4AD9A

Crystal structure of human lactb2.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
288
structure length
288
Chain Sequence
MAAVLQRVERLSNRVVRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPAIPEYISCLKQALTEFNTAIQEIVVTHWHRDHSGGIGDICKSINNDTTYCIKKLPRNPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEEENAIFSGDCILGEGTTVFEDLYDYMNSLKELLKIKADIIYPGHGPVIHNAEAKIQQYISHRNIREQQILTLFRENFEKSFTVMELVKIIYKNTPENLHEMAKHNLLLHLKKLEKEGKIFSNTDPDKKWKAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE-LIKE PROTEIN 2
total genus 86
structure length 288
sequence length 288
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF17778 BLACT_WH Beta-lactamase associated winged helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4ad9A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4ad9A01
2YSRA 4DNCA 1R00A 2DQRA 3X2ZA 5JI6A 4TYTA 2XVCA 3GWZA 1XCVA 4IVNA 3PFIA 4HX4A 2EFQA 4LB5A 2UYXA 1Z9CA 2DI3A 4MTEA 2DLLA 3KP3A 1Z1DA 1MD0A 1DXKA 4NQWA 2V1DA 3RTRA 1XCBA 4LJZF 3ZQ7A 2H6CA 4A0YA 3V4GA 2QQBA 4ETSA 2CO5A 5ACQA 3HIFA 3OV8A 3I64A 1ULYA 5A87A 1IAWA 3L7WA 4ESJA 1HSJA 1YLFA 2FM6A 2FU6A 5LM6A 3I59A 4WXCA 5ICEA 4GXOA 1KU7A 4P96A 3BPVA 2WYMC 4ENNA 2LNBA 2QBYB 1DDKA 3WTVC 5AEBA 3RI4A 3ZPLA 5HLHA 1YW7A 2QQ9A 4AWZA 5CVJA 2JPBA 1J2XA 4UAMA 3K2ZA 4UHTA 5FQAA 2STTA 3WTXC 3CTAA 3DHAA 1VTNC 2G7UA 3LAJA 1J0RA 5CJ9A 2BG6A 4C1HA 4LLLA 1DUXC 3H92A 2BG8A 4N9IA 3RIRA 4HF1A 1RUNA 1KYWA 5H6QA 1Y44A 1REPC 3ADRA 1EV7A 1MJAA 5A5ZA 3JTHA 2ELHA 1KU3A 3L00A 4EXSA 4J5HA 5JFRA 1Z6TA 2XASA 4WX9A 3G1PA 4HX7A 3ZN1A 2IT0A 2Y87A 5DUIA 3J80K 3SQNA 1KO3A 4KT5C 2NYPA 1XD7A 4C1GA 2P97A 3J81Z 1ZLJA 2P5LC 2Y8AA 4CGZA 4HOBA 2F5EA 4CICA 1FP2A 4TZBA 1ZRFA 2OHHA 3PQKA 5LEJA 2MD5A 2XAJA 5HDNA 3LA3A 2QDSA 4XWWA 4HQEA 3J7AO 2VBWA 1SD7A 2ZFWA 3TO6A 1ZG3A 4G6QA 4UXNA 1W5SA 3BZ6A 2DBBA 3GEZA 2QLZA 3ROUA 1TQIA 3BK2A 2O3FA 2WV0A 2XHKA 3BJAA 4Q4ZF 4Z2YA 1LQ1A 2Z9OA 1D8JA 2W85A 3ISPA 1JJTA 3A4YA 1KU2A 4RAYA 4TZFA 1DDNA 4KYWA 3TO9A 1LDJA 4HL1A 1R1UA 3BOQA 4U7DA 1QGPA 2V9VA 3IEMA 2FU8A 3Q9VA 1ZKPA 1S6LA 1FSHA 2P5KA 2FNAA 1MZBA 4M73A 4NQ4A 1HKSA 3TQNA 2IVMA 3IWFA 3X2XA 3GX4X 3KETA 4GYGA 1W7PB 1DD6A 4HBLA 1WRAA 1BC7C 1BI0A 5LGTA 5FGMA 2H09A 3I13A 3F23A 1FBSA 1TNSA 3V8JA 1KGSA 1ZREA 1RUOA 2Q42A 2COMA 3QRFF 4CDGA 2AXLA 1X8HA 3KP7A 4LFUA 2DPUA 3ZMVA 1B4AA 1XDUA 2BTNA 1FYLA 1HKTA 3X2YA 2EV5A 2QINA 5FLXK 1UHMA 2LDUA 5DYMA 4A2UA 5AONA 1S8NA 4OIPF 1K79A 3ZWFA 3F6OA 1U78A 5K5QA 4WWCA 2EFOA 3IKTA 1OPCA 3CUQB 5TRDA 2A07F 4AIKA 3ABUA 1U8RA 1ONVA 1FC3A 1MJ9A 3NEUA 3MD7A 4LK1F 1O3QA 1XGOA 2YX7A 2I7TA 4I2OA 5AHOA 3U9GA 3R6SA 2XIGA 1ZG5A 4EGYA 1LB2A 2ESNA 4KA4A 1USTA 1ZLKA 3VOEA 4FX4A 2DQLA 2XKPA 5DCMA 2KIMA 4L9VA 1FX7A 2RGVA 2CGPA 2OBPA 5HLIA 1QZYA 3LQRA 1IUYA 5LCAA 3EDPA 3JTGA 5AHRA 4XWTA 2GA2A 2G7HA 3DHBA 4L18B 4ZH4F 1I6XA 1UFMA 5B3RA 1KR3A 1ZGAA 1SAXA 3WODF 1IRFA 5E8IA 1MDMB 3QAHA 1RIOH 3ZMUA 2FBIA 1LEAA 4HZFA 4EYLA 3BK1A 2BEOA 2PBIA 4NQ5A 1IZ1A 2PG4A 2PQ8A 5DCFA 5EVDA 1FY7A 2VT3A 3HYIA 3N4MA 4K2EA 4BYYA 3I0VA 3P7NA 2A6HF 3DEUA 2HWVA 4P5OA 4EM1A 1K07A 5ERIA 1L9YA 4D1VA 5LMCA 2IW5A 2EV6A 1ZYRF 5ACXA 4KMUX 2IA0A 3AF6A 3KE2A 3M8EA 3ELKA 2AS5F 5LLDA 1UB9A 2F5DA 3CDHA 1WSUA 4G6DA 3DH8A 2BYVE 4XSXF 3DXJF 4TV7A 2YR2A 4YFNF 2YNTB 3CUQA 1HSTA 4PZJA 2Y8BA 2ZNBA 4EV0A 3F9OA 3IOFA 4A6EA 1J59A 2D2WA 3DFGA 1P92A 2HKXA 4G7OF 1L3LA 1STZA 4IHSA 3I58A 5CVIA 4GYUA 1Z7UA 5F6FA 4TZ9A 3QOPA 2ZBKA 5EH9A 2FMYA 4ZZLA 2HQNA 3JW4A 4KEQA 4FHTA 4I98B 2YNTA 5DD4A 2CSOA 4LLNA 3KCCA 4A6DA 1O57A 3KP2A 1PP7U 1BOAA 5LRSA 3V7RA 1RZ4A 2A3SA 2JTVA 3DF8A 1KU9A 4ZEJA 4ZYHA 1YTYA 3EETA 3F3XA 5A2QZ 1BJAA 1YFHA 2BFLA 5D8LB 3R4KA 1YW9A 1X8GA 2M30A 5EVKA 2ISYA 3R0AA 2WYMA 3H3ZA 4D1TA 1XDSA 1R5GA 5HS8A 1IN7A 3K0LA 2KRFA 4RAWA 4ESBA 4UWSB 5B15A 2HOEA 3I71A 2VONA 4IJAA 4JBAA 3FMRA 2UXNA 2X0LA 3IE2A 4AX1B 1U6GA 3FMQA 1VJNA 5A2QK 2I7VA 4ZYEA 3ZMSA 4F6ZA 1XTOA 3QU3A 4GCWA 4I0AA 5EEGA 1R36A 1O3SA 1TTYA 1R5HA 2YX4A 4C09A 3IRRA 4KICA 2H6AA 1IN4A 2XGXA 4L9NA 2GFKA 3ULQB 1Y0UA 3FF5A 3G3ZA 1IXSB 2M5WA 1U2WA 2P18A 1TW3A 5AIPA 1OYIA 2Y0MA 3KP6A 3FXQA 1HKQA 3QP5A 4IXAA 3DKWA 1Z6RA 5D5UB 1V3FA 4UBQA 2OU2A 4M6YA 3SW3A 2L4AA 4EMSA 4HV6A 4IPAA 2M5CA 4B09A 1F9NA 2RN7A 2VC0A 4EJOA 4AIHA 5ILVA 4EQQA 1W5TA 2OHIA 3WTYC 4M72A 5FLXZ 2RVCA 4YFKF 4J5FA 1HW2A 3K9TA 1PUEE 2KKOA 3FHZA 1K7AA 3SZPA 2FQ3A 4KIGA 3BV6A 1GHCA 5JVTA 1G3TA 4HX8A 5AXOA 1BMCA 1E5DA 2EK5A 3B02A 2HQRA 1R7JA 3JSPA 2EA2A 2DFIA 2R7DA 1FPQA 2BGAA 3E3VA 2FU4A 5KK1A 2CFXA 5E1ZB 2ZNZA 1CF7B 2XF4A 3IEKA 4KDPA 4HF2A 4BXUA 2HYFA 3U1DA 3RKKA 4DILA 4JK1X 1M2XA 5D5XB 4YFXF 3J80Z 4RB1A 1DPUA 5ACTA 3I53A 5HIPA 1HW1A 2GCUA 2P7CB 3JXPA 3GO5A 5BPDA 2O0YA 4JO0A 5FB2A 3QU6A 2FU7A 4WD6A 2ADUA 4B8XA 2KJCA 2FK6A 1XMAA 2QWWA 5L3EA 3MZHA 4M9SA 4B87A 2IP2A 4Y15A 1WWXA 2RDPA 3EQLF 1P4WA 2C6YA 4KFCA 4EJVA 4DIKA 1YW8A 4OIQF 2G9WA 2EA4A 5F64A 2FXAA 2BC2A 2CYYA 2NXAA 5LCHA 1G4DA 3WTTC 3QP6A 2YPRA 2B0LA 2VODA 2YNVA 4L0ZB 1YQAA 2XKOA 2Z3YA 3R0JA 1FYKA 2YNVB 3KEQA 4XLNF 1BN5A 3V8KA 4GGGA 1X3UA 5K5RA 3ZQ4A 2M87A 1PP8F 4Z6XA 1T0FA 2FNPA 3Q6VA 1KO2A 2OA4A 2EJRA 2FBKA 4I0BA 4LG0B 3HRMA 2HGCA 1B6AA 2XAQA 2BFZA 2IRFG 1MJBA 4BNCA 4E70A 5EWAA 3PY5A 2FE3A 4HL2A 1BM9A 1F5TA 4HV5A 2R3SA 5LLQA 1VMEA 3GUDA 2HEOA 3H3EA 4TYFA 2EFWA 1KA8A 1BBYA 1GVJA 1JE8A 1LVAA 4IF4A 5BOXA 4V0HA 2OZ6A 3FX3A 4IRHA 1OMIA 2ZZIA 5DPXA 4EYFA 5IT3A 2EV0A 3LA7A 2M1BA 1YCFA 4FEKA 2TDXA 4HDUA 3WE3A 1XSVA 3V7CA 4U0VA 3RKJA 1G3WA 4U7BA 4EJUA 1HBXG 5E17F 3KZYA 1D3YA 1XSDA 1XB4A 2A61A 1RI7A 4GCVA 4CHLA 4OINF 4CHUA 2ZWRA 2JSCA 3E97A 1EH7A 2LF7A 1T6SA 4G9YA 4NB5A 2BFZB 4Q47A 5D5VB 2FHXB 3FAIA 2GIVA 3C18A 2FBHA 3WGHA 1U5TA 3KZZA 3REOA 3CO6C 5EV6A 5K4KA 2HR3A 3GZ6A 1S3JA 1HQCA 3O2PE 3WXCA 4LG0A 1EH6A 4OU0A 3Q5FA 2VOPA 4R8HA 2L4MA 2KJBA 2ZXJA 2DOOA 2QJSA 5KIKA 5A0TA 3JAMZ 2GAUA 2VC1A 1MGTA 2DTRA 2FA5A 2XAFA 2YNWA 2P6TA 5LEKA 4CZZA 1R22A 5L3BA 4G7HF 1Z05A 3TDZC 2DK5A 2XAHA 1D5VA 1QNTA 4L5IA 1G3YA 5ACRA 2MBFA 6PAXA 3BROA 1FLIA 5HH4A 4Z67A 3F22A 4U0YA 4H0EA 1QPMA 3K69A 1ZAOA 4C1DA 2CQKA 3MEXA 4LGWA 3NQOA 2OZUA 4CXFA 4A0XA 3BWGA 3IRQA 2CG4A 5D4RA 2EFNA 4JQFA 1P2FA 3MQ0A 3SPUA 4OMZA 1CF7A 5ACVA 4M74A 1ZGJA 3MZYA 2XV4S 3IC7A 4TZEA 4MEYF 4RB0A 1QH3A 2FRHA 4Y17A 2M5DA 2K4JA 4QWQA 4WXDA 5CVRA 2ZJ2A 4F7ZA 4RBSA 4YSLA 5J6XA 3MCZA 2OQGA 2E1CA 2Z99A 2L01A 4A5MA 1TW2A 1YS7A 2BIBA 3CUQC 5E8GA 4EXYA 4IHTA 3LAPA 2PJPA 2OHJA 1R1TA 4A0ZA 2MH2A 2STWA 4D02A 4RB3C 2RV8A 2P8TA 2FU9A 1QZZA 3ABTA 4OMYA 2JZYA 4N0BA 3LVZA 4A5NA 2VW8A 3L2CA 2V6CA 2ZCWA 5EV8A 4HLYA 3M1EA 2MH9A 4PVTA 3J81K 3M8FA 2UZKA 1ZARA 3GFLA 3ERED 3VPEA 1BI2A 1TBXA 3F21A 1ON2A 2RKHA 1YCGA 2CWEA 3FWEA 2PMHA 1IN5A 3E5QA 1F1ZA 4IRGA 3VODA 4ZNBA 4D1UA 2GKLA 3WGIA 1XGNA 1H9GA 3BDDA 2A68F 3HUGA 3MWMA 2W25A 3GLXA 4ZO2A 3WTZA 1IW7F 3RYRA 2RNJA 2VBZA 2V1XA 2GZWA 4H0DA 1XMKA 1K78B 4AIJA 2Q2EA 1W7PD 3SFPA 5DEQA 2Z33A 2HTSA 4OIOF 3NRVA 3DP7A 3LSTA 1S7OA 2PN6A 3IDZA 4HW0A 2O03A 5HH6A 1OR7A 2HZTA 2HKOA 5FFXA 4LB6B 4L0YB 5DUKA 1AWCA 2YU3A 4S04A 1J7KA 2GFJA 1ZG1A 5ICCA 1ZNBA 3ZMTA 4BHBA 2P5VA 3F6VA 3MFKA 4BH9A 2VN2A 5K5OA 5FQBA 4HA8A 3H3UA 3M7GA 4M9XA 3RPCA 3HOSA 1U3EM 3COAC 5FD5A 1BI3A 1T38A 4LLGF 5CYVA 1VGNA 4C1CA 2P4WA 5LHIA 1SMLA 1BC2A 1QO0D 3KNSA 1TLHB 1O3RA 4XUKA 1EH8A 5D4SA 2GWRA 1XGSA 2EWNA 3GYHX 2PFBA 3FM3A 3WE2A 5ACWA 4O98A 3GZ5A 1B1BA 2JPCA 3JSOA 2A5YB 2JRTA 4ZYDA 4N9HA 1AOYA 2Y75A 2WHGA 2QM3A 3T8RA 3GF2A 1MDMA 1YCHA 4RB2C 2DO7A 2UXXA 2QENA 3L9FA 3ZP5A 1ZHFA 2Q9UA 3SBLA 2QEDA 4MHGA 2IJLA 1JT1A 3FZVA 3F72A 4ZZDA 1TNTA 3QH8A 5EVBA 4EYBA 1SFUA 3I14A 2QZ8A 5HLGA 1QBJA 1G6NA 1OYWA 1H9TA 4C1EA 5K4NA 3N97A 2NNNA 5LSCA 3BC2A 4YIIA 2BR6A 3ECOA 1BI1A 4EFZA 2GQQA 1U5TC 1R1VA 5EEHA 3G73A 2P7VB 2XAGA 3K1PA 4FSBA 4ZO3A 3EYIA 3F8NA 4QLCU 2W84A 2HDCA 4R1HA 5A0VA 1T98A 2AIOA 3T9MA 5E1XA 5IT9Z 3CO7C 4AX0B 1ZRDA 2W24A 1IN8A 1LDDA 4UVBA 5L3FA 1ODDA 4Z5YA 2WRSA 1ON1A 3T3OA 1J5YA 2ZMEB 4O6JA 3I15A 3FXUA 2O61A 3ZNBA 2BFKA 2F5CA 2VE8A 3PY6A 1XSXA 2QVOA 1BIBA 1D8KA 4UWRB 1ZN2A 3HSFA 2F5FA 5CLSA 2HTJA 2J5PA 5ACPA 2A69F 4RAZA 1BVTA 3KP5A 2MC3A 1WKMA 4F6HA 1MQOA 5BPIA 1YYVA 2Q0IA 3D5LA 1KQ8A 5KVRA 2QDTA 1QH5A 4NQ6A 1DP7P 1Q1HA 3IL2A 4KN4X 1H0MA 3T0YA 1GXPA 1WW1A 2ZNYA 3BJOA 2EB7A 3BY6A 5HS7A 4EVIA 4WF2A 5BQTA 4AWXB 5CVVA 5E1WA 1KYZA 4I02A 4Q5SF 3D0SA 3WTSC 4RGSA 3S2WA 4BP0A 3FXRA 3P9CA 4R79A 5L3DA 1KQ9A 3KP4A 2PI0A 2NNYA 1P4AA 4BHCA 5L3CA 4U4LA 1SFXA 3QPTA 4UV8A 5BS6A 2Z5UA 4ENJA 2VOOA 5H6RA 4RGUA 3VB2A 3F8FA 2NS0A 2BBYA 2ACJA 2ZO4A 1J9IA 3GVAA 1R23A 4XLPF 1G3SA 2BG7A 4NHJA 4GYQA 3WGGA 2I7XA 4UUVA 1BC8C 2ESHA 1IF1A 2NAZA 1FZPB 1P4XA 2HB9A 4EM2A 4LK0F 4KUMA 3I11A 4S05A 2FF4A 3SZTA 1YS6A 4M9ZA 3R61A 5ACUA 3DQVC 4XRFA 3S0ZA 3IKVA 4YSBA 4PDKA 3LA2A 1NHAA 1DPRA 1K78A 2E7WA 3BP8A 3P9KA 5LHHA 3L09A 2HS5A 4LD5A 1FBUA 5J8FA 5EW0A 3FM5A 2L3DA 4HYEA 1JHHA 3FCZA 5LS3A 5K4MA 4HAMA 2YZ3A 1O7LA 2PEXA 5ICFA 3I4PA 5FO5A 3E5UA 5LGNA 3K1NA 4UV9A 2P4ZA 1U5TB 3AF5A 3TDUC 2DK8A 1TQPA 2KIUA 1MKMA 4MEXF 4UWOB 1BIAA 1V4RA 3V7SA 4ASNA 4L9JA 1LJ9A 2LKPA 2L54A 2QUFA 2H6BA 3CJNA 2XROA 5LRRA 4CYDA 2DT5A 2FSWA 2H94A 1JHFA 4ENKA 4I01A 2NZFA 4YIFA 3OOPA 1CGPA 4IRIA 4BAYA 3GFMA 3GFIA 1LEBA 1L0OC 5HOOA 1XM8A 2QYOA 1SD5A 1ZH5A 3TOAA 1FWZA 2XRNA 3K1MA 4PGHA 4Q48A 4EM0B 2Q0OA 4ESFA 3ZN0A 3LQQA 3RJPA 1SMYF 3C3WA 4KMFA 1OYYA 3I59B 1XN7A 1JXSA 1SMTA 5HH5A 4L5JA 4FX0A 3RDIA 1LDKB 2NYXA 2BV6A 1IN6A 3KLNA 2BMIA 2K86A 4HKYA 1LNWA 4UNOA 3I5UA 2V79A 1HW5A 4Z5ZA 2DW4A 4MQ9F 2HYGD 4WCGA 3TOBA 3KEOA 1C0WA 3ZR9A 3AJ3A 4EJTA 1WQ2A 5AYAA 2ISZA 4OIRF 5LGUA 4KN7X 3LWFA 3TO7A 4MGRA 3P9IA 2WWYA 3T3NA 3LFKA 2NRAC 4EJWA 4AVPA 3E6CC 2YCBA 2IA2A 5HIQA 4Y13A 3ML6A 4Z7RA 2ZKZA 2FEZA 3V8LA 3RKXA 2PLYA 5FFZA 3T5XA 2R7FA 4PGGA 3R60A 2RC4A 3KLOA 2ZMEA 3TKYA 2WTEA 5LCFA 1XGMA 2D1HA 3I54A 3HOTA 3DPLC 4U88A 5JR3A 2IA1A 5E18F 2DPDA 1I27A 4KEPA 4WXHA 2V1UA 2OQRA 5IQKA 3IE1A 3ZMDA 1WUPA 5LE1A 4PVOA 3WU1B 4G8XA 5AIQA 2K7LA 3HHHA 5BMZA 2DU9A 3IWZA 1SFEA 1FSEA 4YG2F 1I5ZA 4MTDA 3VEPA 5B1UA 5FD6A 2MLGA 5FQCA 5F1RA 2IPQX 3QPHA 3E6BA 1X8IA 2E7YA 2KIFA 3WG9A 4P55A 2Y48A 3O6BB 2VT2A 3HTUA 1WUOA 2L02A 2Q0JA 4FT8A 5HDGA 1O3TA 1IXRC 1UHWA 1QQIA 2D1VA 2H27A 1P6RA 2EFPA 2M8EA 1J75A 3TP9A 2M45A 4OOIA 4I09A 5K1YA 4AD9A 4RL2A 4RAMA 5EHTA 1A8TA 4ENMA 3IELA 1B9NA 4GO1A 2BG2A 2WYLA 1FNNA 5J8CA 4L9TA 2JT1A 4LMYA 3WTUC 4XSZF 2DKFA 2FOKA 4RM5A 4YSKA 5CVUA 3TGNA 1I1GA 1JGSA 3HRSA 4BHPA 3E6DA 5K0WA 3HRUA 3SRXA 3VQZA 4LE6A 4CO8A 5HDKA 4UVAA 3L6NA 2HFHA 1YO5C 3ECHA 4ZYGA 5TJJA 4G7ZF 2RQPA 3EYYA 1B9MA 3U2RA 5H20A 3EUHA 5DDGA 1F4KA 5ACSA 5E20A 3HTSB 2ETHA 3RPUA 2K27A 4PCQA 3VFZA 5ILSA 5D6EA 2K02A 2LSOA 1W7PA 2R2DA 5HIOA 4EGZA 3KNRA 2VXZA 4RS8A 4P9FA 4HQMA 2XUBA 2K4BA 3KFWX 5IT9K 3T1BA 4U0WA 4C1FA 1HXDA 2VE9A 4UA4A 4HDVA 2BGCA 3IOGA 3I0TA 3RKWA 3DV8A 2A6EF 5D6FA 3P2UA 3HSEA 2MLKA 3SFZA 1ZRCA 1GXQA 3HSRA 3T8TA 5HS9A 5KILA 2UWMA 3WTWC 1IRGA 2GXGA 4RGRA 1JJEA 1T2KA 4KIFA 1KQ0A 4M71A 3W6JB 2GA1A 3FMSA 3IE0A 3MAJA 4MNUA 5HVQC 5L3GA 4A12A 2BE5F 3C1DA 3F8MA 1S29A 3E6MA 1WI9A 3HRTA 3R2UA 3CLOA 5D8KB 3GFJA 3WU0A 4M6XA 3DHCA 3X30A 3PG4A 2XR1A 4O5VA 1B59A 4KIBA 1R58A 3JAMK 3AAFA 2CBNA 3GW2A 1HLKA 1I1SA 1Z91A 5ICGA 2MA3A 3F8CA 4GYIA 3B73A 3PQJA 4ON0A 4I7HA 4WK8F 2P1EA 1T39A 2GXBA 2Q8KA 5DCMB 4HLXA 3DPTA 3BPXA 3SXYA 2BG8B 2DAOA 1A04A 2PMUA 1O7FA 2A7MA 4FR7A 2F2EA 2LF8A 3F8BA 4G94A 2O6GE 2P6SA 5DV5A 1TQMA 1RNLA 4DQ2A 5D5WB 4KNYA 1OKRA 4O3MA 1IXCA 4Z60A 2D45A 1K6OA 4D1WA 5ILUA 3SD9A 3CUOA 3Q9SA 4NQ2A 2YNUA 2O8XA 1E17A 3BJ6A 2VBYA 4UVCA 5HISA 1FP1D 1YG2A 3O3KA 4XBFA 2E7XA 3RYPA 2WC2A 5DD8A 4AWYB 3M9AA 4RL0A 2FMLA 1A7TA 1P9EA 2X4HA 2J5OA 5LHGA 5AXRA 3GXOA 3E5XA 3IHUA 3W6KB 1FT9A 2E1NA 3ZMZA 4P9UA 2FHXA 2GMNA 4D0PA 3RPQA 3RKYA 2NZEA 4UWPB 4HF0A 4BQAA 4RGXA 4BZ3A 1FBQA 1UCRA 1PDNC 2VBXA 1S7AA 1SD6A 5LBQA 2OAZA 5JHUA 4EY2A 4P62A 1SD4A 1E2XA 2CW0F 1FOKA 2QBYA 1ZTCA 1WRJA 3HHGA 1W4MA 3SHFA 2QQAA 1USSA 1FYMA 1YIOA 3C7JA 3KL7A 5ED4A 4MQVA 2W57A 2OD5A 3ESHA 2AZ4A
chains in the Genus database with same CATH superfamily
2YSRA 4DNCA 1R00A 2DQRA 3X2ZA 1MMAA 5JI6A 4TYTA 2XVCA 3GWZA 1XCVA 4IVNA 2E5NA 3PFIA 2XRLA 4ZDOA 2CUFA 3DTIA 2L7FP 3DU6A 4HX4A 4OAZA 2EFQA 4LB5A 5C4JJ 2UYXA 1QVTA 4IOCF 2DI3A 4MTEA 1Z9CA 2DLLA 2N8GA 2DDAA 3KP3A 1Z1DA 1MD0A 2K9LA 1DXKA 4NQWA 2V1DA 3RTRA 1XCBA 1DU6A 3HGGA 1Y6IA 4LJZF 3ZQ7A 3DEWA 3KPHA 4J01A 4E7IA 3ZQGA 4BBSJ 2H6CA 4IZZA 3FXMA 4A0YA 3V4GA 2QQBA 4ETSA 2CO5A 5ACQA 3SFIA 3OL4A 3HIFA 3OV8A 2M7AA 3I64A 1ULYA 3MKWB 5A87A 3ERMA 2I5UA 1IAWA 2ZXHA 2X51A 3L7WA 4ESJA 3DKYA 1HSJA 1YLFA 2DOAA 2FM6A 4XMYA 1W1WE 1Q1VA 2FU6A 5LM6A 3I59A 4WXCA 5ICEA 4BE0A 4GXOA 1KU7A 3AG3H 4A3CJ 3JRHA 3FBNB 4P96A 2A5WA 3BPVA 1KONA 1FIPA 2WYMC 4ENNA 2LNBA 4DGWB 1VQ5I 2QBYB 1DDKA 3WTVC 2I8DA 5AEBA 3RI4A 2QSGX 3ZPLA 3KYCB 5HLHA 3ZR8X 1ZKGA 4NURA 1YW7A 2QQ9A 2QQ8A 2WY7Q 4AWZA 5CVJA 4E4HA 2CW7A 2JPBA 2HQAA 3MMYB 1J2XA 3RQIA 2WBMA 3J7YJ 3K2ZA 4UAMA 4UHTA 5FQAA 3CP8A 4X6AJ 2CG3A 1DQUA 2RQQA 4BS9A 5HNFA 2STTA 5C3EJ 2LG4A 3WTXC 5K7FA 2OTLI 3CTAA 3C2BA 3DHAA 4MLOA 1VTNC 2G7UA 2O7OA 3LAJA 1J0RA 2VLAA 1X1BA 5CJ9A 3M4OJ 2BG6A 1VQPI 3M07A 4HNVA 4C1HA 4LLLA 1DUXC 3H92A 2BG8A 2HYJA 4N9IA 3RIRA 2GBYA 4HF1A 1RUNA 2M4KA 3ABLH 1KYWA 5EG0A 5F0FA 5H6QA 1Y44A 1REPC 3CESA 1X19A 4HG2A 3ZRGA 3ADRA 1EV7A 4IO9F 1MJAA 5A5ZA 3JTHA 5FLVA 4C2TA 2ELHA 3CCSI 1KU3A 3L00A 1T08B 1TL8A 4EXSA 4J5HA 5JFRA 5AIJA 1Z6TA 2XASA 3UR3C 2PMZA 4WX9A 1IV6A 2M8GX 1EF4A 3G1PA 2DA2A 4HX7A 4M3EA 4IHYA 3WU2C 3ZN1A 2IT0A 3HPHA 2Y87A 5DUIA 3J80K 3BT9A 1JJ6C 5DTDA 5EYRA 3SQNA 1KO3A 4KT5C 1E3HA 2NYPA 1XD7A 4C1GA 3S17J 4KT6A 4CCJA 3J81Z 2P97A 1ZLJA 2CJJA 1H89C 4RA2A 2P5LC 2W00A 2Y8AA 4CGZA 4HOBA 2F5EA 4CICA 1FP2A 5EZGA 4TZBA 1ZRFA 2OHHA 3PQKA 3PSFA 5LEJA 1JGGA 2MD5A 2XAJA 5HDNA 1FTTA 3LA3A 1PUFA 2JN6A 2M7BA 3AG1H 2QDSA 4XWWA 4HQEA 1N78A 4BE1A 3J7AO 3AFHA 5J4VA 2DYRH 4CYCA 2VBWA 1SD7A 2ZFWA 1ZGWA 2R7SA 3TO6A 4Y33A 5KHDA 4F93B 3DU5A 1ZG3A 2Y30A 4G6QA 4UXNA 3ZCOA 3H1CA 1W5SA 5DM6F 3BZ6A 1VQ8I 2DBBA 3GEZA 2JSPA 2QLZA 3S1RJ 2HOSA 3ROUA 2CV2A 5CQGA 1TQIA 3BK2A 2DFFA 2O3FA 3BR5A 2WV0A 2XHKA 3E7LA 3BJAA 2DA7A 4Q4ZF 4Z2YA 4BY7J 1LQ1A 2Z9OA 4W97A 2X9DA 5F0CA 1D8JA 2W85A 4RDUA 3ISPA 1JJTA 3A4YA 1KU2A 1D1BA 4RAYA 4TZFA 1DDNA 3K4JA 4KYWA 1ETWA 3TO9A 2WB1A 1XPXA 1TWFJ 1JTXA 1QA6A 1LDJA 3IH3A 4HL1A 4CCLA 1ETOA 1R1UA 3RKQA 3BOQA 4U7DA 3DLLF 4AUXA 3BR3A 3N05A 4J00A 4NNJA 1QGPA 2V9VA 3A02A 3IEMA 3IV5A 2FU8A 3Q9VA 2W48A 2EZLA 1ZKPA 1KZHA 1S6LA 1FSHA 2P5KA 2FNAA 3A0BC 1MZBA 4M73A 3H5RA 4NQ4A 1HKSA 2CFUA 4I76A 4JX6A 1RR8C 4Y3OA 3S93A 4ITVA 2V26A 3CC7I 3TQNA 1T8IA 2IVMA 3IWFA 3X2XA 3GX4X 4KISA 3KETA 4GYGA 1W7PB 3OYGA 1DD6A 3ZOBA 4HBLA 1WRAA 1BC7C 1BI0A 5LGTA 5FGMA 2H09A 3I13A 4UB8C 5GAHJ 3F23A 1FBSA 1TNSA 3V8JA 1T33A 1KGSA 3CCLI 1ZREA 4A3DJ 5H2FC 3W3CA 1RUOA 3OR1C 2Q42A 2COMA 3QRFF 4CDGA 2XPVA 2AXLA 2BVMA 3GTLJ 1X8HA 3KP7A 4X0GA 4LFUA 2DPUA 3ZMVA 2OTJI 1B4AA 1XDUA 4XK4A 3UKGA 1FYLA 4BBRJ 1HKTA 2BTNA 4B48A 1X3WB 3X2YA 2EV5A 1T0FC 1MNMC 1SANA 2QINA 2R5YA 2AXTC 5FLXK 1UHMA 2LDUA 5DYMA 4A2UA 5AONA 1S8NA 2R7QA 4OIPF 2KRCA 2XSDC 1K79A 1E3OC 2PJRA 3ZWFA 3F6OA 3DKXA 2RNGA 1U78A 1ERDA 3BTCA 5K5QA 4WWCA 2EFOA 1TWCJ 3IKTA 1OPCA 3CUQB 5TRDA 4BXFA 5J1YA 4AIKA 3JR9A 2A07F 2CFZA 3ABUA 1U8RA 1ONVA 3FXLA 1M1EB 1FC3A 1MJ9A 4XKCA 1N75A 3NEUA 4RM3A 1XTAA 3CLQA 1R9TJ 2OJED 3MD7A 2JK3A 4LK1F 1XGOA 2X6WA 4BEHB 1O3QA 2YX7A 3K7AJ 2I7TA 4I2OA 5AHOA 1X2MA 3U9GA 2LOOA 3R6SA 2V4JC 3L2RA 5JLXA 2XIGA 2R0QC 1ZG5A 4ABZA 2L9SA 2TRTA 4EGYA 1LB2A 2ESNA 2VQLA 3KIOA 4KA4A 1USTA 1YITI 1ETQA 1ZLKA 3PFYA 2MG4A 3VOEA 3S2HJ 4FX4A 3A03A 1FJLA 2DQLA 2XKPA 5FLMJ 1S9HA 5DCMA 3CJQB 5EGOA 1TWGJ 1T95A 2K9MA 2KIMA 2KRHA 2WAQA 4L9VA 2RAEA 2CQ7A 4C3IJ 2VPRA 1NK3P 4N4NB 1B72A 2XB0X 3LSMA 1FX7A 1QVUA 4BJTA 2RGVA 3I9V2 2XF5A 2OBPA 1XX5A 2WADA 3HM5A 5HLIA 3OSFA 2CGPA 1QZYA 1R6RA 3FKJA 3MN2A 3LQRA 1IUYA 5LCAA 3EDPA 5LD2C 3JTGA 3BR0A 5AHRA 3TW7A 3QWLA 1MH4A 2PJRB 4XWTA 2GA2A 2G7HA 3CMMA 3GZNB 3DHBA 4L18B 4ZH4F 1I6XA 1UFMA 5B3RA 1KR3A 2YHEA 3L2VA 2OCEA 1ZGAA 1SAXA 3PUFA 3WODF 3GTPJ 1IRFA 5E8IA 1MDMB 3QAHA 4PJ0C 1RIOH 3ZMUA 2DOEA 1LEAA 2FBIA 4HZFA 3BK1A 4UUTA 4EYLA 2BEOA 2PBIA 4DZPA 3HGYA 4NQ5A 3Q0WA 1IZ1A 2DXIA 4UUSB 2PG4A 2PQ8A 2X1EA 5DCFA 4C3HJ 1BW6A 1WJEA 2KISA 5EVDA 2DMQA 4BXXJ 5GAGJ 1FY7A 2DMPA 4LG3A 1BJZA 3KYLA 2VT3A 3HYIA 3HJEA 4YELA 2IXSA 3N4MA 2BY1A 4AV7A 3WG7H 4K2EA 4BYYA 3I0VA 3P5JA 2K3PA 3P7NA 4DBQA 2A6HF 2LVSA 1DGRM 3DEUA 2ME0A 1IJWC 2HWVA 4P5OA 5F1JA 4EM1A 4LIVA 1K07A 5ERIA 4JP0A 1L9YA 4D1VA 5LMCA 3H5NA 3OYLA 1Y56A 2IW5A 2EV6A 3O8HA 5EEAA 1ZYRF 3ZQFA 4BJ6C 2MD0A 4KMUX 2IA0A 5ACXA 4I99C 3AF6A 3KE2A 3M8EA 4BEHA 3ELKA 5FJ8J 2V9KA 4IHVA 2R7WA 1B72B 5TISC 2AS5F 2R7UA 4IQ4A 1UB9A 2F5DA 4QSHA 5LLDA 3CDHA 5FRMA 1WSUA 4II3A 4G6DA 3DH8A 2BYVE 4XSXF 3DXJF 2MGQA 4TV7A 3RQ4A 2YR2A 5HLTA 4YFNF 2JVGA 2YNTB 1P7IA 3CUQA 1HSTA 4PZJA 4ZC3A 2Y8BA 2ZNBA 2MC4A 4EV0A 3F9OA 3IOFA 4A6EA 1J59A 2QF7A 3G71I 2D2WA 3DFGA 1VQKI 2VQGA 5C4XJ 1P92A 1U9NA 2HKXA 1DU0A 4G7OF 4AYBA 1L3LA 2GM4A 1STZA 3W2AA 4IHSA 3I58A 5CVIA 1BW5A 4GYUA 1Z7UA 4M3GA 3HOZJ 3HOVJ 5F6FA 4TZ9A 2MABA 3AG2H 3QOPA 4XR6A 2ZBKA 5EH9A 2BXZA 3HBLA 2FMYA 2VUMJ 4ZZLA 4DYCA 2HQNA 3JW4A 4CZCA 4KEQA 4FHTA 4I98B 2YNTA 4XN0A 5FKOA 5IYDJ 5DD4A 2CSOA 3U1KA 3GTKJ 3A01B 4LLNA 1P7JA 1UG2A 2BZTA 3KCCA 3VYRB 4A6DA 4D5FA 5AJLA 1O57A 3KP2A 1A6QA 1PP7U 1BOAA 1HOMA 5LRSA 3V7RA 3TW6A 2G0EA 2YS9A 1D5YA 1RZ4A 2A3SA 1CQTA 2JTVA 3DF8A 1KU9A 4F52A 4ZEJA 3GLLA 3KX2A 4ZYHA 1YTYA 3EETA 3F3XA 1AA7A 1BJAA 5A2QZ 2X48A 4BY1J 3OS1A 1YFHA 2BFLA 5D8LB 2V7FA 3R4KA 3UNGC 1YW9A 2OPTA 2M30A 1X8GA 3OR2C 5EVKA 4C9YA 4NQWB 2ISYA 2WA0A 3R0AA 4BU2A 2WYMA 3H3ZA 4D1TA 2NVTJ 5BNGA 1XDSA 1R5GA 5HS8A 1IN7A 3K0LA 2KRFA 4RAWA 3QODA 4DOZA 1AU7A 4ESBA 2IS2A 2VKDA 5EG0B 3LNQA 1QU3A 4UWSB 4IEJA 4XLAA 1ETVA 5B15A 2HOEA 3I71A 2VONA 1MBJA 2V1NA 4IJAA 4JBAA 3FMRA 2DYSH 2UXNA 2X0LA 3IE2A 4AX1B 1U6GA 3FMQA 3LSGA 1X2NA 1VJNA 5A2QK 4RAFA 2H8RA 4B43A 4B4CA 2I7VA 4ZYEA 2PMZN 3ZMSA 4F6ZA 1XTOA 3QU3A 2BHZA 4GCWA 4I0AA 3QPLA 2VQCA 5EEGA 1R36A 1O3SA 1TTYA 2DODA 1R5HA 1S5LC 3AKZA 2YX4A 4C09A 3IRRA 2JRMA 4KICA 2H6AA 1IN4A 2XGXA 4L9NA 3H0DA 1E3PA 2IGOA 2GFKA 3ULQB 2QKLB 1ZR2A 1Y0UA 3FF5A 3W2WA 1K6YA 2IBDA 3G3ZA 1IXSB 3FXJA 2M5WA 3MKZA 1IDZA 1MIJA 3GTGJ 1U2WA 3DTKA 4IKFA 2P18A 1TW3A 1ETYA 2JUGA 5AIPA 3MD2A 4QPOA 5EZHA 1OYIA 2QCOA 2Y0MA 3KP6A 3FXQA 2IGMA 2EIJH 2ZJQF 1NTCA 1HKQA 1WGXA 3QP5A 3IUOA 4IXAA 3DKWA 1Z6RA 1U8BA 1OCZH 5D5UB 1V3FA 1IUFA 4UBQA 2OU2A 4M6YA 3SW3A 2JWTA 1R71A 1OCOH 2L4AA 4W1UA 4EMSA 4HV6A 4IPAA 1JKRC 2M5CA 2F4IA 4B09A 1F9NA 2R5ZA 2R5YB 3W2VA 1TT0A 4G6TB 1W5CC 2RN7A 2VC0A 3QOEA 4AIHA 4EJOA 5ILVA 4RBOA 1W0UA 4EQQA 3K10A 1W5TA 2EQRA 2OHIA 3DCFA 1RKWA 3WTYC 4A3IJ 2AQFA 4M72A 5FLXZ 1GV5A 2KQRA 2RVCA 4LITA 4ZTFA 1X1DA 4YFKF 4J5FA 4ZDLA 1HW2A 3K9TA 1PUEE 2IS4A 2KKOA 3FHZA 2WAEA 1K7AA 3BG6A 3A2KA 3SZPA 2FQ3A 4KIGA 2TCTA 3BV6A 5IOZA 1GHCA 1UZCA 1G3TA 4HX8A 5JVTA 3FK7A 4V2GA 5AXOA 3VPRA 1BMCA 1E5DA 2EK5A 3B02A 2H1KA 3VWBA 2HQRA 1R7JA 4HNUA 3JSPA 2EA2A 3RZOJ 2DFIA 1GVDA 2R7DA 1FPQA 1A6IA 2AO9A 2BGAA 3WHBA 3E3VA 2VKHA 2FU4A 5KK1A 1JUSA 2CFXA 4NC6A 5E1ZB 2ZNZA 1CF7B 2XF4A 2DJNA 3BQYA 3IEKA 4KDPA 4HF2A 2CU7A 2VXDA 2HVRA 4FASD 1I39A 1YJ9I 4BXUA 3K70C 1VQMI 2HYFA 3U1DA 3RKKA 2X1CA 4B47A 4DILA 4XL9A 4JK1X 1M2XA 5D5XB 4YFXF 3NWTA 3J80Z 2KL4A 4RB1A 1DPUA 1N77A 5ACTA 1FOXA 2P81A 2M9HA 3I53A 3G1OA 5HIPA 4CCKA 1YI2I 1R5ID 1HW1A 2GCUA 2P7CB 1X4OA 1Z21A 3H9QA 3GO5A 3JXPA 5BPDA 3CMAI 2O0YA 3HC7A 4JO0A 5FB2A 1WJ5A 4X1EA 3D1NI 3QU6A 2FU7A 3CCUI 4WD6A 2ADUA 4XLHA 3DTEA 4B8XA 2KZGA 2KJCA 2FK6A 1XMAA 1IRXA 2QWWA 5L3EA 3MZHA 4M9SA 4B87A 1Y39A 1WHUA 2IP2A 3BLYA 4Y15A 4FTHA 1GLNA 1WWXA 2RDPA 4HSRA 3EQLF 5K7HA 1P4WA 2C6YA 4KFCA 4EJVA 4DIKA 1YW8A 4OIQF 2G9WA 2EA4A 1Y1VJ 3MVPA 5F64A 4CA0A 4IOAF 1I6HJ 2FXAA 2BC2A 4B3XA 2CYYA 2NXAA 5LCHA 1WVRA 1G4DA 3WTTC 3QP6A 2YPRA 2B0LA 2XAUA 5F08A 2VODA 2YNVA 4U87A 4L0ZB 1YQAA 2XKOA 3CF5F 2RREA 4XQFA 2Z3YA 4DYQA 3R0JA 1FYKA 2YNVB 3KEQA 3CJRB 3HOYJ 4XLNF 3OS0A 1BN5A 3V8KA 1U0JA 4GGGA 1X3UA 5K5RA 3KEYA 2XC7A 3ZQ4A 4DYRA 1MSEC 2M87A 1PP8F 2VI6A 1T0FA 4Z6XA 3OIOA 2FNPA 3Q6VA 1POGA 1KO2A 3GCMA 2OA4A 2EJRA 2FBKA 4I0BA 4LG0B 2KP6A 3HRMA 2ME6A 2HGCA 1B6AA 2XAQA 2LD5A 1TWAJ 1R4MB 2LBFB 2BFZA 2IRFG 1MNDA 3VSKA 1MJBA 2H1LA 4BNCA 4E70A 1RETA 5EWAA 4XRSA 4NDLA 5B66C 5B1BH 3CF2A 3PY5A 2FE3A 2FX0A 4HL2A 1BM9A 3FHNA 2NVUB 3BCAA 4HV5A 1F5TA 2B63J 2R3SA 5LLQA 3AL0C 3GTMJ 3DEEA 3K4MA 1VMEA 1OCRH 4E7LA 3GUDA 4ZYAA 2HEOA 3H3EA 4TYFA 4F91B 2EFWA 1KA8A 4XKBA 3AG4H 1BBYA 3FKIJ 3TP0A 1GVJA 1JE8A 1LVAA 4IF4A 5BOXA 4V0HA 2VJIA 2OZ6A 3FX3A 4IRHA 1OMIA 4PUSA 2ZZIA 5DPXA 1VQNI 5IT3A 2LMDA 3DWLE 2EV0A 3OMYA 4HRIA 3LA7A 1A5JA 1SVOA 1LE8B 2M1BA 1LPQA 3CC4I 1YCFA 4OAYA 1X1PA 3CCRI 3BTLA 4FEKA 2TDXA 4HDUA 4A3LJ 3OOUA 1ACIA 3WE3A 1XSVA 4HEA2 3V7CA 3PJRA 1K61A 2WB1N 4U0VA 3RKJA 1G3WA 4U7BA 4YEJA 2Y9YA 1MBFA 4EJUA 3EUHC 1VQ9I 1HBXG 1QHGA 3ABMH 5E17F 3KZYA 1D3YA 1ENHA 1VNDA 1XB4A 1XSDA 3J7ZI 5DM7F 2A61A 4D7MA 4FQGA 4XRSG 1RI7A 4GCVA 4CHLA 4OINF 4CHUA 2ZWRA 2JSCA 1A31A 3E97A 1EH7A 2LF7A 1T6SA 4G9YA 4NB5A 4XLEA 2BFZB 4Q47A 2R93J 5D5VB 4EEFG 2F5VA 3BG5A 2Y9ZA 2FHXB 2L7ZA 3FAIA 2GIVA 3C18A 1K4SA 4NBQA 2XDVA 2FBHA 3V42A 3WGHA 2O9LA 1U5TA 2F48A 3KZZA 3REOA 3CO6C 3CCQI 5EV6A 2CUEA 5K4KA 4M3FA 3HOUJ 3LFUA 2HR3A 3GZ6A 2R7TA 1S3JA 4JYKA 5TGTA 5DS9A 1HQCA 2K9SA 5GADJ 3O2PE 2DMTA 3OYAA 3WXCA 1BR4A 4LG0A 2EBIA 1EH6A 4OU0A 3Q5FA 1Z3XA 1UMQA 2GOXB 4R8HA 2VOPA 2L4MA 2KJBA 3I4NJ 2ZXJA 2DOOA 2QJSA 5KIKA 5A0TA 2VB6A 2CRGA 3GMEA 3JAMZ 4BGDA 5J1UA 2GAUA 2VC1A 1MGTA 2DTRA 2FA5A 2XAFA 2YNWA 2P6TA 2X85A 3CCEI 3CQZJ 4V19K 2LTPA 5LEKA 3HG9A 4CZZA 3JRIA 2ZJRF 1ZK8A 1R22A 2KIQA 4I6ZA 5L3BA 3MKYB 4G7HF 2W4SA 3FK6A 1Z05A 2DFHA 3TDZC 2JA8J 2DK5A 5IP7J 2XAHA 5E3LA 1D5VA 1QNTA 4L5IA 4UUSA 2KT0A 1G3YA 3E0JB 2VL8A 4BL0B 5ACRA 5F27A 1R49A 2MBFA 2Z2SB 4GFBA 6PAXA 3BROA 1FLIA 5HH4A 1DP3A 2L9RA 3M3YJ 3HB9A 4Z67A 3F22A 4U0YA 5JVGF 1YE9A 5F0HA 4H0EA 2DDBA 4BDZA 1QPMA 3CCVI 3K69A 1ZAOA 4C1DA 2CQKA 3MEXA 4LGWA 3S1QJ 2K85A 2OZUA 3NQOA 3IAM2 4CXFA 1LVKA 3PO2J 4A0XA 3BWGA 2DFEA 3IRQA 2CG4A 5D4RA 2EFNA 4JQFA 4IX7A 1P2FA 3MQ0A 3SPUA 4OMZA 1CF7A 5ACVA 4M74A 3A1YA 4QIWN 1T56A 1F36A 1X3ZB 1ZGJA 1K83J 3MZYA 2XV4S 3IC7A 3RZDJ 4TZEA 4HPQA 4MEYF 4RB0A 1QH3A 2VJ4A 2FRHA 4D9JA 4Y17A 3G1MA 2BVLA 4CH7A 2M5DA 2K4JA 4MFEA 4QWQA 4WXDA 5CVRA 2ZJ2A 3L1PA 1TZLA 1I3QJ 4F7ZA 1VQ6I 4RBSA 4YSLA 5J6XA 1ETKA 3MCZA 1FMWA 2OQGA 2E1CA 2Z99A 2X1DA 2L01A 4A5MA 1TW2A 1YS7A 3S3MA 2BIBA 1D0XA 3CUQC 5E8GA 4EXYA 4IHTA 3LAPA 2PJPA 2OHJA 1RC9A 4S0HB 2WAFA 1R1TA 4A0ZA 4HNTA 4AXHA 2MH2A 2YU9J 3TP3A 3PSIA 2STWA 4D02A 4RB3C 2RV8A 1WH7A 2P8TA 1B8IB 2FU9A 1QZZA 3ABTA 4OMYA 2JZYA 2F4MB 1WJDA 4N0BA 3LVZA 3DBHB 2VIXA 5E3NA 4A5NA 2K3FA 2E35A 3HUGB 2VW8A 4G12A 3L2CA 2V6CA 1Y8QB 1YIJI 4E7KA 2ZCWA 5EV8A 3K70D 1MH3A 1TP4A 1A35A 2E1OA 4PK4A 4HLYA 3M1EA 1OFCX 2MH9A 4CCNA 2V6EA 4PVTA 3J81K 2ZB9A 3M8FA 2DT7B 4BKXA 4C2MJ 4BACA 1D1AA 2UZKA 4CCOA 2CUJA 1ZARA 2NXNB 3GFLA 4C3JJ 3ERED 1BI2A 1TBXA 3VPEA 1H88C 3F21A 1LUJB 1ON2A 4RLFA 2L0KA 2RKHA 1YCGA 3OYNA 2Y0SA 4B1RA 1X1CA 2BW3A 4V2FA 2CWEA 3CCMI 3FWEA 2PMHA 1IN5A 2Q2EB 1E0EA 3E5QA 1F1ZA 1YOVB 4IRGA 3VODA 4XICA 1FEXA 2LYCA 4ZNBA 2K5CA 4D1UA 2MSYA 2GKLA 2NS7A 3WGIA 1XGNA 1H9GA 2XGCA 2JA7J 3BDDA 2A68F 3HUGA 3MWMA 2CFOA 1FIAA 2W25A 3BR1A 3GLXA 4RM2A 1PUFB 2M3AA 2CG2A 4ZO2A 1Z67A 3PM1A 2JA6J 2NS8A 3WTZA 1IW7F 1SAUA 3RYRA 2RNJA 1IDYA 2CV0A 2VBZA 3WHCA 1O4XA 2V1XA 2KLOA 3DPUA 1JUMA 2GZWA 2LY2A 4H0DA 4DJAA 3ASOH 1GT0C 1XMKA 1K78B 1B8IA 4AIJA 2Q2EA 2V9PA 1W7PD 3SFPA 5DEQA 2Z33A 2HPMA 2JA2A 2HTSA 3OSGA 4OIOF 3NRVA 3S14J 4MIMA 3U21A 3DP7A 3LSTA 1S7OA 2PN6A 3IDZA 1VQLI 5JHFA 4HW0A 2O03A 5HH6A 1OR7A 3RPUD 2HZTA 2HKOA 4A93J 5FFXA 2CW8A 2LLKA 1IV8A 4LB6B 4L0YB 4DZJA 5DUKA 2PX9A 3S3NA 1AWCA 2YU3A 4S04A 3BR2A 1J7KA 4PSWA 2GFJA 2CUZA 1ZG1A 2BY0A 2EILH 5ICCA 3I55I 3SEQA 1ZNBA 3TBIA 3ZMTA 4BHBA 2M2EA 2P5VA 3F6VA 3MFKA 5B3SH 3CMEI 3F0CA 4BH9A 2VN2A 1PVEA 5K5OA 5FQBA 4HA8A 3ABKH 1VFCA 2MYSA 3H3UA 3M7GA 5J4YA 4M9XA 1OR7C 2KZVA 5J40A 3RPCA 3HOSA 1U3EM 3COAC 2NOGA 4XNFA 5FD5A 1BI3A 1T38A 4LLGF 5CYVA 1QHHD 2L7KA 1VGNA 1VQ4I 4C1CA 2P4WA 3DBRB 4Z6YA 2LK2A 1JT6A 4XORA 5LHIA 1SMLA 1BC2A 4B44A 1WH5A 1YX3A 1HA8A 1QO0D 3J7AY 3KNSA 1TLHB 1O3RA 4XUKA 4XOTA 1EH8A 5D4SA 4GDFA 1SVLA 2GWRA 4AC0A 1XGSA 2EWNA 4M3DA 3GYHX 2PFBA 2ZFUA 2R7RA 2IAIA 1S72I 3FM3A 3WE2A 5ACWA 2HVQA 1GUUA 3CCJI 4O98A 4BQQA 2Y0SN 3GZ5A 2LBFA 1LE8A 1B1BA 2JPCA 3JSOA 2A5YB 2UV1A 2JRTA 4ZYDA 2LY9A 2A05A 4N9HA 1AOYA 3DLAA 2Y75A 3IP4B 1SFKA 3K6GA 5CQEA 4ANJA 4AVZA 2WHGA 2QM3A 2CS3A 2H8WA 3T8RA 3GF2A 2DCEA 1MDMA 2OF7A 1YCHA 3HPGA 4RB2C 1LFPA 2DO7A 2GLOA 2UXXA 2QENA 1EKEA 3L9FA 3ZP5A 1ZHFA 2Q9UA 3SBLA 2QEDA 4MHGA 2IJLA 2CQNA 1JT1A 3FZVA 3F72A 4ZZDA 1TNTA 1ETXA 1LFUP 3LOCA 3QH8A 5EVBA 4NC7A 5FKLA 4EYBA 3JRCA 4BUPA 3FISA 2MW8A 4M6VA 1SFUA 3I14A 2QZ8A 3GBGA 4JOMA 1SVMA 5HLGA 1QBJA 1G6NA 1OYWA 1H9TA 3BZCA 1P9QC 3RSNA 2ZXIA 4C1EA 2XSJC 3BG9A 1UAAA 3K4BA 5K4NA 3N97A 2NNNA 3LL7A 1SC7A 5LSCA 3BC2A 1HDDC 1ZTRA 4YIIA 2BR6A 3ECOA 1BI1A 2R5ZB 3K4NA 4EFZA 1IGNA 5EJCA 3G1LA 2GQQA 1U5TC 1R1VA 5EEHA 2W7NA 3G73A 2P7VB 2XAGA 3K1PA 4FSBA 4ZO3A 1RPWA 5IP6A 3JREA 3EYIA 3F8NA 4JX4A 2EH3A 4C2UA 4QLCU 3OIPA 2W84A 4FE4A 1WJCA 2QSHX 3KZIC 4DW6A 2OC6A 2HDCA 3H5AA 4R1HA 5A0VA 3S1NJ 1T98A 2I10A 2AIOA 3T9MA 2KDOA 5E1XA 1J09A 1EJ9A 3K4KA 5IT9Z 3CO7C 4AX0B 2QSFX 5B1AH 2ZSHB 1MMNA 2F6CA 5EDNA 4XONA 4XN3A 1ZRDA 2W24A 2ELJA 1IN8A 4DIQA 1LDDA 4UVBA 5GP9A 2JA5J 3G6EI 5L3FA 1ODDA 4Z5YA 2WRSA 1ON1A 1IRZA 2JJ7A 1OJLA 3T3OA 1J5YA 2HVSA 2ZMEB 2GIZA 4O6JA 3I15A 3JRFA 3CP2A 3FXUA 3S1MJ 2O61A 4D1QA 5E3OA 1K4TA 3ZNBA 2JQ7A 1HLVA 2BFKA 2L2OA 2F5CA 1Z0XA 2VE8A 3PY6A 4DBRA 1XSXA 2QVOA 1BIBA 1D8KA 4UWRB 1ZN2A 1EA3A 1OCPA 2VJJA 1VZ0A 3HSFA 2F5FA 4D7NA 5CLSA 1IO2A 2HTJA 2DTZA 2J5PA 5ACPA 2A69F 4RAZA 1HC8A 1BVTA 3KP5A 2MC3A 4CCMA 1WKMA 4F6HA 1MQOA 5BPIA 1YYVA 2Q0IA 3D5LA 3LSKA 1KQ8A 2HXOA 5KVRA 3CD6I 1QH5A 2QDTA 1DP7P 4NQ6A 1Q1HA 3IL2A 4KN4X 1H0MA 2QA4I 2FJ1A 3T0YA 1GXPA 2CQQA 1WW1A 2ZNYA 3OYCA 3BJOA 2DA4A 3SJMA 2EB7A 3BY6A 5HS7A 4EVIA 3ZQLA 4XKVA 2HU9A 4JX5A 4WF2A 5GPAA 2DMUA 3ZQQA 5BQTA 5M5XJ 1G59A 4AWXB 5CVVA 1G2HA 5E1WA 1KYZA 1MMDA 2CQXA 3HZJA 4I02A 4PSXA 2ECBA 4AM3A 2DN0A 2EIKH 3CDLA 4Q5SF 2JUCA 2NOJB 2BHYA 3D0SA 3WTSC 4PJNA 1VF9A 4RGSA 3S2WA 4BP0A 1TC3C 3FXRA 3P9CA 3HOWJ 1V5GA 4Y4RA 1V5EA 4R79A 5L3DA 3FDYA 1KQ9A 1AHDP 3KP4A 2PI0A 3LMMA 3Q0UA 2NNYA 1DGWY 1P4AA 2QGUA 4BHCA 3QYBA 5IOYA 5L3CA 4U4LA 1SFXA 3QPTA 4UV8A 3TL4X 5BS6A 2Z5UA 4ENJA 2VOOA 5H6RA 4RGUA 1Y1WJ 3VB2A 4F55A 3B6AA 3F8FA 1VQ7I 4PDXA 2L5QA 2NS0A 2BBYA 2ZO4A 3OWTA 3ZQHA 3GVAA 2ACJA 1R23A 1NH3A 1AKHA 1J9IA 4XLPF 4A3GJ 1G3SA 3OYKA 2BG7A 3OYEA 4NHJA 2B9SA 3C2GA 4GYQA 3WGGA 2I7XA 4UUVA 5EGOB 3C2HA 4L5EA 2BY2A 4Y7NJ 1YHQI 1BC8C 2YUSA 2ESHA 4YIRX 2NAZA 1IF1A 1NK2P 1FZPB 3EUAA 1P4XA 2EZHA 2HB9A 1ITYA 4EM2A 4LK0F 1R4NB 2E60A 4E7ZA 3BTJA 4KUMA 4PJLA 3I11A 4S05A 2VQHA 3Q0VA 3SYTA 2FF4A 3SZTA 1ORKA 1JKOC 1YS6A 4M9ZA 3R61A 4E7SA 5ACUA 3DQVC 4XRFA 2R7OA 3S0ZA 3IKVA 4BE2A 4YSBA 4PDKA 2OV7A 3LA2A 1MBHA 1NHAA 1DPRA 1K78A 3K4CA 3CC2I 5IP9J 2E7WA 3BP8A 5KAFC 3P9KA 5LHHA 3L09A 2JMWA 2HS5A 4LD5A 3CCYA 4H4KC 1FBUA 5J8FA 5EW0A 4AIDA 3FM5A 1ZELA 4A3KJ 3I4MJ 2L3DA 4HYEA 4E7HA 1JHHA 3FCZA 1U9OA 2QKMB 5LS3A 2GXAA 5K4MA 4HAMA 4BQOA 2YZ3A 1O7LA 2PEXA 5ICFA 3I4PA 2DA6A 5FO5A 5FROA 4BJ5C 3E5UA 5LGNA 3K1NA 3PNTA 4UV9A 3ZXSA 2P4ZA 5IY5H 1U5TB 3AF5A 1V5FA 2IEKA 2CV1A 3TDUC 3GTQJ 3NWSA 4PFOA 4A3FJ 2E19A 2DK8A 3G4SI 1TQPA 3OYHA 3VSLA 2KIUA 1MKMA 4MEXF 1D0YA 2DJIA 4UWOB 1BIAA 1V4RA 3E1SA 3V7SA 3FBIB 4ASNA 4L9JA 1LJ9A 2LKPA 2L54A 2QUFA 3VYTB 2H6BA 1LKXA 3CJNA 3RCOA 3HL2A 5LRRA 2XROA 1GDTA 4CYDA 2DT5A 2FSWA 2H94A 1JHFA 3QYEA 5M3FJ 2R92J 4ENKA 3LSIA 1MW7A 4I01A 2NZFA 3O8GA 1LFBA 4YIFA 3OOPA 2Q1ZB 1GV2A 4M3BA 1CGPA 4QPQA 3SZGA 4BAYA 3GFIA 3GFMA 4IRIA 1LEBA 2ZSIB 1H8AC 1L0OC 5HOOA 1XM8A 2QYOA 4IQJA 1SD5A 1ZH5A 2KDZA 2VJ5A 3SDGA 4FE7A 3TOAA 2AHQA 1FWZA 2LRDA 2XRNA 3K1MA 4PGHA 4Q48A 4EYFA 4RAGA 3D5RC 4AU7A 2Q0OA 4EM0B 4ZTJA 4ESFA 1RRJA 1WZ2A 3ZN0A 3LQQA 3DBLB 3MZ8A 2E1MB 3RJPA 1SMYF 3C3WA 1S7EA 2HPIA 4KMFA 1OYYA 3I59B 1XN7A 3OYMA 3LSHA 3BG7A 3GTOJ 1JXSA 3HXLA 2EIMH 3I56I 1WJAA 1SMTA 4AYBN 5HH5A 4L5JA 4XRMA 4QTRA 2E2HJ 1FMVA 4FX0A 3RDIA 1LDKB 2ZC2A 2NYXA 2X6OA 3TEDA 2BV6A 1IN6A 4ZJZA 3KLNA 2BMIA 4FETA 2FD5A 2ZMEC 2K86A 4HKYA 1LNWA 4UNOA 3I5UA 2V79A 1HW5A 2A6TA 4Z5ZA 1VI0A 3FIWA 2DW4A 4MQ9F 2HYGD 3OS2A 2XF6A 4WCGA 3TOBA 2NVXJ 3CDIA 3KEOA 4XIDA 1C0WA 3ZR9A 3BQZA 2L9VA 4II2A 4EJTA 2K9QA 2HOTA 3AJ3A 1WQ2A 5AYAA 1UELB 2ISZA 2P0WA 1X4PA 2ECCA 4OIRF 2ID3A 2IS6A 5LGUA 2EPFA 1OISA 1JUPA 4KN7X 3LWFA 3TO7A 4MGRA 1G8XA 3P9IA 2WWYA 4BQNA 4XKWA 3T3NA 2DT6A 3BC8A 3LFKA 2NRAC 4EJWA 1XS9A 3IAS2 4AVPA 5B5EC 3E6CC 3H3VK 1X58A 2YCBA 2IA2A 3NAUA 5F04A 2IGNA 4Y13A 1YJWI 1WI3A 3ML6A 5HIQA 3K4LA 3KYDB 4Z7RA 3HOXJ 2ZKZA 1OCCH 4MO7A 2FEZA 3H9JA 3V8LA 3RKXA 2PLYA 5FFZA 3T5XA 2R7FA 3VDXA 1JTYA 1XC5A 3A01A 3OL3A 3SEZA 4PGGA 2M0CA 3R60A 3H9GA 1AKHB 2ICWG 2M34A 2RC4A 2K9NA 3KLOA 4LIUA 2L9NA 2ZMEA 2E1MC 1VQOI 3A0HC 4RMNA 4CUGA 3TKYA 2WTEA 1BR2A 5LCFA 1XGMA 1QPIA 2D1HA 4IHXA 5M5WJ 1SEUA 4LOCA 3I54A 3HOTA 5IYCJ 3DPLC 3LSPA 3ZGKA 9ANTA 4U88A 5JR3A 1MBEA 1W36D 1YRNB 2IA1A 5E18F 2DPDA 1I27A 3OIQA 4KEPA 1PJRA 4XLFA 2IS1A 4WXHA 2V1UA 1QZEA 1WPKA 2OQRA 5FRNA 1RR7A 2XF7A 5IQKA 3S3OA 2XPUA 3IE1A 2UUZA 1TT5B 3B6CA 3F9KA 3QYFA 4ZDPA 3ZMDA 4P1WA 3S15J 2O5RA 5J1RA 1WUPA 1X1AA 4PVOA 5LE1A 5C44J 3WU1B 4G8XA 5AIQA 2K7LA 5M5YJ 3HHHA 1YJNI 5BMZA 2OCCH 2DU9A 2VKVA 4A3JJ 3IWZA 5GTIC 1SFEA 1JI8A 3OYFA 1FSEA 1TWHJ 4YG2F 1I5ZA 1JT0A 4MTDA 3EUKL 1YX5A 3VEPA 3OYBA 5B1UA 1V55H 5FD6A 1BR1A 4NC8A 2MLGA 1SFOJ 5FQCA 2HQ5A 5F1RA 2E71A 3PNYA 3L2UA 3S32A 2IPQX 3QPHA 3E6BA 4GRIA 1X8IA 3CZ6A 2E7YA 2KIFA 3WG9A 4P55A 5FKMA 4BDYA 1NG7A 2Y48A 4EATA 3O6BB 1V54H 1BL0A 2VT2A 1MMGA 1Z3YA 3HTUA 3OY9A 1WUOA 2L02A 2VASA 4FT8A 5HDGA 2Q0JA 1BA5A 1O3TA 1IXRC 1UHWA 1QQIA 2D1VA 3S8PA 2H27A 4YRVA 1P6RA 2EFPA 2M8EA 1J75A 4CYCB 2MFZA 3TMOA 3TP9A 3FXOA 5FKKA 2M45A 4OOIA 4I09A 5K1YA 2FQ4A 4FISA 2HNHA 2M0MA 4AD9A 1HF0A 3HKZN 4RL2A 4RAMA 2Z16A 5EHTA 1A8TA 1FOYA 4ENMA 1OLTA 2E36A 5IPAA 2W82A 2E34A 2BY3A 3IELA 1B9NA 4GO1A 1FTZA 2BG2A 2WYLA 2BXYA 3ESWB 1FNNA 3OYJA 3HDDA 5J8CA 1WCMJ 3M1CA 1MMSA 4KITB 3CMYA 4L9TA 2JT1A 1OCTC 4LMYA 3PL8A 3WTUC 4XSZF 3QQAA 2FOKA 3PIOF 2DKFA 4RM5A 4YSKA 1HDPA 2HXIA 5CVUA 3TGNA 1I1GA 4J19A 5HNHA 1JGSA 3HRSA 2DMNA 4UY8I 4BHPA 3E6DA 5K0WA 2R7VA 3HRUA 3SRXA 3VQZA 2LR8A 4LE6A 4CO8A 5HDKA 4UVAA 3L6NA 1UJ8A 2HFHA 1YO5C 3ECHA 1WFXA 3MKLA 2JVHA 4ZYGA 5TJJA 4G7ZF 2DA5A 2RQPA 2X6YA 3EYYA 1B9MA 5IYBJ 3U2RA 5H20A 3PIPF 3EUHA 2CH0A 2KFDA 5DDGA 4Y52J 1F4KA 5ACSA 4B3AA 2XGEA 5E20A 4A3EJ 2DA3A 3ONQA 3HTSB 1PYVA 1WJFA 3I3LA 2CMPA 2ETHA 3RPUA 2K27A 4PCQA 1MNEA 3VFZA 5ILSA 3H36A 3CJTB 5GPCA 5D6EA 2B7EA 2O8KA 2K02A 1Y0NA 2FOWA 2LSOA 4XM3A 1W7PA 1MSFC 4F3QA 2R2DA 3M8JA 4EGZA 5HIOA 3KNRA 2LC2A 1APLC 3FXKA 1JKPC 2VXZA 4RS8A 4P9FA 2R7ZJ 4HQMA 2LKXA 2XUBA 2K4BA 3IH4A 3KFWX 5IT9K 3T1BA 4U0WA 2LREA 4C1FA 1HXDA 3D5SC 3OYDA 3S16J 2VE9A 5J47A 4UA4A 1I3AA 1ZQ3P 4HDVA 2BGCA 2ZJPF 2Y31A 1JKQC 3IOGA 3PUBA 3I0TA 3RKWA 3DV8A 2A6EF 5D6FA 2FUG2 3P2UA 4XLCA 3HSEA 4MFDA 2MLKA 3S2DJ 3SFZA 1ZRCA 1A36A 1GXQA 3HSRA 3T8TA 4F92B 5HS9A 3QPSA 5KILA 2UWMA 3WTWC 5E79C 2GXGA 1IRGA 4RGRA 1JJEA 2BOLA 1T2KA 2XB5A 4KIFA 4OWRB 1KQ0A 2X6XA 4M71A 2NVQJ 3W6JB 2GA1A 2HZDA 1XMXA 3FMSA 2ZXWH 3HKZA 3IE0A 3MAJA 4MNUA 5HVQC 5L3GA 1UHSA 4A12A 2BE5F 3C1DA 1IC8A 2QEXI 3BR6A 3F8MA 1S29A 2BW3B 3E6MA 1WI9A 3HRTA 5E3MA 3GTJJ 3W6VA 3R2UA 3CLOA 5D8KB 3PNVA 3VYSB 1F43A 3GFJA 2KMUA 4C30A 3WU0A 4M6XA 3DHCA 2LH9A 3X30A 4NUBA 5EF6A 2XR1A 4O5VA 3HEFA 1B59A 3PG4A 4KIBA 2ID6A 5KNLA 1R58A 3ZQIA 3JAMK 3AAFA 2CBNA 4IHWA 4FCYA 3GW2A 1HLKA 2Y69H 4PJJA 1I1SA 1Z91A 3H35A 5ICGA 2MA3A 3F8CA 1NG6A 2HI3A 2Y2ZA 4GYIA 3B73A 3PQJA 5J3LA 5KCMA 4I7HA 4ON0A 4WK8F 3EPZA 1Z7LA 3JRBA 2P1EA 2E2JJ 1T39A 2GXBA 2Q8KA 5DCMB 4HLXA 3DPTA 3BPXA 1RKTA 5HODA 4KJZA 3SXYA 2BG8B 3AL0B 2Z1DA 1QRYA 3VYUB 2E2IJ 2DAOA 1A04A 2VKEA 2PMUA 2LFBA 3BTIA 1IG7A 1O7FA 1MBGA 3LSJA 2D5VA 5M3MJ 2A7MA 4FR7A 3ASNH 2F2EA 2IGKA 2KHMA 5CKTA 2LF8A 2LP0A 3F8BA 3IH2A 1OQYA 4G94A 4RLQA 4E7JA 2O6GE 2R4GA 3BCBA 1Z77A 2AQEA 2P6SA 5DV5A 2WV1A 2R7XA 1TQMA 1RNLA 4DQ2A 1JJ8C 5D5WB 4KNYA 1OKRA 4O3MA 3A4CA 1UG0A 1IXCA 4Z60A 5K7ZA 1MBKA 2HDDA 2WAQN 2D45A 1K6OA 3JRGA 4D1WA 5ILUA 3SD9A 3CUOA 3Q9SA 4XOPA 4NQ2A 4N4OB 2YNUA 2O8XA 1N25A 1E17A 3L2QA 3BJ6A 2VBYA 4UVCA 4UB6C 2EZIA 5HISA 1FP1D 1YG2A 3O3KA 2W1OA 5JLWA 4XBFA 2E7XA 3OYIA 3RYPA 2WC2A 5DD8A 1HCRA 4AWYB 3M9AA 3LSRA 2EZKA 1ZR4A 2XPWA 4RL0A 5FKNA 2FMLA 3ZQCA 5CPRB 5GAEJ 1A7TA 2X4HA 1P9EA 1RESA 2LY1A 2J5OA 5LHGA 3BG3A 4D5CA 5AXRA 2K40A 3GXOA 3E5XA 3IHUA 3SDBA 3W6KB 1FT9A 3PO3J 3JCUC 1D0ZA 2HDWA 2E5ZA 2EINH 2HOAA 1BOBA 4A3BJ 2E1NA 2VPLA 3ZMZA 4IL6C 4P9UA 4E6KG 2FHXA 4PJMA 2KPMA 1YRNA 2GMNA 4D0PA 3RPQA 3RKYA 4A3MJ 2WY8Q 2NZEA 3Q3SA 4UWPB 2DA1A 2ELKA 1W36C 1FOWA 2XGDA 2F4OB 4HF0A 2M4GA 4BQAA 3H0GJ 3G2BA 4RGXA 3L2WA 2LKSA 1FBQA 4BZ3A 1UCRA 1PDNC 2VBXA 1S7AA 1SD6A 5LBQA 5GTHC 3BZKA 1D1CA 2OAZA 5JHUA 1WJBA 4EY2A 2OUMA 3K2AA 4P62A 2DOFA 3JRAA 1SD4A 2COBA 1E2XA 1Y8RB 2CW0F 4HSTA 5LFAA 1FOKA 1WRJA 2QBYA 1ZTCA 3HHGA 1W4MA 5KAIC 3SHFA 2QQAA 3X2QH 1USSA 1FYMA 3NARA 1I50J 1W0TA 2NVYJ 4CSWA 2L7MP 2GOMA 1YIOA 4PFPA 3C7JA 4A69C 5ED4A 4MQVA 1XG1A 3KL7A 2W57A 2OD5A 3JRDA 3ESHA 2AZ4A 5A23A
chains in the Genus database with same CATH topology
2YSRA 4DNCA 1R00A 2DQRA 3X2ZA 5JI6A 4TYTA 2XVCA 3GWZA 1XCVA 4IVNA 3PFIA 4HX4A 2EFQA 4LB5A 2UYXA 1Z9CA 2DI3A 4MTEA 2DLLA 3KP3A 1Z1DA 1MD0A 1DXKA 4NQWA 2V1DA 3RTRA 1XCBA 4LJZF 3ZQ7A 2H6CA 4A0YA 3V4GA 2QQBA 4ETSA 2CO5A 5ACQA 3HIFA 3OV8A 3I64A 1ULYA 5A87A 1IAWA 3L7WA 4ESJA 1HSJA 1YLFA 2FM6A 2FU6A 5LM6A 3I59A 4WXCA 5ICEA 4GXOA 1KU7A 4P96A 3BPVA 2WYMC 4ENNA 2LNBA 2QBYB 1DDKA 3WTVC 5AEBA 3RI4A 3ZPLA 5HLHA 1YW7A 2QQ9A 4AWZA 5CVJA 2JPBA 1J2XA 4UAMA 3K2ZA 4UHTA 5FQAA 2STTA 3WTXC 3CTAA 3DHAA 1VTNC 2G7UA 3LAJA 1J0RA 5CJ9A 2BG6A 4C1HA 4LLLA 1DUXC 3H92A 2BG8A 4N9IA 3RIRA 4HF1A 1RUNA 1KYWA 5H6QA 1Y44A 1REPC 3ADRA 1EV7A 1MJAA 5A5ZA 3JTHA 2ELHA 1KU3A 3L00A 4EXSA 4J5HA 5JFRA 1Z6TA 2XASA 4WX9A 3G1PA 4HX7A 3ZN1A 2IT0A 2Y87A 5DUIA 3J80K 3SQNA 1KO3A 4KT5C 2NYPA 1XD7A 4C1GA 2P97A 3J81Z 1ZLJA 2P5LC 2Y8AA 4CGZA 4HOBA 2F5EA 4CICA 1FP2A 4TZBA 1ZRFA 2OHHA 3PQKA 5LEJA 2MD5A 2XAJA 5HDNA 3LA3A 2QDSA 4XWWA 4HQEA 3J7AO 2VBWA 1SD7A 2ZFWA 3TO6A 1ZG3A 4G6QA 4UXNA 1W5SA 3BZ6A 2DBBA 3GEZA 2QLZA 3ROUA 1TQIA 3BK2A 2O3FA 2WV0A 2XHKA 3BJAA 4Q4ZF 4Z2YA 1LQ1A 2Z9OA 1D8JA 2W85A 3ISPA 1JJTA 3A4YA 1KU2A 4RAYA 4TZFA 1DDNA 4KYWA 3TO9A 1LDJA 4HL1A 1R1UA 3BOQA 4U7DA 1QGPA 2V9VA 3IEMA 2FU8A 3Q9VA 1ZKPA 1S6LA 1FSHA 2P5KA 2FNAA 1MZBA 4M73A 4NQ4A 1HKSA 3TQNA 2IVMA 3IWFA 3X2XA 3GX4X 3KETA 4GYGA 1W7PB 1DD6A 4HBLA 1WRAA 1BC7C 1BI0A 5LGTA 5FGMA 2H09A 3I13A 3F23A 1FBSA 1TNSA 3V8JA 1KGSA 1ZREA 1RUOA 2Q42A 2COMA 3QRFF 4CDGA 2AXLA 1X8HA 3KP7A 4LFUA 2DPUA 3ZMVA 1B4AA 1XDUA 2BTNA 1FYLA 1HKTA 3X2YA 2EV5A 2QINA 5FLXK 1UHMA 2LDUA 5DYMA 4A2UA 5AONA 1S8NA 4OIPF 1K79A 3ZWFA 3F6OA 1U78A 5K5QA 4WWCA 2EFOA 3IKTA 1OPCA 3CUQB 5TRDA 2A07F 4AIKA 3ABUA 1U8RA 1ONVA 1FC3A 1MJ9A 3NEUA 3MD7A 4LK1F 1O3QA 1XGOA 2YX7A 2I7TA 4I2OA 5AHOA 3U9GA 3R6SA 2XIGA 1ZG5A 4EGYA 1LB2A 2ESNA 4KA4A 1USTA 1ZLKA 3VOEA 4FX4A 2DQLA 2XKPA 5DCMA 2KIMA 4L9VA 1FX7A 2RGVA 2CGPA 2OBPA 5HLIA 1QZYA 3LQRA 1IUYA 5LCAA 3EDPA 3JTGA 5AHRA 4XWTA 2GA2A 2G7HA 3DHBA 4L18B 4ZH4F 1I6XA 1UFMA 5B3RA 1KR3A 1ZGAA 1SAXA 3WODF 1IRFA 5E8IA 1MDMB 3QAHA 1RIOH 3ZMUA 2FBIA 1LEAA 4HZFA 4EYLA 3BK1A 2BEOA 2PBIA 4NQ5A 1IZ1A 2PG4A 2PQ8A 5DCFA 5EVDA 1FY7A 2VT3A 3HYIA 3N4MA 4K2EA 4BYYA 3I0VA 3P7NA 2A6HF 3DEUA 2HWVA 4P5OA 4EM1A 1K07A 5ERIA 1L9YA 4D1VA 5LMCA 2IW5A 2EV6A 1ZYRF 5ACXA 4KMUX 2IA0A 3AF6A 3KE2A 3M8EA 3ELKA 2AS5F 5LLDA 1UB9A 2F5DA 3CDHA 1WSUA 4G6DA 3DH8A 2BYVE 4XSXF 3DXJF 4TV7A 2YR2A 4YFNF 2YNTB 3CUQA 1HSTA 4PZJA 2Y8BA 2ZNBA 4EV0A 3F9OA 3IOFA 4A6EA 1J59A 2D2WA 3DFGA 1P92A 2HKXA 4G7OF 1L3LA 1STZA 4IHSA 3I58A 5CVIA 4GYUA 1Z7UA 5F6FA 4TZ9A 3QOPA 2ZBKA 5EH9A 2FMYA 4ZZLA 2HQNA 3JW4A 4KEQA 4FHTA 4I98B 2YNTA 5DD4A 2CSOA 4LLNA 3KCCA 4A6DA 1O57A 3KP2A 1PP7U 1BOAA 5LRSA 3V7RA 1RZ4A 2A3SA 2JTVA 3DF8A 1KU9A 4ZEJA 4ZYHA 1YTYA 3EETA 3F3XA 5A2QZ 1BJAA 1YFHA 2BFLA 5D8LB 3R4KA 1YW9A 1X8GA 2M30A 5EVKA 2ISYA 3R0AA 2WYMA 3H3ZA 4D1TA 1XDSA 1R5GA 5HS8A 1IN7A 3K0LA 2KRFA 4RAWA 4ESBA 4UWSB 5B15A 2HOEA 3I71A 2VONA 4IJAA 4JBAA 3FMRA 2UXNA 2X0LA 3IE2A 4AX1B 1U6GA 3FMQA 1VJNA 5A2QK 2I7VA 4ZYEA 3ZMSA 4F6ZA 1XTOA 3QU3A 4GCWA 4I0AA 5EEGA 1R36A 1O3SA 1TTYA 1R5HA 2YX4A 4C09A 3IRRA 4KICA 2H6AA 1IN4A 2XGXA 4L9NA 2GFKA 3ULQB 1Y0UA 3FF5A 3G3ZA 1IXSB 2M5WA 1U2WA 2P18A 1TW3A 5AIPA 1OYIA 2Y0MA 3KP6A 3FXQA 1HKQA 3QP5A 4IXAA 3DKWA 1Z6RA 5D5UB 1V3FA 4UBQA 2OU2A 4M6YA 3SW3A 2L4AA 4EMSA 4HV6A 4IPAA 2M5CA 4B09A 1F9NA 2RN7A 2VC0A 4EJOA 4AIHA 5ILVA 4EQQA 1W5TA 2OHIA 3WTYC 4M72A 5FLXZ 2RVCA 4YFKF 4J5FA 1HW2A 3K9TA 1PUEE 2KKOA 3FHZA 1K7AA 3SZPA 2FQ3A 4KIGA 3BV6A 1GHCA 5JVTA 1G3TA 4HX8A 5AXOA 1BMCA 1E5DA 2EK5A 3B02A 2HQRA 1R7JA 3JSPA 2EA2A 2DFIA 2R7DA 1FPQA 2BGAA 3E3VA 2FU4A 5KK1A 2CFXA 5E1ZB 2ZNZA 1CF7B 2XF4A 3IEKA 4KDPA 4HF2A 4BXUA 2HYFA 3U1DA 3RKKA 4DILA 4JK1X 1M2XA 5D5XB 4YFXF 3J80Z 4RB1A 1DPUA 5ACTA 3I53A 5HIPA 1HW1A 2GCUA 2P7CB 3JXPA 3GO5A 5BPDA 2O0YA 4JO0A 5FB2A 3QU6A 2FU7A 4WD6A 2ADUA 4B8XA 2KJCA 2FK6A 1XMAA 2QWWA 5L3EA 3MZHA 4M9SA 4B87A 2IP2A 4Y15A 1WWXA 2RDPA 3EQLF 1P4WA 2C6YA 4KFCA 4EJVA 4DIKA 1YW8A 4OIQF 2G9WA 2EA4A 5F64A 2FXAA 2BC2A 2CYYA 2NXAA 5LCHA 1G4DA 3WTTC 3QP6A 2YPRA 2B0LA 2VODA 2YNVA 4L0ZB 1YQAA 2XKOA 2Z3YA 3R0JA 1FYKA 2YNVB 3KEQA 4XLNF 1BN5A 3V8KA 4GGGA 1X3UA 5K5RA 3ZQ4A 2M87A 1PP8F 4Z6XA 1T0FA 2FNPA 3Q6VA 1KO2A 2OA4A 2EJRA 2FBKA 4I0BA 4LG0B 3HRMA 2HGCA 1B6AA 2XAQA 2BFZA 2IRFG 1MJBA 4BNCA 4E70A 5EWAA 3PY5A 2FE3A 4HL2A 1BM9A 1F5TA 4HV5A 2R3SA 5LLQA 1VMEA 3GUDA 2HEOA 3H3EA 4TYFA 2EFWA 1KA8A 1BBYA 1GVJA 1JE8A 1LVAA 4IF4A 5BOXA 4V0HA 2OZ6A 3FX3A 4IRHA 1OMIA 2ZZIA 5DPXA 4EYFA 5IT3A 2EV0A 3LA7A 2M1BA 1YCFA 4FEKA 2TDXA 4HDUA 3WE3A 1XSVA 3V7CA 4U0VA 3RKJA 1G3WA 4U7BA 4EJUA 1HBXG 5E17F 3KZYA 1D3YA 1XSDA 1XB4A 2A61A 1RI7A 4GCVA 4CHLA 4OINF 4CHUA 2ZWRA 2JSCA 3E97A 1EH7A 2LF7A 1T6SA 4G9YA 4NB5A 2BFZB 4Q47A 5D5VB 2FHXB 3FAIA 2GIVA 3C18A 2FBHA 3WGHA 1U5TA 3KZZA 3REOA 3CO6C 5EV6A 5K4KA 2HR3A 3GZ6A 1S3JA 1HQCA 3O2PE 3WXCA 4LG0A 1EH6A 4OU0A 3Q5FA 2VOPA 4R8HA 2L4MA 2KJBA 2ZXJA 2DOOA 2QJSA 5KIKA 5A0TA 3JAMZ 2GAUA 2VC1A 1MGTA 2DTRA 2FA5A 2XAFA 2YNWA 2P6TA 5LEKA 4CZZA 1R22A 5L3BA 4G7HF 1Z05A 3TDZC 2DK5A 2XAHA 1D5VA 1QNTA 4L5IA 1G3YA 5ACRA 2MBFA 6PAXA 3BROA 1FLIA 5HH4A 4Z67A 3F22A 4U0YA 4H0EA 1QPMA 3K69A 1ZAOA 4C1DA 2CQKA 3MEXA 4LGWA 3NQOA 2OZUA 4CXFA 4A0XA 3BWGA 3IRQA 2CG4A 5D4RA 2EFNA 4JQFA 1P2FA 3MQ0A 3SPUA 4OMZA 1CF7A 5ACVA 4M74A 1ZGJA 3MZYA 2XV4S 3IC7A 4TZEA 4MEYF 4RB0A 1QH3A 2FRHA 4Y17A 2M5DA 2K4JA 4QWQA 4WXDA 5CVRA 2ZJ2A 4F7ZA 4RBSA 4YSLA 5J6XA 3MCZA 2OQGA 2E1CA 2Z99A 2L01A 4A5MA 1TW2A 1YS7A 2BIBA 3CUQC 5E8GA 4EXYA 4IHTA 3LAPA 2PJPA 2OHJA 1R1TA 4A0ZA 2MH2A 2STWA 4D02A 4RB3C 2RV8A 2P8TA 2FU9A 1QZZA 3ABTA 4OMYA 2JZYA 4N0BA 3LVZA 4A5NA 2VW8A 3L2CA 2V6CA 2ZCWA 5EV8A 4HLYA 3M1EA 2MH9A 4PVTA 3J81K 3M8FA 2UZKA 1ZARA 3GFLA 3ERED 3VPEA 1BI2A 1TBXA 3F21A 1ON2A 2RKHA 1YCGA 2CWEA 3FWEA 2PMHA 1IN5A 3E5QA 1F1ZA 4IRGA 3VODA 4ZNBA 4D1UA 2GKLA 3WGIA 1XGNA 1H9GA 3BDDA 2A68F 3HUGA 3MWMA 2W25A 3GLXA 4ZO2A 3WTZA 1IW7F 3RYRA 2RNJA 2VBZA 2V1XA 2GZWA 4H0DA 1XMKA 1K78B 4AIJA 2Q2EA 1W7PD 3SFPA 5DEQA 2Z33A 2HTSA 4OIOF 3NRVA 3DP7A 3LSTA 1S7OA 2PN6A 3IDZA 4HW0A 2O03A 5HH6A 1OR7A 2HZTA 2HKOA 5FFXA 4LB6B 4L0YB 5DUKA 1AWCA 2YU3A 4S04A 1J7KA 2GFJA 1ZG1A 5ICCA 1ZNBA 3ZMTA 4BHBA 2P5VA 3F6VA 3MFKA 4BH9A 2VN2A 5K5OA 5FQBA 4HA8A 3H3UA 3M7GA 4M9XA 3RPCA 3HOSA 1U3EM 3COAC 5FD5A 1BI3A 1T38A 4LLGF 5CYVA 1VGNA 4C1CA 2P4WA 5LHIA 1SMLA 1BC2A 1QO0D 3KNSA 1TLHB 1O3RA 4XUKA 1EH8A 5D4SA 2GWRA 1XGSA 2EWNA 3GYHX 2PFBA 3FM3A 3WE2A 5ACWA 4O98A 3GZ5A 1B1BA 2JPCA 3JSOA 2A5YB 2JRTA 4ZYDA 4N9HA 1AOYA 2Y75A 2WHGA 2QM3A 3T8RA 3GF2A 1MDMA 1YCHA 4RB2C 2DO7A 2UXXA 2QENA 3L9FA 3ZP5A 1ZHFA 2Q9UA 3SBLA 2QEDA 4MHGA 2IJLA 1JT1A 3FZVA 3F72A 4ZZDA 1TNTA 3QH8A 5EVBA 4EYBA 1SFUA 3I14A 2QZ8A 5HLGA 1QBJA 1G6NA 1OYWA 1H9TA 4C1EA 5K4NA 3N97A 2NNNA 5LSCA 3BC2A 4YIIA 2BR6A 3ECOA 1BI1A 4EFZA 2GQQA 1U5TC 1R1VA 5EEHA 3G73A 2P7VB 2XAGA 3K1PA 4FSBA 4ZO3A 3EYIA 3F8NA 4QLCU 2W84A 2HDCA 4R1HA 5A0VA 1T98A 2AIOA 3T9MA 5E1XA 5IT9Z 3CO7C 4AX0B 1ZRDA 2W24A 1IN8A 1LDDA 4UVBA 5L3FA 1ODDA 4Z5YA 2WRSA 1ON1A 3T3OA 1J5YA 2ZMEB 4O6JA 3I15A 3FXUA 2O61A 3ZNBA 2BFKA 2F5CA 2VE8A 3PY6A 1XSXA 2QVOA 1BIBA 1D8KA 4UWRB 1ZN2A 3HSFA 2F5FA 5CLSA 2HTJA 2J5PA 5ACPA 2A69F 4RAZA 1BVTA 3KP5A 2MC3A 1WKMA 4F6HA 1MQOA 5BPIA 1YYVA 2Q0IA 3D5LA 1KQ8A 5KVRA 2QDTA 1QH5A 4NQ6A 1DP7P 1Q1HA 3IL2A 4KN4X 1H0MA 3T0YA 1GXPA 1WW1A 2ZNYA 3BJOA 2EB7A 3BY6A 5HS7A 4EVIA 4WF2A 5BQTA 4AWXB 5CVVA 5E1WA 1KYZA 4I02A 4Q5SF 3D0SA 3WTSC 4RGSA 3S2WA 4BP0A 3FXRA 3P9CA 4R79A 5L3DA 1KQ9A 3KP4A 2PI0A 2NNYA 1P4AA 4BHCA 5L3CA