 2BBYA 1FBSA 2PFBA 2D1HA 5DUIA 4C1DA 1Q1HA 1S7AA 1K7AA 5EVKA 1XB4A 1QZYA 5H6QA 2BFLA 3E6MA 3HRSA 2XAGA 3L00A 1EH8A 2ZNYA 1MJ9A 1KQ8A 2NNNA 2V9VA 3Q9SA 1AOYA 4CYDA 3BJAA 4EY2A 2YU3A 2P4WA 4B8XA 3KP2A 3SXYA 5J6XA 1TNTA 2P1EA 3TOBA 4ON0A 5KK1A 3T5XA 3TGNA 2EFPA 2F2EA 3ADRA 5LMCA 2XKOA 4KICA 3J80K 4FSBA 5B1UA 2KIMA 3OOPA 4R8HA 3BWGA 5LLQA 2STTA 5EVBA 4A6DA 1O3QA 2P18A 4F7ZA 1TQIA 2JZYA 3IELA 3TO9A 4QLCU 4HV5A 2DO7A 2D1VA 4CGZA 4FEKA 2YNTA 2ZNBA 1XSDA 1YW8A 3J80Z 4OMZA 4L9NA 1IRFA 2E7YA 5DEQA 4A0YA 2A7MA 5A5ZA 2FBHA 2GKLA 2CYYA 4EJVA 2XAQA 1U5TC 5BS6A 3FMSA 3LQQA 4O3MA 4LJZF 3FXRA 3BK2A 3ECHA 2YX4A 1B9MA 3IE1A 1YLFA 1SAXA 1ONVA 4EM1A 1OMIA 4C1EA 3H3ZA 2DTRA 1KU9A 3CUQA 4ESJA 4LG0B 2GCUA 5EHTA 3SPUA 4IJAA 3EYYA 4HYEA 5A2QK 2EA2A 5DV5A 1Z6RA 5EW0A 5DPXA 4IVNA 1YCHA 1DPRA 3CDHA 4XRFA 3KZZA 4OIRF 2A68F 3ABUA 4KIBA 3ECOA 1LEAA 5L3CA 4J5FA 4XWTA 4KIGA 3RIRA 5FFXA 2H6AA 5A2QZ 4AD9A 2PQ8A 2DFIA 4RGUA 5ICFA 5H20A 5FD6A 3WTYC 4ZEJA 3ZQ4A 2FU9A 4LGWA 1U6GA 1Z6TA 2HZTA 4YFXF 2PEXA 3DKWA 2TDXA 5DCMB 3VB2A 4KDPA 4MNUA 1Z91A 1YTYA 2QWWA 4LB5A 3I4PA 4N0BA 2M8EA 4I01A 1PDNC 4BXUA 2HB9A 4Z5YA 2X0LA 2QBYA 2BV6A 2P8TA 5DUKA 2DKFA 1KGSA 2FMLA 1RUNA 5DYMA 5AXOA 2FOKA 5FLXZ 4Y13A 2VBWA 4UWSB 2VE9A 2K27A 1HXDA 1TW2A 3ERED 2Y48A 3JTGA 2DBBA 3T0YA 5CVUA 4F6HA 3FXUA 5EEHA 1XTOA 2CG4A 2IA2A 3HUGA 2XF4A 5LRSA 2GXGA 4HW0A 1R1VA 4EMSA 3C1DA 1FBUA 4RL2A 4HX4A 1F4KA 3JAMK 2IA0A 1K78B 5A0VA 1R5GA 2PI0A 5J8CA 1MGTA 2P7VB 4EXSA 1XGOA 2OZUA 3KETA 2OBPA 1QH5A 3ZP5A 6PAXA 4UWRB 2E1CA 4L5IA 1IZ1A 3WODF 5BOXA 3I54A 3WTWC 3LQRA 3PQKA 5HH4A 2Q0OA 1DP7P 4BZ3A 4C09A 3KLOA 5BMZA 1O57A 2W84A 1I1GA 4Z2YA 4PZJA 3FAIA 1SFUA 4RM5A 2EFWA 2EWNA 4I02A 5K0WA 3SW3A 3V8KA 2DQRA 4Z6XA 4LLGF 3E5XA 1W5SA 5LS3A 4E70A 1D8JA 1V3FA 4HAMA 4UUVA 3F72A 3KP6A 1IN7A 2VC0A 5AIPA 5L3DA 3SQNA 1D5VA 4I0BA 1R58A 1M2XA 1FT9A 3LFKA 3T9MA 1YFHA 1SMLA 3PY5A 4UA4A 2V1DA 3RKJA 3KP5A 2A61A 3HOTA 1XGNA 4YSKA 3KE2A 4MEYF 4V0HA 2HQRA 1XDUA 5CVRA 5D6FA 4IPAA 1B4AA 3DHBA 4TYTA 2PBIA 2CGPA 2WTEA 2IPQX 1P9EA 4DNCA 1RI7A 2HGCA 1VMEA 1WWXA 4EM0B 1Z1DA 1VJNA 1BBYA 1TQPA 1ZNBA 2BYVE 4TZ9A 3DH8A 3BY6A 3K2ZA 1U78A 4L5JA 1FBQA 4HOBA 1GHCA 1HLKA 2O03A 4PDKA 4Z67A 1U8RA 1J0RA 1FYMA 1U5TB 2VW8A 3AF5A 4ZYDA 4D1UA 4UV8A 2VC1A 3ZPLA 4LB6B 5E18F 3R0JA 2JPCA 2JT1A 2Y8BA 1T39A 3IC7A 2P5KA 2ZMEA 2ZO4A 1IW7F 5D8KB 5EH9A 2H6BA 3IDZA 2YSRA 4JQFA 3Q5FA 3RJPA 2A69F 3SRXA 4LK0F 1R36A 4DILA 2VT2A 1S8NA 5E20A 3E6BA 1IUYA 2FU4A 4U88A 4HA8A 2UXNA 5E17F 5LRRA 4DQ2A 2UZKA 5E8GA 5L3GA 1O3RA 1T98A 1QBJA 4NQ5A 4CO8A 5AHOA 5IT9Z 2YCBA 4M6XA 2BG7A 2O6GE 3GXOA 5IT3A 4S05A 4P9UA 3M9AA 1LNWA 1BI0A 1U3EM 2XRNA 3IL2A 5KVRA 3BJOA 2H27A 2ZKZA 4NHJA 2QEDA 5EV8A 2CBNA 5HS9A 3VQZA 4AVPA 3JW4A 3TOAA 4A2UA 3GFIA 1U2WA 4ZNBA 2V6CA 2HR3A 3IKTA 3V7RA 3V8LA 3EUHA 3RYRA 5HS7A 4NB5A 4ASNA 3KP4A 3WTXC 3O3KA 4BP0A 4HF0A 2NYPA 3WGHA 1H0MA 2XUBA 1IRGA 3B73A 1MD0A 3R60A 3QOPA 1LDJA 2QENA 1X8GA 4HLYA 5K5OA 4MHGA 5AONA 3G3ZA 3K0LA 4RB3C 1XM8A 5LE1A 1E2XA 4M6YA 1MDMA
chains in the Genus database with same CATH superfamily
4RB1A 1YIOA 1GXPA 2JTVA 1YCGA 2BHYA 3AG4H 1WH7A 2LNBA 1VF9A 4GYGA 4HNTA 1HF0A 2DN0A 3P9KA 1WUOA 2BGCA 4UXNA 2NVUB 3GYHX 4X0GA 4C1GA 4HRIA 4AVZA 3BROA 4L0ZB 3SZGA 2LLKA 4BNCA 3WE2A 3U9GA 1WJDA 1YS7A 1O3TA 4LMYA 4YIRX 1V5FA 4BY7J 1MMGA 3TDUC 3R61A 2GLOA 1LEBA 3I71A 5BPDA 3F8BA 3KEQA 4LG3A 5ICEA 3TP9A 4HZFA 3FHZA 2IGOA 2HZDA 3OYEA 5EV6A 4HDUA 4ZDPA 2FHXB 3HOWJ 3SBLA 1JKQC 4U4LA 5BQTA 3OYBA 3L6NA 2FNAA 1FPQA 4BH9A 2CJJA 4WXDA 3VYRB 4XOTA 4C3JJ 4NC6A 3I59B 1S5LC 5JLXA 1MJBA 4GDFA 2LY1A 1JJ8C 4RL0A 4OINF 3WG9A 1IO2A 2EIKH 2K02A 2MA3A 5F64A 3LAJA 3QPLA 3QAHA 1WI9A 3Q0VA 5DTDA 1WCMJ 4MTEA 4YFNF 5ILVA 5LGUA 5EWAA 2DYSH 3X2QH 2YNVA 5LSCA 1X3WB 1ZYRF 2YX7A 3L2QA 4PJ0C 1JT0A 3BQYA 3K4MA 1OKRA 3HRMA 1XC5A 1VFCA 4EJOA 1FIAA 3GZ6A 1UHSA 2GOMA 3WTTC 1E3PA 3FMQA 3X2XA 2VOPA 2M9HA 4LLNA 2NVQJ 3U2RA 3TBIA 3S16J 4BAYA 5E79C 1XX5A 3FF5A 4ANJA 2HEOA 3RDIA 3FXJA 4Y17A 4D0PA 1I39A 5L3EA 3HPGA 4KFCA 3F21A 2X6XA 2WYMA 5LGTA 2QDTA 2M45A 3CUOA 1TBXA 1UB9A 2WHGA 3FXQA 4GYIA 2KIQA 2R7DA 5LEKA 2YUSA 3ZQCA 3HOVJ 4D7NA 3IE0A 4HG2A 2DA2A 4EFZA 2OTJI 1ORKA 2KRFA 5JVGF 1V4RA 4K2EA 2A07F 4DIQA 3CD6I 3QH8A 2L7ZA 2M87A 3S0ZA 1PYVA 3H92A 2XGXA 2ZXJA 4U87A 4CH7A 3G1OA 1YHQI 3N97A 3OWTA 1G2HA 3I58A 3H3VK 2VBYA 3QYBA 4PGHA 3DPTA 4IHXA 2XGCA 3WXCA 2BIBA 5ACUA 1ULYA 3S93A 1A04A 4EV0A 3O8GA 3KYCB 4RAYA 5TGTA 4LG0A 2EH3A 4EJUA 1FYKA 4EGZA 1ETVA 3GEZA 3OR2C 4IXAA 1J2XA 4II3A 1FMVA 3C18A 3PO2J 3WTVC 2LMDA 3VPEA 2R0QC 1FSHA 5HIOA 4X6AJ 1JHFA 5KILA 2KMUA 4A3IJ 1OCTC 4PVTA 3WG7H 1OYIA 1EH7A 3KP7A 3SEQA 1Z7UA 4ABZA 4AWYB 5HH5A 3REOA 1I50J 1GUUA 2XDVA 4FR7A 2KJCA 4M72A 3LA2A 5HISA 4KT5C 2JJ7A 2GFKA 2KZVA 5ACRA 2FJ1A 3MZYA 4G6QA 4I6ZA 1JKRC 4EXYA 1W7PD 5K7HA 1S3JA 1ZG3A 1L0OC 3A4CA 3JTHA 4A5NA 2QQ9A 1SVMA 4BE1A 4R1HA 4B1RA 2M5WA 2R92J 4A5MA 3LSMA 2XAHA 5FFZA 3P9IA 2HTJA 3F0CA 3ZWFA 1WKMA 4BJTA 3MD2A 4UVCA 2EA4A 4DZPA 2OCEA 4JK1X 1R1TA 4JP0A 3V7CA 4BHCA 3JSOA 4XK4A 2XHKA 3H3UA 3C2BA 3C7JA 2TCTA 4KMUX 1VQ6I 3IEMA 4Q5SF 2K9NA 2DPUA 2L7KA 4ZYEA 3HDDA 1X8IA 1W36C 2LG4A 1XG1A 5DCMA 1K6OA 2DPDA 4UAMA 4FX0A 2WAQN 1V5GA 1WJ5A 3QU3A 1HW2A 1E17A 2NZEA 2H1LA 3T1BA 3F23A 1MZBA 2QZ8A 5AIJA 4L9TA 3HIFA 2R7RA 1UAAA 1XSXA 4M9SA 4EM2A 3K6GA 1Y8QB 2M7AA 5F0HA 4XSXF 3M8FA 4B3AA 2IT0A 2DLLA 1QZZA 5K1YA 2BG6A 3OMYA 1XMXA 3S1NJ 4ETSA 1D1CA 4BJ5C 5H2FC 4BL0B 3UKGA 1R4MB 2DJIA 2IAIA 2CS3A 2BTNA 2Q2EA 4JX5A 1FZPB 1QH3A 1RPWA 3H1CA 3CP8A 2L54A 2XB5A 3GWZA 2Q0JA 4C9YA 2WRSA 1A31A 5L3FA 1T38A 4YG2F 1IUFA 3RTRA 2V1UA 4D02A 1ON1A 2IW5A 4XR6A 1GLNA 4Y33A 4IHWA 3JRGA 2MH9A 1S7EA 2P0WA 1J9IA 4KA4A 3ABLH 1ZH5A 4NQ2A 2HNHA 5HLGA 1YJ9I 3OY9A 2BE5F 2LKPA 1T8IA 3I14A 1W4MA 2PJRB 3SZTA 2DDBA 1JJTA 3WU2C 3HOYJ 3ULQB 3FKJA 1VQ8I 3DU5A 5HS8A 1FSEA 2ZFWA 5GADJ 5K4KA 3KZIC 4YIIA 4XMYA 3SHFA 1QO0D 1JXSA 1NG6A 2YZ3A 1LFUP 4H4KC 3CO7C 2Y9YA 1NHAA 1J75A 1ERDA 3JRCA 4ZYHA 4L0YB 3HSEA 4RS8A 5IOZA 5M5XJ 1H9TA 2JPBA 3DEUA 3I0VA 1HW1A 5FLXK 1O3SA 3GCMA 3IEKA 4F6ZA 2CFOA 3M8JA 1MMSA 4Y52J 4MQ9F 3KX2A 1K61A 4J00A 4L9VA 3K69A 3SZPA 2JQ7A 3BPXA 1OQYA 2JRTA 2JA8J 1OLTA 4RGXA 2GIVA 5CLSA 1MBJA 5B1AH 3U1KA 1R71A 2VLAA 1Y0UA 4ESBA 1K78A 1VI0A 5FGMA 1WJEA 2L4MA 3CLOA 1YRNB 2RDPA 2ECBA 2ISYA 3A02A 4I0AA 3CUQB 4ZYGA 1HKTA 2X6OA 1P7JA 1RKWA 2DJNA 4G6TB 2CUJA 3E1SA 3KYLA 3CJNA 2UWMA 3X30A 3FISA 4RB2C 4D5CA 4CCKA 5H6RA 5B5EC 2ESHA 3PG4A 2CW7A 2FOWA 1Y1VJ 3I4MJ 3SD9A 4IRIA 3RPCA 2VONA 2KDZA 3DP7A 4PJNA 4RMNA 1KQ0A 2JSPA 1R22A 3CCEI 3A0BC 3CMYA 3F22A 2DOEA 3BT9A 3S32A 1K4SA 3BK1A 1GDTA 3GW2A 1ZKPA 5D4SA 3HRTA 2G7UA 4G94A 1YIJI 1ZLJA 4LE6A 2K40A 5D8LB 2CV1A 1O7FA 3E97A 1WQ2A 1BC2A 2Y8AA 5JLWA 3IV5A 2L0KA 1X4OA 4KJZA 2E1MC 5LGNA 2HPIA 1OCPA 3MEXA 2BY2A 1DDNA 4KEQA 2M30A 4O5VA 3L09A 3CCUI 2E5ZA 2JUCA 3OIPA 2MBFA 1U9OA 3CC2I 2QEXI 2WYLA 1HSJA 1D0YA 1FOWA 3ZQGA 4UWOB 2RNGA 2F5FA 1G6NA 1BN5A 1HDDC 2STWA 4YELA 3JRAA 2QF7A 5K4NA 4WXCA 2VN2A 1B6AA 2Y30A 2VQLA 2RQPA 3RPQA 3VYUB 4BHBA 1WSUA 4PJLA 1AWCA 3J81Z 4IHTA 2I7VA 1G4DA 4RGSA 5FKOA 3A2KA 2L01A 3GMEA 5FO5A 4G7OF 2M8GX 3EUHC 3JRIA 2KT0A 4EJTA 4I2OA 5A0TA 3ERMA 3N05A 4XLNF 1KU2A 2KP6A 2MLKA 4BU2A 3CC4I 4RB0A 4PUSA 4UVAA 2OD5A 5LHHA 4TZBA 3SFPA 1X8HA 3JRBA 2MD5A 3RYPA 2HPMA 1FP1D 3ZQ7A 2GA2A 2D45A 2V7FA 5D5VB 2XR1A 1X1CA 4B47A 3K4BA 1X58A 1K4TA 5TRDA 1X1DA 3M8EA 4ENNA 3ABMH 3QRFF 2HQ5A 1TT5B 4GCVA 4CZZA 1SVOA 1W1WE 1R7JA 2A5YB 1AKHB 2EV0A 2LP0A 5DCFA 1MBKA 5F04A 2QVOA 2CW0F 3ZQFA 3ZNBA 2EQRA 1BIBA 1U5TA 2IBDA 2QCOA 2R4GA 2YS9A 4UV9A 5CQGA 1JT1A 1OJLA 1P4AA 2PN6A 3U1DA 2AIOA 4BE0A 1HLVA 3BR5A 3KP3A 3H0GJ 2ZCWA 1WJBA 3PFIA 4MGRA 5CVVA 1OFCX 2E7XA 1D3YA 3SDGA 2QUFA 3PQJA 3LMMA 5LHIA 2H09A 1T6SA 1DDKA 5LLDA 4XLPF 3S3MA 2M5DA 3MAJA 2R93J 2F5DA 3I53A 2DK5A 5IP6A 5F27A 1FY7A 4NQWA 2QJSA 4AX0B 3BG9A 2L9NA 3CTAA 2NS7A 3H5RA 2P4ZA 1S29A 4C1FA 3TDZC 1KA8A 2ICWG 2XGDA 3R6SA 3FXMA 5HH6A 2KKOA 1QPMA 2K4BA 1K79A 4U7BA 1B72A 3OYIA 1UCRA 5D6EA 2R5YB 1H89C 2Z3YA 1OCOH 3HSFA 2MLGA 1F1ZA 2K5CA 2QKMB 3P7NA 1ODDA 1YX5A 4HSTA 5DM6F 1J5YA 5FQBA 2VXDA 2P5VA 2BW3A 2DK8A 4NQ4A 5LM6A 4Q48A 2LF8A 1GVDA 2WAQA 1P4WA 5HVQC 3VWBA 5EG0B 3W2VA 1LVAA 3S2DJ 2VOOA 3DHAA 3H9QA 3ISPA 1Z3YA 4MTDA 2YR2A 9ANTA 1H9GA 3WTSC 1TC3C 1MJAA 3FDYA 3QP6A 2O8KA 4AV7A 1OYWA 4BYYA 4XN3A 3I55I 4HQEA 2YHEA 3FCZA 2IS6A 5B15A 4L18B 4MO7A 2L7FP 1Y44A 4ENMA 5CVIA 3G71I 3QYEA 3CF5F 2FD5A 1Y0NA 1MNDA 2CSOA 4C2MJ 2MW8A 2GXAA 4IHSA 2M7BA 2JA7J 3M3YJ 2VJJA 3R2UA 3HYIA 1SD5A 3BG3A 1JTYA 4GRIA 4RAWA 1P4XA 2CW8A 2Z5UA 2UYXA 3IH3A 2WYMC 2H6CA 3T3OA 4J5HA 4P9FA 3I13A 1KQ9A 3CO6C 3CCLI 5IT9K 3Q9VA 1HW5A 4N4OB 1Y1WJ 3Q6VA 4HL2A 1ZHFA 3G1PA 1XSVA 4E4HA 1VQMI 4HV6A 1RR8C 3G73A 2ZWRA 4D1TA 2L4AA 1A6QA 1SFEA 2ZNZA 3EDPA 3HEFA 5FB2A 2IJLA 5IQKA 1Y56A 2FU6A 2H1KA 3BV6A 4LD5A 2CWEA 3BCBA 2RN7A 2VI6A 3LVZA 3BZ6A 5ACWA 4E7HA 3K1PA 4GXOA 4RAGA 3PIPF 1NK2P 1I27A 3X2ZA 3D5RC 1LFBA 4FQGA 4BXFA 3FX3A 3EYIA 3HZJA 1WPKA 1LE8B 1XCBA 4XORA 4HF1A 2KQRA 3H5AA 2VUMJ 4WK8F 1ZG5A 3L2CA 4P96A 1BI1A 2OQGA 2VKVA 2QQAA 5K5QA 3PUBA 2W00A 4UHTA 3QP5A 1J59A 3JSPA 4F3QA 1CF7A 2FM6A 1JTXA 1R1UA 4N9IA 3A01A 1IXRC 1TQMA 1ETQA 4Z5ZA 3W6KB 3BDDA 4GGGA 3JRDA 2QA4I 4XKCA 3F8FA 1UHMA 1K83J 3J7AY 4TZFA 1TWFJ 3GTLJ 1FOKA 5J8FA 1UHWA 1XCVA 2ID6A 4RDUA 3J7YJ 5J4YA 3EETA 5E1XA 3K7AJ 4UNOA 2GA1A 2K7LA 2Y75A 1HKQA 3K2AA 2LBFB 4OAYA 4L9JA 4GYQA 2BY0A 1KU7A 2KRHA 4OU0A 1Z67A 2WB1N 3ZMTA 5DD4A 2M4KA 2HKOA 2BG8B 3GTPJ 1ZKGA 1BJAA 2DOFA 4N4NB 1YYVA 3V8JA 1Z77A 2XV4S 4DGWB 2GWRA 2DXIA 1JI8A 4DIKA 1KYZA 2O7OA 4EJWA 3OS2A 1BIAA 3IOFA 4LLLA 4FCYA 3ONQA 2R7UA 3ZXSA 3MKYB 2W1OA 3MVPA 2UV1A 2LKSA 3QPTA 2DOAA 3TO6A 2EFQA 5AHRA 1YOVB 3ZMUA 4ENKA 2ACJA 3GFJA 1UFMA 2DQLA 3BTJA 3NQOA 2V9KA 4UUSA 1ETKA 2FHXA 3H35A 2VT3A 4HBLA 1S7OA 3TMOA 4AYBN 2L3DA 4UUTA 1Y6IA 2IVMA 1P92A 1D1AA 1OR7A 3SFZA 3K70D 2HQAA 2EBIA 1ACIA 3BP8A 2VJ4A 1ZQ3P 1WJAA 4RAMA 3RKYA 3CUQC 4GO1A 2EFNA 3WGGA 3HGGA 4R79A 1VGNA 2BGAA 3C2HA 2DA4A 2JN6A 2BFZA 3ZN1A 2P6SA 2FNPA 1LUJB 1YW7A 2FMYA 1Z0XA 3FMRA 3O8HA 2ZZIA 2HKXA 4LK1F 3E5QA 4LIUA 3L1PA 2E35A 4MIMA 4PCQA 3CCYA 5D5XB 1X3ZB 1I6HJ 4AWXB 2YNUA 3ZR9A 3E6CC 1ZRDA 4IKFA 2XIGA 4RBSA 4G8XA 4ZH4F 1R49A 5ACVA 3ZMDA 2AXLA 3OYHA 2FBIA 4I76A 4OIQF 5HLHA 3S2HJ 3ZCOA 2E1MB 4AX1B 5F0FA 5ICGA 2VXZA 3CCMI 2OAZA 2K9LA 2L9VA 3BTIA 3GVAA 4M9ZA 4CCJA 2EZHA 5M5WJ 1QHGA 3DCFA 3PSIA 1NG7A 2OZ6A 2D5VA 2GZWA 3AJ3A 3PSFA 2FXAA 4G7HF 1GV5A 3BC2A 5ERIA 4UVBA 3PJRA 1HOMA 5GPCA 1TW3A 3NEUA 1W5CC 2IRFG 4YRVA 2O0YA 2VB6A 4FX4A 2XRLA 5CYVA 3RKKA 1DPUA 4OMYA 2P6TA 2ZXIA 4XLEA 2M1BA 1FNNA 1MW7A 4PFPA 4OOIA 4BGDA 1BOAA 1I5ZA 4XONA 1W7PB 2CU7A 2R7WA 3TKYA 4E7ZA 3KEOA 2Q8KA 4A0XA 1QPIA 2OHIA 5FKLA 2XGEA 1ETXA 2AQEA 2DA1A 1FX7A 4H0EA 3PY6A 4BKXA 2DT7B 2ZSIB 2JA2A 1T2KA 3MD7A 4U7DA 4EVIA 2DTZA 1DUXC 5EF6A 2Y69H 2NYXA 2KJBA 2R7ZJ 2NOGA 4M73A 1YS6A 1J7KA 5LEJA 3QU6A 3B6AA 5FKKA 5J47A 4ZDOA 4WD6A 1D1BA 2LVSA 3T3NA 2R7OA 5DD8A 3LSRA 2L7MP 5CPRB 2PLYA 3GTMJ 1P2FA 1XGSA 3PO3J 5HNHA 4EQQA 2DFHA 3AKZA 3G6EI 2RNJA 3NRVA 3ZRGA 3AAFA 3MKWB 4RAZA 2AXTC 1WRAA 3DHCA 2BY1A 2KL4A 2NZFA 4D1VA 4M6VA 2QGUA 5ICCA 2HDCA 3VDXA 2W85A 3I3LA 4ZC3A 4HDVA 1LDDA 3VEPA 4EATA 3LNQA 1X1PA 4NQ6A 3G1LA 2CUFA 5AYAA 1MMNA 2Z9OA 3ZMSA 1LVKA 1QNTA 3LAPA 2A6HF 1L3LA 1SD6A 3IKVA 2AHQA 3OYJA 4AWZA 3OYCA 2CQKA 2WAFA 2UUZA 3J7AO 4C1HA 5E1ZB 2QSHX 2VODA 2A05A 2CUZA 2FUG2 4Y7NJ 1S6LA 1ZTCA 1BVTA 4A3EJ 2CQQA 2HOEA 2NRAC 2QINA 2WC2A 2P97A 3F6VA 1IN8A 3HRUA 2OA4A 1WVRA 4DYCA 2M3AA 1LJ9A 3GFLA 1L9YA 4JYKA 3FK7A 2QLZA 1PUFA 2EV5A 3A4YA 3S2WA 3S1MJ 2VL8A 3ZN0A 4IHVA 3DBLB 3DPUA 5FQCA 3LSTA 3FHNA 3HOSA 4MEXF 2HU9A 4KEPA 2YU9J 1G3YA 3OYDA 2YNVB 4XLCA 4ZO2A 4JO0A 2FF4A 2QKLB 3CJTB 3MWMA 2X4HA 5F08A 5FRMA 3OV8A 2D2WA 4W1UA 3HB9A 4G6DA 1QVUA 3TO7A 4A69C 2XAUA 5B3SH 1IG7A 2FSWA 4UB6C 3TEDA 5CVJA 2EFOA 2BZTA 2BVMA 4KUMA 2BG2A 3RQIA 3SDBA 3WGIA 5AEBA 2E7WA 2PJRA 1JUMA 3OS0A 2V1NA 3GUDA 1KO3A 4MLOA 3VODA 4XSZF 1RUOA 4F91B 2CFXA 3K70C 4IO9F 3KZYA 3OYAA 1SD4A 1D0XA 1JHHA 2L9SA 3K4KA 2DOOA 5JR3A 1M1EB 4ENJA 1ZARA 2JVHA 2XAFA 3BG6A 4AIHA 2NNYA 2ZJ2A 1LFPA 1Z7LA 2P7CB 2WWYA 3S1QJ 1HC8A 3SJMA 1A6IA 1A7TA 2DW4A 1O7LA 1E0EA 3E3VA 1G3TA 2LREA 4ZJZA 5JFRA 4FE4A 1BJZA 3OYGA 4HL1A 2L2OA 5J1YA 5IYCJ 3E5UA 1TTYA 4XRMA 2EILH 1MIJA 2LK2A 2WBMA 3OIOA 4E6KG 3F6OA 1ZRCA 3BZCA 5C4JJ 2XROA 2Z33A 2V6EA 2FA5A 2EINH 1PP8F 2RAEA 4IOCF 2A3SA 2WB1A 2RREA 1YRNA 2K86A 2LR8A 2NS8A 5HDGA 4KISA 1ZG1A 1X4PA 2FQ4A 3K4NA 3W6JB 2E19A 2BC2A 3COAC 3DKXA 2GMNA 2XSJC 3K9TA 4M9XA 1XMKA 4D1WA 2KIFA 2MC3A 2OU2A 4XOPA 1ZGWA 3AL0C 1OYYA 5E3NA 1ZREA 5E3LA 3M1EA 2Y87A 2E34A 4J19A 1YQAA 2C6YA 1JGSA 4GFBA 1TWCJ 3I0TA 3ZQIA 2DU9A 1HCRA 4YSLA 1WUPA 1DU0A 1PUEE 1P9QC 3HTUA 3T8TA 4N9HA 2JA5J 1QVTA 1RC9A 2K3FA 2Y0SN 4AYBA 5FLVA 1BMCA 1ZR2A 2YNTB 3OYFA 4XBFA 4CDGA 1RNLA 2DFFA 3U21A 5JI6A 1SC7A 4HKYA 4F55A 2KIUA 2ISZA 3RPUA 1VQNI 4IOAF 2K9QA 2AZ4A 1A8TA 1H88C 1EJ9A 2Y0MA 4BJ6C 5LCAA 2I7TA 5LCFA 1Z05A 4ZO3A 1Z9CA 1USTA 3D0SA 2GFJA 2R7TA 4KMFA 4I7HA 3BG5A 2Q0IA 1G3WA 2BFKA 1FC3A 3OSGA 1OPCA 1TWHJ 2HDDA 2KISA 4CCMA 2DAOA 1IRZA 4XL9A 1SEUA 2GAUA 2YNWA 1XGMA 3R4KA 1IN4A 3JR9A 1AU7A 1IV6A 4XWWA 3ESHA 1R00A 3TQNA 2ZMEC 4ESFA 3MFKA 1REPC 3NWTA 2O8XA 4WXHA 2XAJA 1KU3A 5ACTA 4C3IJ 1JUPA 1FIPA 2AS5F 1JJEA 3LA7A 5D4RA 2JSCA 3HSRA 2MABA 2LF7A 3LA3A 2XF6A 2ELJA 3S8PA 3C2GA 1VQ5I 2ETHA 2XSDC 2M4GA 2G7HA 2IA1A 3T8RA 2E1OA 2P5LC 5LD2C 4XUKA 2QQBA 4KT6A 2DMPA 2GOXB 5LBQA 2HYGD 1HA8A 1ZK8A 2AQFA 4Q4ZF 2R7FA 1TNSA 4DBRA 1F5TA 3QPSA 3S3NA 4A3BJ 4FT8A 1LDKB 1GXQA 5GAHJ 4TYFA 2FRHA 5D5WB 5ED4A 4WF2A 3DTEA 2KFDA 2F5CA 3VOEA 3K4LA 1U8BA 4Q47A 1MBHA 3M4OJ 1E3OC 2ZXWH 5IY5H 1FWZA 1XDSA 3OYKA 3DQVC 3DV8A 4B4CA 3BTCA 3J81K 4P55A 5DS9A 2CV0A 2CG2A 1LB2A 4M3GA 4BHPA 1APLC 1R5HA 2ESNA 2MFZA 2ZBKA 2XB0X 3EQLF 2RGVA 4PSXA 2R2DA 1N25A 1QQIA 4RLQA 2ADUA 2LC2A 3DF8A 5M3FJ 4BXXJ 4IEJA 1MKMA 1WJFA 4KYWA 3FM5A 2R3SA 2A6TA 2VASA 4HF2A 5JHUA 3F9OA 5E8IA 2E1NA 4IF4A 2HOSA 1T0FA 3FWEA 1G8XA 1DU6A 3H0DA 1SMYF 4V2GA 4AIJA 2CUEA 2WY7Q 4YSBA 5HLTA 4P5OA 2GQQA 4M3EA 1KO2A 2LDUA 3KL7A 3Q0WA 1SFXA 2R5YA 2VIXA 3BPVA 4P1WA 2QBYB 3IAS2 3LSJA 5KNLA 2IS1A 3GFMA 3HHHA 4XKBA 2R5ZA 4I98B 3PIOF 2VBXA 3DLLF 1WW1A 5A87A 5B3RA 3FK6A 4EGYA 3HHGA 5GP9A 4WWCA 1LQ1A 4Z60A 3MZHA 1IV8A 1IXSB 4CXFA 5AIQA 1S9HA 5BPIA 2RC4A 1CGPA 3I64A 1WI3A 1XMAA 1SD7A 3IRRA 3ASNH 5EG0A 1ZRFA 3DWLE 3L9FA 3D5SC 3JAMZ 2BXYA 3QYFA 3WTUC 3ML6A 3HTSB 5B1BH 2X6WA 1I1SA 4C30A 3RI4A 2FQ3A 1D5YA 3GF2A 5L3BA 4HLXA 3I11A 3JXPA 1VNDA 2K4JA 1IAWA 2V1XA 2QM3A 2BR6A 1WJCA 2YPRA 1XN7A 3GTGJ 5AXRA 2BY3A 3WU0A 2GBYA 5GTIC 3FKIJ 3HUGB 2RKHA 4JX4A 3SEZA 5HDNA 3F3XA 2OCCH 3M7GA 1IF1A 4O98A 2EZIA 3A0HC 2W24A 2XASA 4BEHB 4D1QA 4YFKF 2Z2SB 3CMEI 4MFEA 2OHJA 3GO5A 2EZKA 2F5VA 1XD7A 4Y15A 2G9WA 2RVCA 1PP7U 2Z99A 3AG1H 4G9YA 2FEZA 2JVGA 3HOXJ 4TV7A 5LCHA 5HIQA 4B09A 1A36A 3K1NA 4NC8A 3AF6A 4EYLA 3RKXA 1KONA 5E1WA 3BJ6A 3H9JA 4CYCA 4U0WA 2W82A 1TP4A 1IDYA 2OPTA 2XPUA 2R7VA 3ESWB 3V4GA 4CHUA 2L02A 1R4NB 3BR3A 1KR3A 3L2VA 3CCSI 1BW6A 2J5PA 3GLXA 4AIKA 4X1EA 1ZLKA 3W2AA 2DT5A 5ACXA 3LFUA 2HXIA 2NS0A 3E0JB 5ILUA 3W2WA 5ACPA 4OIOF 3CCQI 3LWFA 1B59A 5JHFA 2CQXA 2J5OA 5K5RA 3B02A 3OYMA 4YIFA 3AFHA 3KNSA 4BUPA 1F36A 5HIPA 4MQVA 2DA6A 1HBXG 2CO5A 2F48A 5DDGA 3I56I 4GYUA 4CUGA 2OJED 2I5UA 1IN5A 5J4VA 4CHLA 1TWAJ 1VTNC 4G7ZF 2A5WA 3A03A 4AIDA 3CESA 5FQAA 3GX4X 1FYLA 1EV7A 3SYTA 2BHZA 3VFZA 1UG2A 4LITA 1HSTA 2PJPA 3KNRA 1N78A 1YG2A 3DPLC 2H94A 2N8GA 5K7ZA 3I5UA 2FE3A 3F8MA 1ITYA 2NXAA 2DYRH 4BDYA 3X2YA 4M74A 4E7KA 4ZTJA 1EKEA 1BOBA 4A6EA 1VQKI 5JVTA 4EYBA 4HX8A 5D5UB 2DMUA 3I4NJ 2BG8A 3DXJF 1FJLA 1P6RA 2OUMA 3WHCA 2ZXHA 1VQPI 1DXKA 2W57A 4D9JA 1ENHA 4ITVA 3HOUJ 5ACSA 2HFHA 2KPMA 4ZZLA 4E7IA 4B87A 2E2IJ 4OIPF 1GT0C 2Y0SA 3HXLA 2FK6A 2CG3A 2B63J 3E6DA 3VSKA 4IRGA 4JBAA 1DD6A 1ZGAA 5FKNA 2JUGA 4Z7RA 5ILSA 3K4CA 4A0ZA 1POGA 1OCZH 3MZ8A 1LPQA 3G2BA 2FU7A 3JRFA 2EB7A 2VBZA 3OR1C 2OHHA 3AL0B 5KHDA 4BACA 5ACQA 1B72B 2HOAA 4KN4X 4HNVA 5AJLA 4C2TA 5F1RA 3C3WA 3RKWA 1B1BA 1X3UA 4I09A 4KN7X 2EPFA 2OQRA 3K1MA 4CICA 2PMUA 1QGPA 3LSIA 1CQTA 1EH6A 1HQCA 1WFXA 1HKSA 1UMQA 1G3SA 1G59A 4CCNA 1IRXA 3M1CA 3FBNB 4WX9A 2B0LA 1SMTA 5HODA 2Q1ZB 1TLHB 5HOOA 2HQNA 4O6JA 1BA5A 4P62A 1SANA 4B3XA 3HOZJ 1QRYA 4B44A 4TZEA 3OL4A 1UG0A 2IGNA 2EK5A 3BR0A 3IHUA 3PM1A 1FP2A 3FXKA 4DZJA 4NUBA 4FHTA 1NTCA 3D5LA 4AU7A 2ME0A 4ZDLA 1K07A 1JE8A 4B48A 3IWFA 3ZMVA 4QIWN 3BR2A 5IP7J 2GXBA 5GAGJ 1MQOA 2Z16A 1T33A 4E7JA 2F6CA 1I6XA 2EJRA 5EVDA 2M5CA 2O9LA 2HWVA 3TW7A 1MSEC 2XPVA 4PVOA 2X1CA 4LIVA 1XTAA 2ZMEB 2COMA 1KYWA 5GPAA 2DMQA 5KCMA 2IP2A 3OSFA 4GCWA 1IN6A 1MBFA 2NAZA 1FLIA 1STZA 5IYDJ 2GIZA 4ZYAA 4RGRA 4A3JJ 1W7PA 1AHDP 5F6FA 3I59A 3BZKA 1BC8C 1IDZA 5TISC 1BI2A 1YX3A 1RR7A 3F9KA 1RIOH 3CQZJ 3LSHA 3BC8A 3QPHA 1T56A 2PG4A 3CCVI 4UWPB 2O5RA 2OC6A 2MC4A 2RV8A 4F92B 2QSFX 3O6BB 1BL0A 2BOLA 5KIKA 1USSA 2X1EA 2QSGX 3B6CA 4XLFA 1YJWI 3H9GA 4G12A 4M71A 3N4MA 3H5NA 5LHGA 2VQGA 3WTZA 3ROUA 1YITI 1N77A 5CQEA 2HYFA 5LFAA 3M07A 2Q42A 3W6VA 1QA6A 3F8CA 3IOGA 1GVJA 4UBQA 4HQMA 4ZZDA 5TJJA 5GTHC 4IL6C 3CMMA 4PFOA 4DBQA 3I15A 3KCCA 1CF7B 5KAIC 4NURA 4BQAA 4S04A 4KIFA 4II2A 3UR3C 3IE2A 1F9NA 3KLNA 2TRTA 1WRJA 5HLIA 3WU1B 2ELHA 4Y4RA 1JJ6C 3GZ5A 2BEOA 2XVCA 2VE8A 1ZAOA 5EGOB 3WE3A 2QYOA 3ABTA 2EIJH 1IXCA 1ZELA 2MGQA 1R23A 2WA0A 3TP0A 5HDKA 1O4XA 1ON2A 1K6YA 3MQ0A 5EEGA 2LSOA 4LFUA 4KNYA 4E7SA 5FD5A 4A12A 2MYSA 2QDSA 2V79A 3VPRA 3HM5A 3ZMZA 5M3MJ 4QWQA 5CJ9A 1BC7C 2L5QA 3KEYA 4HX7A 4C3HJ 1B9NA 2O3FA 3O2PE 2O61A 1RKTA 4PSWA 1TWGJ 3ZQHA 4C1CA 3P9CA 2PMHA 3HKZA 2FU8A 3H3EA 3ABKH 2PMZN 1B8IB 3DTIA 3ELKA 4WCGA 3G4SI 1MBEA 5K4MA 1BI3A 1X1BA 1XPXA 2WV0A 3W3CA 4FTHA 3F8NA 3IWZA 4FE7A 4PGGA 2HDWA 4RM2A 2HI3A 4UUSB 1X1AA 1D8KA 2ID3A 2Q9UA 2MH2A 2FBKA 4OWRB 2W25A 4DOZA 3IRQA 3FZVA 2BMIA 4EYFA 3LSGA 2X6YA 5J40A 4U0VA 1JGGA 1BR2A 2UXXA 3SFIA 1RZ4A 3FM3A 3G1MA 2R7SA 1R9TJ 4H0DA 1YO5C 1ZGJA 3BQZA 2IGKA 2L9RA 1W5TA 3IUOA 4IRHA 3KFWX 4U0YA 1YCFA 2BFZB 3DFGA 2A6EF 2XKPA 1WH5A 4BS9A 3MMYB 5EZGA 2I7XA 2MD0A 2F5EA 3EPZA 2LRDA 1MDMB 3P2UA 2DA5A 3UNGC 2DI3A 4Z6YA 2EV6A 2HS5A 2JWTA 3R0AA 4XLAA 4HEA2 2EIMH 3L7WA 1ZN2A 3MCZA 2HTSA 1BM9A 3BOQA 1C0WA 1YW9A 2E2JJ 3V7SA 1U9NA 1VQ4I 1DGWY 1I3AA 1E5DA 5F1JA 4BE2A 3RZDJ 2BBYA 1FBSA 4Y3OA 2PFBA 2D1HA 5DUIA 4C1DA 5EJCA 1Q1HA 1S7AA 2BVLA 1K7AA 5EVKA 1XB4A 1QZYA 5H6QA 4QPQA 2V4JC 2BFLA 3E6MA 1IJWC 4A3MJ 3HRSA 2NVYJ 2IEKA 2XAGA 4A3FJ 3L00A 1EH8A 2ZNYA 1MJ9A 1KQ8A 2NNNA 2V9VA 1Z21A 3Q9SA 1MNEA 1A5JA 1AOYA 4CYDA 3BJAA 3CCRI 4EY2A 2DMNA 4NC7A 2YU3A 2P4WA 2X48A 4B8XA 1ZR4A 3KP2A 2W48A 3SXYA 2BXZA 4KITB 1Q1VA 1UZCA 1TNTA 5J6XA 3CCJI 4BBRJ 4IX7A 4ZTFA 4A93J 1VQOI 2P1EA 2HOTA 3TOBA 4ON0A 1I3QJ 2COBA 5KK1A 4JX6A 3T5XA 3TGNA 2EFPA 3CJQB 2F2EA 3ADRA 3ZR8X 3MKZA 3PL8A 5LMCA 1T0FC 1U0JA 1OCCH 2XKOA 4FETA 4KICA 4D5FA 4LOCA 3J80K 3IAM2 5HNFA 4FSBA 1Z3XA 2CQNA 5B1UA 3DU6A 2V26A 3VSLA 3S17J 2KIMA 1ETOA 1MNMC 3OOPA 4R8HA 1ETYA 5FRNA 3BWGA 3P5JA 5EZHA 2WAEA 1KZHA 1W0UA 5LLQA 3NAUA 2STTA 5EVBA 4A6DA 3FXOA 4CSWA 2DT6A 1O3QA 4D7MA 1TQIA 4F7ZA 2JZYA 2P18A 3IELA 3Q3SA 3TO9A 3HPHA 4HV5A 2DO7A 2D1VA 3TW6A 4QLCU 4CGZA 2YNTA 2ZNBA 5FJ8J 4FEKA 1XSDA 3HJEA 1YW8A 4PJJA 3PUFA 2ME6A 1T95A 3OIQA 3DBHB 3J80Z 4OMZA 4XNFA 4L9NA 3HL2A 1IRFA 2W4SA 5EEAA 2E7YA 5DEQA 2IS2A 5KAFC 3VYTB 3OL3A 4A0YA 3GTKJ 2A7MA 5A5ZA 2JA6J 2FBHA 2CV2A 2PX9A 2X85A 2GKLA 2CYYA 4EJVA 2XAQA 1U5TC 5BS6A 3FMSA 3LQQA 4O3MA 2ZSHB 1AA7A 4LJZF 3FXRA 1R5ID 3BK2A 3FBIB 1D0ZA 3ECHA 2YX4A 4HSRA 4BQQA 1B9MA 3BCAA 3IE1A 2XPWA 1FOXA 3CZ6A 3VYSB 1MSFC 3JREA 1JKOC 1YLFA 1SAXA 2HVSA 3DKYA 1ONVA 4EM1A 1OMIA 4C1EA 3H3ZA 5J3LA 2DTRA 1V55H 1KU9A 3CUQA 4ESJA 4LG0B 1TL8A 2GCUA 5EHTA 3SPUA 2G0EA 4IJAA 1T08B 5IYBJ 2EZLA 2NXNB 1X2NA 2JMWA 3EYYA 2EA2A 4HYEA 5DV5A 1Z6RA 3AG2H 5A2QK 1PUFB 2B7EA 5EW0A 5IOYA 5DPXA 4IVNA 1YCHA 4PDXA 4CA0A 1RETA 1H8AC 1DPRA 3CDHA 4XRFA 1YE9A 3KZZA 4OIRF 4XKWA 3JRHA 2A68F 3QODA 1BW5A 3ABUA 4KIBA 4A3KJ 3ECOA 4IQJA 4J01A 1WZ2A 2OF7A 1LEAA 2IGMA 3QQAA 5L3CA 2LD5A 2VJ5A 4J5FA 5EDNA 4V19K 4XWTA 2WV1A 4M3FA 2ELKA 4KIGA 2X1DA 3RIRA 2AO9A 5FFXA 2H6AA 5A2QZ 1GV2A 3EUAA 4AD9A 2PQ8A 2LH9A 2DFIA 4RGUA 1E3HA 5B66C 5ICFA 2R7QA 3FXLA 5H20A 4NDLA 5FD6A 3WTYC 3NARA 4ZEJA 1MBGA 3ZQ4A 2HYJA 3CJRB 1N75A 2FU9A 4LGWA 1FTTA 1U6GA 2M0MA 1Z6TA 2HZTA 4YFXF 2PEXA 3DKWA 2TDXA 5DCMB 3VB2A 2F4IA 4CCLA 4XLHA 4MNUA 4F52A 4KDPA 3E7LA 1Z91A 1Y39A 1YTYA 3OYNA 2QWWA 4LB5A 4V2FA 3DEEA 4AM3A 3RQ4A 1MH3A 3LSKA 3I4PA 2F4OB 2M8EA 4N0BA 3L2UA 2ZJRF 4I01A 2LFBA 1PDNC 4BXUA 1MH4A 2HB9A 3IH4A 4Z5YA 3ZGKA 1TT0A 2X0LA 2QBYA 2Q2EB 3GZNB 3ZQQA 2BV6A 2I8DA 2P8TA 3CF2A 5DUKA 3IP4B 3J7ZI 4RAFA 2DKFA 1KGSA 3H36A 3OOUA 2FMLA 4XM3A 1RUNA 5DYMA 1NK3P 5AXOA 1SVLA 2FOKA 5FLXZ 5C44J 1DQUA 5M5YJ 4Y13A 3S15J 2PMZA 3PFYA 2VBWA 1JT6A 4PK4A 4UWSB 2VE9A 1ZTRA 2IXSA 2K27A 2K9MA 1HXDA 1PJRA 2JK3A 3GTOJ 1TW2A 1RESA 3ERED 2Y48A 3JTGA 2DBBA 1AKHA 3T0YA 4BBSJ 5CVUA 3IH2A 4F6HA 3DBRB 3GTJJ 3FXUA 3A1YA 5EEHA 1SFOJ 2K85A 2VPLA 2CQ7A 2XF7A 1XTOA 4XN0A 3BR1A 1VZ0A 2RQQA 2CG4A 3L2WA 3L2RA 2IA2A 1VQ9I 2VKDA 1MMAA 3K10A 3HUGA 2DFEA 2XF4A 1J09A 4L5EA 1SAUA 5LRSA 2GXGA 2FX0A 3BG7A 1X19A 4BEHA 4HW0A 1R1VA 2P81A 3JCUC 3LL7A 4EMSA 4XIDA 3C1DA 4RM3A 1FBUA 2M0CA 3LSPA 4HX4A 4RL2A 4DW6A 1F4KA 3JAMK 2IA0A 1K78B 5A0VA 2LTPA 1R5GA 2NOJB 3WHBA 5J8CA 2PI0A 1MGTA 4E7LA 3BTLA 2P7VB 4EXSA 1FMWA 1XGOA 2OZUA 3CC7I 2Y2ZA 3KETA 2OBPA 1QH5A 1PVEA 3ZP5A 3MN2A 6PAXA 4UWRB 2K3PA 2E1CA 2CH0A 4L5IA 2VKEA 4B43A 1OR7C 2WADA 2VJIA 1QZEA 1UELB 4S0HB 1DGRM 1IZ1A 1A35A 3WODF 5BOXA 3I54A 2DA3A 3WTWC 1NH3A 2KDOA 2KRCA 2E60A 3RSNA 5A23A 2ZJQF 1DP3A 1IC8A 3LQRA 2Z1DA 3PQKA 1XS9A 2Q0OA 5HH4A 1DP7P 1MMDA 3CLQA 3HKZN 1BR1A 4IQ4A 4BZ3A 2F4MB 4C09A 2WY8Q 3KLOA 3V42A 5BMZA 4RA2A 1O57A 4HNUA 2W84A 1I1GA 1VQLI 4Z2YA 4AXHA 4PZJA 3FAIA 2E2HJ 2ECCA 5FROA 4OAZA 1SFUA 2CFZA 4RM5A 2EFWA 2EWNA 4DYRA 1JUSA 4I02A 1YI2I 5K0WA 3SW3A 3V8KA 1X2MA 2ZC2A 2DQRA 2H8RA 2HXOA 4Z6XA 4LLGF 3E5XA 5FKMA 4A3DJ 1W5SA 3NWSA 5CKTA 5LS3A 1HDPA 4E70A 5F0CA 1D8JA 1V3FA 4HAMA 2VQHA 4UUVA 3F72A 3KP6A 4F93B 4A3LJ 4PJMA 1IN7A 2VC0A 5AIPA 3RZOJ 2XC7A 4RLFA 5IPAA 5L3DA 3S1RJ 3SQNA 1D5VA 4BQOA 3ASOH 3DEWA 4I0BA 1R58A 2HVQA 1M2XA 4YEJA 1FT9A 3LFKA 3S3OA 3T9MA 4NBQA 3GLLA 4CCOA 1YFHA 1SMLA 3PY5A 4UB8C 2DA7A 4UA4A 2V1DA 3S14J 1QU3A 3KP5A 2A61A 3HOTA 1XGNA 4YSKA 3KE2A 1IGNA 4MEYF 3RKJA 1BR4A 3RPUD 4V0HA 1LE8A 2HQRA 1XDUA 5CVRA 5D6FA 1S72I 4IPAA 1B4AA 3DHBA 4TYTA 2PBIA 2CGPA 3PNYA 1EA3A 2WTEA 2IPQX 1P9EA 4DNCA 1RI7A 2LYCA 2R5ZB 2HGCA 1VMEA 1WWXA 2LY2A 4C2UA 4EM0B 1Z1DA 2CRGA 1VJNA 1VQ7I 1BBYA 1TQPA 2ZFUA 4MFDA 1ZNBA 2BYVE 4TZ9A 1UJ8A 3DH8A 3BY6A 3K2ZA 1U78A 4L5JA 3Q0UA 3KYDB 2K9SA 1FBQA 3HGYA 4HOBA 3QOEA 2DMTA 2LBFA 1GHCA 2O03A 1HLKA 4PDKA 4Z67A 3TL4X 1U8RA 2B9SA 3CP2A 1J0RA 1FYMA 1U5TB 2HVRA 2VW8A 3RKQA 3AF5A 4QPOA 4ZYDA 3GTQJ 3KIOA 4D1UA 5DM7F 2KZGA 1JKPC 4UV8A 2VC1A 3ZPLA 4LB6B 5E18F 1FTZA 4DYQA 2NVTJ 3R0JA 2M34A 2JPCA 2JT1A 4QSHA 1YJNI 5K7FA 2Y8BA 1T39A 3K4JA 3IC7A 1F43A 2P5KA 1OCRH 3I9V2 1V54H 2ZMEA 2KLOA 2ZO4A 2DCEA 2Y9ZA 4NQWB 1IW7F 5D8KB 5EH9A 3D1NI 2V9PA 2I10A 3HG9A 3DTKA 2VQCA 2DDAA 2H6BA 3IDZA 2YSRA 4JQFA 3Q5FA 2DODA 4AC0A 3RJPA 2CMPA 2A69F 4XKVA 3ZQLA 3HC7A 4W97A 3SRXA 3PNTA 4RBOA 4LK0F 4IZZA 1R36A 2ZJPF 4BY1J 2OV7A 2H8WA 4IHYA 4DILA 2VT2A 4CYCB 1S8NA 5E20A 3E6BA 1IUYA 2FU4A 4U88A 4HA8A 2UXNA 3GBGA 5E17F 3HBLA 5GAEJ 5LRRA 1ETWA 2MSYA 3BLYA 4DQ2A 2UZKA 2LKXA 5E8GA 5L3GA 2BW3B 1O3RA 1T98A 2IS4A 1QBJA 4NQ5A 4CO8A 3AG3H 5AHOA 2CFUA 5IT9Z 2YCBA 1V5EA 4M6XA 3MKLA 2BG7A 3KPHA 2O6GE 3GXOA 5IT3A 3BR6A 2MG4A 4P9UA 2QQ8A 4S05A 3M9AA 4NNJA 1LNWA 1RRJA 1EF4A 1BI0A 1WGXA 5EYRA 1U3EM 2XRNA 4XRSA 5E3MA 5KVRA 3BJOA 3IL2A 2R7XA 5E3OA 2M2EA 2H27A 2ZKZA 1OISA 4NHJA 2QEDA 5EV8A 2CBNA 5J1RA 5EGOA 5HS9A 2LOOA 2W7NA 4FASD 3VQZA 2E36A 1P7IA 3LOCA 4AUXA 3JW4A 4AVPA 5J1UA 3TOAA 5C4XJ 3DLAA 4A2UA 2E71A 3GFIA 1U2WA 3CMAI 3CDIA 1SFKA 1Y8RB 4DJAA 3FIWA 4XRSG 4I99C 4ZNBA 4UY8I 2V6CA 2HR3A 3IKTA 1W0TA 3QWLA 4QTRA 3V7RA 3V8LA 1QHHD 2JRMA 4HPQA 5BNGA 3EUHA 3RYRA 2NVXJ 4FISA 4XICA 4BDZA 5HS7A 3RCOA 4NB5A 2VPRA 1WHUA 5C3EJ 4ASNA 4M3DA 4EEFG 1B8IA 4CZCA 3KP4A 3WTXC 3EUKL 2OTLI 4A3CJ 1FOYA 4BQNA 3O3KA 4BP0A 4HF0A 3OYLA 2E5NA 3TP3A 2NYPA 1TZLA 2X51A 3WGHA 2KHMA 2Y31A 3OS1A 2X9DA 1H0MA 2LY9A 2XUBA 1IRGA 3B73A 1MD0A 3R60A 4A3GJ 3QOPA 2GM4A 2VKHA 1LDJA 2QENA 3CDLA 1X8GA 4HLYA 1LKXA 1W36D 5K5OA 3A01B 3PNVA 4MHGA 1FEXA 3ZOBA 5AONA 1R6RA 3G3ZA 3K0LA 4RB3C 4JOMA 2ZB9A 4XQFA 5FLMJ 1XM8A 5LE1A 1E2XA 5IP9J 4M6YA 2XF5A 1MDMA 4M3BA
chains in the Genus database with same CATH topology
4RB1A 1YIOA 1GXPA 2JTVA 1YCGA 2LNBA 4GYGA 3P9KA 1WUOA 2BGCA 4UXNA 3GYHX 4C1GA 3BROA 4L0ZB 4BNCA 3WE2A 3U9GA 1O3TA 1YS7A 4LMYA 3TDUC 3R61A 1LEBA 3I71A 5BPDA 3F8BA 3KEQA 5ICEA 3TP9A 4HZFA 3FHZA 5EV6A 4HDUA 2FHXB 3SBLA 4U4LA 5BQTA 3L6NA 2FNAA 1FPQA 4BH9A 4WXDA 3I59B 1MJBA 4RL0A 4OINF 3WG9A 2K02A 5F64A 2MA3A 3LAJA 3QAHA 1WI9A 4MTEA 4YFNF 5ILVA 5LGUA 5EWAA 2YNVA 5LSCA 1ZYRF 2YX7A 1OKRA 3HRMA 4EJOA 3GZ6A 3WTTC 3FMQA 3X2XA 2VOPA 4LLNA 3U2RA 4BAYA 3FF5A 2HEOA 3RDIA 4Y17A 4D0PA 5L3EA 4KFCA 3F21A 2WYMA 5LGTA 2QDTA 2M45A 3CUOA 1TBXA 1UB9A 2WHGA 3FXQA 4GYIA 2R7DA 5LEKA 3IE0A 4EFZA 2KRFA 1V4RA 4K2EA 2A07F 3QH8A 2M87A 3S0ZA 3H92A 2XGXA 2ZXJA 3N97A 3I58A 2VBYA 4PGHA 3DPTA 3WXCA 2BIBA 5ACUA 1ULYA 1A04A 4EV0A 4RAYA 4LG0A 4EJUA 1FYKA 4EGZA 3GEZA 4IXAA 1J2XA 3C18A 3WTVC 3VPEA 1FSHA 5HIOA 1JHFA 5KILA 4PVTA 1OYIA 1EH7A 3KP7A 1Z7UA 4AWYB 5HH5A 3REOA 4FR7A 2KJCA 4M72A 3LA2A 5HISA 4KT5C 2GFKA 5ACRA 3MZYA 4G6QA 4EXYA 1W7PD 1S3JA 1ZG3A 1L0OC 3JTHA 4A5NA 2QQ9A 4R1HA 2M5WA 4A5MA 2XAHA 5FFZA 3P9IA 2HTJA 3ZWFA 1WKMA 4UVCA 2EA4A 4JK1X 1R1TA 3V7CA 4BHCA 3JSOA 2XHKA 3H3UA 3C7JA 4KMUX 3IEMA 4Q5SF 2DPUA 4ZYEA 1X8IA 5DCMA 1K6OA 2DPDA 4UAMA 4FX0A 3QU3A 1E17A 1HW2A 2NZEA 3T1BA 3F23A 1MZBA 2QZ8A 4L9TA 3HIFA 1XSXA 4M9SA 4EM2A 4XSXF 3M8FA 2IT0A 2DLLA 1QZZA 5K1YA 2BG6A 4ETSA 2BTNA 2Q2EA 1FZPB 1QH3A 2L54A 2Q0JA 3GWZA 2WRSA 5L3FA 1T38A 4YG2F 2V1UA 3RTRA 4D02A 1ON1A 2IW5A 2MH9A 1J9IA 4KA4A 1ZH5A 4NQ2A 5HLGA 2BE5F 2LKPA 3I14A 1W4MA 3SZTA 1JJTA 3ULQB 5HS8A 1FSEA 2ZFWA 5K4KA 4YIIA 3SHFA 1QO0D 1JXSA 2YZ3A 3CO7C 1NHAA 1J75A 4L0YB 4ZYHA 3HSEA 4RS8A 1H9TA 2JPBA 3DEUA 3I0VA 1HW1A 5FLXK 1O3SA 3IEKA 4F6ZA 4MQ9F 4L9VA 3K69A 3SZPA 3BPXA 2JRTA 4RGXA 2GIVA 5CLSA 1Y0UA 4ESBA 1K78A 5FGMA 3CLOA 2L4MA 2RDPA 2ISYA 4ZYGA 4I0AA 3CUQB 1HKTA 3CJNA 2UWMA 3X30A 4RB2C 5H6RA 2ESHA 3PG4A 3SD9A 4IRIA 3RPCA 2VONA 3DP7A 1KQ0A 1R22A 3F22A 3BK1A 3GW2A 1ZKPA 5D4SA 3HRTA 2G7UA 4G94A 1ZLJA 4LE6A 5D8LB 1O7FA 3E97A 1WQ2A 1BC2A 2Y8AA 5LGNA 3MEXA 1DDNA 4KEQA 2M30A 4O5VA 3L09A 2MBFA 2WYLA 1HSJA 4UWOB 1BN5A 2F5FA 1G6NA 2STWA 5K4NA 4WXCA 2VN2A 1B6AA 3RPQA 2RQPA 4BHBA 1WSUA 1AWCA 3J81Z 4IHTA 2I7VA 1G4DA 4RGSA 2L01A 5FO5A 4G7OF 4EJTA 4I2OA 5A0TA 4XLNF 1KU2A 2MLKA 4RB0A 4UVAA 2OD5A 5LHHA 4TZBA 3SFPA 1X8HA 2MD5A 3RYPA 1FP1D 3ZQ7A 2GA2A 2D45A 5D5VB 2XR1A 5TRDA 3M8EA 4ENNA 3QRFF 4GCVA 4CZZA 1R7JA 2A5YB 2EV0A 5DCFA 2QVOA 2CW0F 3ZNBA 1BIBA 1U5TA 1JT1A 4UV9A 2PN6A 1P4AA 3U1DA 2AIOA 3KP3A 2ZCWA 3PFIA 4MGRA 5CVVA 2E7XA 1D3YA 2QUFA 3PQJA 5LHIA 2H09A 1T6SA 1DDKA 5LLDA 4XLPF 2M5DA 3MAJA 2F5DA 3I53A 2DK5A 1FY7A 4NQWA 2QJSA 4AX0B 3CTAA 2P4ZA 1S29A 4C1FA 3TDZC 1KA8A 3R6SA 5HH6A 2KKOA 1QPMA 2K4BA 1K79A 4U7BA 1UCRA 5D6EA 2Z3YA 3HSFA 2MLGA 1F1ZA 3P7NA 1ODDA 1J5YA 5FQBA 2P5VA 2DK8A 4NQ4A 5LM6A 4Q48A 2LF8A 1P4WA 5HVQC 1LVAA 2VOOA 3DHAA 3ISPA 4MTDA 2YR2A 1H9GA 3WTSC 1MJAA 3QP6A 1OYWA 4BYYA 4HQEA 3FCZA 5B15A 4L18B 1Y44A 4ENMA 5CVIA 2CSOA 4IHSA 3R2UA 3HYIA 1SD5A 4RAWA 1P4XA 2UYXA 2Z5UA 2WYMC 2H6CA 3T3OA 4J5HA 4P9FA 3I13A 1KQ9A 3CO6C 5IT9K 3Q9VA 1HW5A 3Q6VA 4HL2A 1ZHFA 3G1PA 1XSVA 4HV6A 3G73A 2ZWRA 4D1TA 2L4AA 1SFEA 2ZNZA 3EDPA 5FB2A 2IJLA 5IQKA 2FU6A 3BV6A 4LD5A 2CWEA 2RN7A 3LVZA 3BZ6A 5ACWA 3K1PA 4GXOA 1I27A 3X2ZA 3FX3A 3EYIA 1XCBA 4HF1A 4WK8F 1ZG5A 3L2CA 4P96A 1BI1A 2OQGA 2QQAA 5K5QA 4UHTA 3QP5A 1J59A 3JSPA 1CF7A 2FM6A 1R1UA 4N9IA 1IXRC 1TQMA 4Z5ZA 3W6KB 3BDDA 4GGGA 3F8FA 1UHMA 4TZFA 1FOKA 5J8FA 1UHWA 1XCVA 4UNOA 3EETA 5E1XA 2GA1A 2K7LA 2Y75A 1HKQA 4GYQA 4L9JA 1KU7A 4OU0A 3ZMTA 5DD4A 2HKOA 2BG8B 1BJAA 3V8JA 1YYVA 2XV4S 2GWRA 4DIKA 1KYZA 4EJWA 1BIAA 3IOFA 4LLLA 3QPTA 3TO6A 5AHRA 2EFQA 3ZMUA 4ENKA 2ACJA 3GFJA 1UFMA 2DQLA 3NQOA 2FHXA 2VT3A 4HBLA 1S7OA 2L3DA 2IVMA 1P92A 1OR7A 3SFZA 3BP8A 4RAMA 3RKYA 3CUQC 4GO1A 2EFNA 3WGGA 4R79A 1VGNA 2BGAA 2BFZA 3ZN1A 2P6SA 2FNPA 1YW7A 2FMYA 3FMRA 2ZZIA 2HKXA 4LK1F 3E5QA 4PCQA 5D5XB 4AWXB 2YNUA 3ZR9A 3E6CC 1ZRDA 2XIGA 4RBSA 4G8XA 4ZH4F 5ACVA 3ZMDA 2AXLA 2FBIA 4OIQF 5HLHA 4AX1B 5ICGA 2VXZA 2OAZA 4M9ZA 3GVAA 2OZ6A 2GZWA 3AJ3A 2FXAA 4G7HF 3BC2A 5ERIA 4UVBA 1TW3A 3NEUA 2IRFG 2O0YA 4FX4A 5CYVA 3RKKA 1DPUA 4OMYA 2P6TA 2M1BA 1FNNA 4OOIA 1BOAA 1I5ZA 1W7PB 3TKYA 3KEOA 2Q8KA 4A0XA 2OHIA 3PY6A 1FX7A 4H0EA 1T2KA 3MD7A 4U7DA 4EVIA 1DUXC 2NYXA 2KJBA 4M73A 1YS6A 1J7KA 5LEJA 3QU6A 4WD6A 3T3NA 5DD8A 2PLYA 1P2FA 1XGSA 4EQQA 2RNJA 3NRVA 3AAFA 4RAZA 1WRAA 3DHCA 2NZFA 4D1VA 5ICCA 2HDCA 2W85A 4HDVA 1LDDA 3VEPA 4NQ6A 5AYAA 2Z9OA 3ZMSA 1QNTA 3LAPA 2A6HF 1L3LA 1SD6A 3IKVA 4AWZA 2CQKA 3J7AO 4C1HA 5E1ZB 2VODA 1S6LA 1ZTCA 1BVTA 2HOEA 2NRAC 2QINA 2WC2A 2P97A 3F6VA 1IN8A 3HRUA 2OA4A 1LJ9A 3GFLA 1L9YA 2QLZA 2EV5A 3A4YA 3S2WA 3ZN0A 5FQCA 3LSTA 3HOSA 4MEXF 4KEPA 1G3YA 2YNVB 4ZO2A 4JO0A 2FF4A 3MWMA 2X4HA 3OV8A 2D2WA 4G6DA 3TO7A 2FSWA 5CVJA 2EFOA 2BG2A 4KUMA 5AEBA 3WGIA 2E7WA 3GUDA 1KO3A 3VODA 4XSZF 1RUOA 2CFXA 3KZYA 1SD4A 1JHHA 2DOOA 5JR3A 4ENJA 1ZARA 2XAFA 4AIHA 2NNYA 2ZJ2A 2P7CB 2WWYA 1A7TA 2DW4A 1O7LA 3E3VA 1G3TA 5JFRA 4HL1A 3E5UA 1TTYA 1ZRCA 3F6OA 2XROA 2Z33A 2FA5A 1PP8F 2A3SA 2K86A 5HDGA 1ZG1A 3W6JB 2BC2A 3COAC 2GMNA 3K9TA 4M9XA 1XMKA 4D1WA 2KIFA 2MC3A 2OU2A 1OYYA 1ZREA 3M1EA 2Y87A 1YQAA 2C6YA 1JGSA 3I0TA 2DU9A 4YSLA 1WUPA 1PUEE 3HTUA 3T8TA 4N9HA 2YNTB 1BMCA 4XBFA 4CDGA 1RNLA 4HKYA 5JI6A 2KIUA 2ISZA 3RPUA 2AZ4A 1A8TA 2Y0MA 5LCAA 2I7TA 5LCFA 1Z05A 4ZO3A 1Z9CA 1USTA 3D0SA 2GFJA 4KMFA 4I7HA 2Q0IA 1G3WA 2BFKA 1FC3A 1OPCA 2DAOA 2GAUA 2YNWA 1XGMA 3R4KA 1IN4A 4XWWA 3ESHA 1R00A 3TQNA 4ESFA 3MFKA 1REPC 2O8XA 4WXHA 2XAJA 1KU3A 5ACTA 2AS5F 1JJEA 3LA7A 5D4RA 2JSCA 3HSRA 2LF7A 3LA3A 2ETHA 2G7HA 2IA1A 3T8RA 2P5LC 4XUKA 2QQBA 5LBQA 2HYGD 4Q4ZF 2R7FA 1TNSA 1F5TA 4FT8A 1LDKB 1GXQA 4TYFA 2FRHA 5D5WB 5ED4A 4WF2A 2F5CA 3VOEA 4Q47A 1FWZA 1XDSA 3DQVC 3DV8A 3J81K 4P55A 1LB2A 4BHPA 1R5HA 2ESNA 2ZBKA 3EQLF 2RGVA 2R2DA 1QQIA 2ADUA 3DF8A 1MKMA 4KYWA 3FM5A 2R3SA 4HF2A 5JHUA 3F9OA 5E8IA 2E1NA 4IF4A 1T0FA 3FWEA 1SMYF 4AIJA 4YSBA 4P5OA 2GQQA 1KO2A 2LDUA 3KL7A 1SFXA 3BPVA 2QBYB 3GFMA 3HHHA 4I98B 2VBXA 1WW1A 5A87A 5B3RA 4EGYA 3HHGA 1LQ1A 4WWCA 4Z60A 3MZHA 1IXSB 4CXFA 5AIQA 5BPIA 2RC4A 1CGPA 3I64A 1XMAA 1SD7A 3IRRA 1ZRFA 3L9FA 3JAMZ 3WTUC 3ML6A 3HTSB 1I1SA 3RI4A 2FQ3A 3GF2A 5L3BA 4HLXA 3I11A 3JXPA 2K4JA 1IAWA 2V1XA 2QM3A 2BR6A 2YPRA 1XN7A 5AXRA 3WU0A 2RKHA 5HDNA 3F3XA 3M7GA 1IF1A 4O98A 2W24A 2XASA 4YFKF 2OHJA 3GO5A 4Y15A 1XD7A 2G9WA 2RVCA 1PP7U 2Z99A 4G9YA 2FEZA 4TV7A 5LCHA 5HIQA 4B09A 3K1NA 3AF6A 4EYLA 3RKXA 5E1WA 3BJ6A 4U0WA 3V4GA 4CHUA 2L02A 1KR3A 2J5PA 3GLXA 4AIKA 1ZLKA 2DT5A 5ACXA 2NS0A 5ILUA 5ACPA 4OIOF 3LWFA 1B59A 2J5OA 5K5RA 3B02A 4YIFA 3KNSA 5HIPA 4MQVA 1HBXG 2CO5A 5DDGA 4GYUA 1IN5A 4CHLA 1VTNC 4G7ZF 5FQAA 3GX4X 1FYLA 1EV7A 3VFZA 2PJPA 1HSTA 3KNRA 1YG2A 3DPLC 2H94A 3I5UA 2FE3A 3F8MA 2NXAA 3X2YA 4M74A 4A6EA 4EYBA 5JVTA 4HX8A 5D5UB 2BG8A 3DXJF 1P6RA 1DXKA 2W57A 5ACSA 2HFHA 4ZZLA 4B87A 4OIPF 2FK6A 3E6DA 4IRGA 4JBAA 1DD6A 1ZGAA 4Z7RA 5ILSA 4A0ZA 2FU7A 2EB7A 2VBZA 2OHHA 5ACQA 4KN4X 5F1RA 3C3WA 3RKWA 1B1BA 1X3UA 4I09A 4KN7X 2OQRA 3K1MA 4CICA 2PMUA 1QGPA 1HQCA 1EH6A 1HKSA 1G3SA 4WX9A 2B0LA 1SMTA 4P62A 1TLHB 5HOOA 2HQNA 4O6JA 4TZEA 2EK5A 3IHUA 1FP2A 4FHTA 3D5LA 1K07A 1JE8A 3IWFA 3ZMVA 2GXBA 1MQOA 1I6XA 2EJRA 5EVDA 2M5CA 2HWVA 4PVOA 2ZMEB 2COMA 1KYWA 2IP2A 4GCWA 1IN6A 2NAZA 1FLIA 1STZA 4RGRA 1W7PA 5F6FA 3I59A 1BC8C 1BI2A 1RIOH 3QPHA 2PG4A 4UWPB 2RV8A 3O6BB 5KIKA 1USSA 4M71A 3N4MA 5LHGA 3WTZA 3ROUA 2HYFA 2Q42A 3F8CA 3IOGA 1GVJA 4UBQA 4HQMA 4ZZDA 5TJJA 3I15A 3KCCA 1CF7B 4BQAA 4S04A 4KIFA 3IE2A 1F9NA 3KLNA 1WRJA 5HLIA 3WU1B 2ELHA 3GZ5A 2BEOA 2XVCA