5EV6A

Crystal structure of the native, di-zinc metallo-beta-lactamase imp-1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia marcescens
total genus 64
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ev6A00
4C1FA 4J5HA 4AWZA 4EY2A 2QDSA 1A8TA 4XUKA 2FU9A 2QJSA 1YCHA 2BC2A 5IQKA 2VW8A 1ZNBA 5B15A 1E5DA 3PY5A 4UWSB 5ACXA 4Z7RA 3ZWFA 4ZEJA 3I15A 1ZKPA 3H3EA 2FHXA 3KNRA 4YSBA 2BG7A 3SD9A 1MQOA 4Z6XA 2FU8A 3BK2A 3FCZA 5LM6A 3IDZA 3X2XA 5K0WA 5ACQA 5KILA 4ZO2A 1L9YA 2NYPA 2GMNA 4RM5A 1BMCA 4C1EA 2BFZB 2BG2A 5HIOA 5ACTA 4GCWA 4HL2A 4D1UA 1VMEA 2WRSA 3QH8A 1KO2A 2WYMA 2XR1A 2YNVA 2BIBA 4C1HA 5DPXA 1P9EA 4CHLA 2XF4A 4ZNBA 3S0ZA 4UWRB 4TZFA 4V0HA 1VJNA 4EYBA 4FSBA 1HLKA 2BMIA 4PVTA 3KNSA 2I7VA 5FQAA 3PG4A 5EW0A 3BC2A 5ACRA 5EHTA 5AXRA 2ZO4A 5FQCA 4LE6A 1DD6A 4EXYA 3IE1A 5HIPA 2YZ3A 1DDKA 2BFZA 2GKLA 5ACVA 4TYTA 2ZZIA 1WUOA 5EWAA 4C09A 4D1VA 5LS3A 3MD7A 2GFJA 5LE1A 4DILA 5HISA 4F6HA 1WW1A 5K4MA 3R2UA 4AD9A 5ACUA 1KO3A 2P4ZA 3ZNBA 4EYLA 3DHAA 1ZTCA 5EVDA 4Z67A 2NZEA 4RL0A 4BZ3A 2OHHA 4D1WA 1X8GA 4FEKA 4UAMA 4U4LA 5K4KA 2BG6A 2BGAA 2BG8B 2FU7A 2ZNBA 4TYFA 4HL1A 3VQZA 2P97A 1Y44A 1YCGA 4J5FA 3G1PA 2ZWRA 3Q6VA 3T3OA 2BR6A 4TZEA 3PY6A 3I13A 2BFLA 1WRAA 5A5ZA 4EXSA 1XTOA 1YCFA 2UYXA 3IE0A 3SW3A 2WYMC 4UA4A 4BP0A 1BC2A 5LCHA 3JXPA 4DIKA 3ZR9A 3BV6A 4YSLA 5KIKA 3IOFA 3L6NA 3LVZA 5AHOA 4AWYB 4JO0A 1X8HA 1JJEA 3SFPA 5AHRA 4C1GA 2HB9A 3I14A 2P1EA 4B87A 4ZO3A 1K07A 4HKYA 5LLDA 4FR7A 2Q0JA 1SMLA 3SRXA 3P2UA 3DHCA 4UBQA 4RAMA 4AX0B 5LCAA 2R2DA 2GFKA 4NQ2A 2M5CA 1X8IA 3DHBA 2YNWA 4Z5YA 2NZFA 4F6ZA 4UWOB 1VGNA 2QINA 2H6AA 3F9OA 5EV6A 2Q9UA 3AF6A 5EVBA 4AX1B 3X2ZA 2Y8BA 2AZ4A 3X2YA 2OHJA 3AJ3A 2Y8AA 2FK6A 2BTNA 3WXCA 4O98A 5LSCA 4NQ6A 2I7XA 3DH8A 3IOGA 3RKJA 4EYFA 4TZ9A 4PVOA 4GYQA 2QDTA 2FU6A 3T9MA 5B3RA 2CBNA 4RL2A 2Q42A 5AEBA 2NXAA 2WYLA 5EH9A 3A4YA 5B1UA 2Q0IA 3IE2A 3IELA 5ACPA 1M2XA 1QH3A 4NQ5A 4P62A 2YNVB 4UWPB 2GCUA 5HH6A 5LMCA 3ESHA 3FAIA 4NQ4A 4TZBA 1KR3A 4D1TA 3I11A 2I7TA 2YCBA 5K4NA 1QH5A 1BVTA 2YNTB 1DXKA 3SBLA 4XWWA 5ACWA 4RBSA 4KEPA 4Z5ZA 5EVKA 3KL7A 4WD6A 5A0VA 4YSKA 5HIQA 2DKFA 2AIOA 3AF5A 4XWTA 3X30A 5ACSA 3SPUA 2BG8A 2FM6A 2YNUA 2E7YA 3ZQ4A 4C1DA 4EFZA 4D02A 3ADRA 2BFKA 1XM8A 1JT1A 4GYUA 5HH4A 5LCFA 3I0VA 5A87A 5A0TA 2OHIA 2A7MA 1A7TA 2YNTA 4KEQA 4C1CA 3IEMA 1JJTA 1WUPA 2M5DA 2FHXB 4H0DA 3RKKA 5EV8A 5AXOA 4Z60A 2WHGA 5FQBA 5AYAA 2P18A 3VPEA 5HH5A 2QEDA 3IEKA 3T3NA 3RPCA 2DOOA 4RAWA 3BK1A 3TP9A 2Y87A
chains in the Genus database with same CATH superfamily
4C1FA 4J5HA 4AWZA 4EY2A 2QDSA 1A8TA 4XUKA 2FU9A 2QJSA 1YCHA 2BC2A 5IQKA 2VW8A 1ZNBA 5B15A 1E5DA 3PY5A 4UWSB 5ACXA 4Z7RA 3ZWFA 4ZEJA 3I15A 1ZKPA 3H3EA 2FHXA 3KNRA 4YSBA 2BG7A 3SD9A 2CG3A 1MQOA 4Z6XA 2FU8A 3BK2A 3FCZA 5LM6A 3IDZA 3X2XA 5K0WA 5ACQA 5KILA 4ZO2A 1L9YA 2NYPA 2GMNA 4RM5A 1BMCA 4C1EA 2BFZB 2BG2A 5HIOA 5ACTA 4GCWA 4HL2A 4D1UA 1VMEA 2WRSA 3QH8A 1KO2A 2WYMA 2XR1A 2YNVA 2BIBA 4C1HA 2CFZA 5DPXA 1P9EA 4CHLA 2XF4A 4ZNBA 3S0ZA 4UWRB 4TZFA 4V0HA 1VJNA 4FSBA 4EYBA 1HLKA 2BMIA 4PVTA 3KNSA 2I7VA 5FQAA 3PG4A 5EW0A 3BC2A 5ACRA 5EHTA 5AXRA 2ZO4A 5FQCA 4LE6A 1DD6A 4EXYA 3IE1A 5HIPA 2YZ3A 1DDKA 2BFZA 2GKLA 5ACVA 4TYTA 2ZZIA 1WUOA 5EWAA 4C09A 4D1VA 5LS3A 3MD7A 2GFJA 5LE1A 4DILA 5HISA 4F6HA 1WW1A 5K4MA 3R2UA 4AD9A 5ACUA 1KO3A 2P4ZA 3ZNBA 4EYLA 3DHAA 1ZTCA 4PDXA 5EVDA 4Z67A 2NZEA 4RL0A 4BZ3A 2OHHA 4D1WA 1X8GA 4FEKA 4UAMA 4U4LA 5K4KA 2YHEA 2BG6A 2BGAA 2BG8B 2FU7A 2ZNBA 4TYFA 4HL1A 3VQZA 2P97A 5A23A 1Y44A 1YCGA 4J5FA 3G1PA 2ZWRA 3Q6VA 3T3OA 2BR6A 4TZEA 3PY6A 3I13A 2BFLA 1WRAA 5A5ZA 4EXSA 1XTOA 1YCFA 2UYXA 3IE0A 3SW3A 2WYMC 4UA4A 4BP0A 1BC2A 5LCHA 3JXPA 4DIKA 3ZR9A 3BV6A 4YSLA 5KIKA 3IOFA 3L6NA 3LVZA 5AHOA 4AWYB 4JO0A 1X8HA 1JJEA 3SFPA 5AHRA 4C1GA 2HB9A 3I14A 2P1EA 4B87A 4ZO3A 1K07A 4HKYA 5LLDA 4FR7A 2Q0JA 1SMLA 3SRXA 5AIJA 3P2UA 3DHCA 4UBQA 4RAMA 4AX0B 5LCAA 2R2DA 2GFKA 4NQ2A 2M5CA 1X8IA 3DHBA 2YNWA 4Z5YA 2NZFA 4F6ZA 4UWOB 1VGNA 2QINA 2H6AA 3F9OA 5EV6A 2Q9UA 3AF6A 5EVBA 4AX1B 3X2ZA 2Y8BA 2AZ4A 3X2YA 2OHJA 3AJ3A 2Y8AA 2FK6A 2BTNA 3WXCA 4O98A 5LSCA 4NQ6A 2I7XA 3DH8A 3IOGA 3RKJA 4EYFA 4TZ9A 4PVOA 4GYQA 2QDTA 2FU6A 3T9MA 5AJLA 5B3RA 2CBNA 4RL2A 2Q42A 5AEBA 2NXAA 2WYLA 5EH9A 3A4YA 5B1UA 2Q0IA 3IE2A 3IELA 5ACPA 1M2XA 4AV7A 1QH3A 4NQ5A 4P62A 2YNVB 4UWPB 2GCUA 5HH6A 5LMCA 3ESHA 3FAIA 4NQ4A 4TZBA 1KR3A 4D1TA 3I11A 2I7TA 2YCBA 5K4NA 1QH5A 1BVTA 2YNTB 1DXKA 3SBLA 2CFUA 4XWWA 5ACWA 4RBSA 4KEPA 4Z5ZA 5EVKA 3KL7A 4WD6A 5A0VA 4YSKA 5HIQA 2DKFA 2AIOA 3AF5A 4XWTA 3X30A 5ACSA 3SPUA 2BG8A 2FM6A 2YNUA 2E7YA 3ZQ4A 4C1DA 4EFZA 4D02A 3ADRA 2BFKA 1XM8A 1JT1A 4GYUA 5HH4A 5LCFA 3I0VA 5A87A 5A0TA 2OHIA 2CG2A 2A7MA 1A7TA 2YNTA 4KEQA 4C1CA 3IEMA 1JJTA 4NURA 1WUPA 2M5DA 2FHXB 4H0DA 3RKKA 5EV8A 4AXHA 5AXOA 4Z60A 2WHGA 5FQBA 5AYAA 2P18A 3VPEA 5HH5A 2QEDA 3IEKA 3T3NA 3RPCA 2DOOA 4RAWA 3BK1A 3TP9A 2Y87A
chains in the Genus database with same CATH topology
4C1FA 4J5HA 4AWZA 4EY2A 2QDSA 1A8TA 4XUKA 2FU9A 2QJSA 1YCHA 2BC2A 5IQKA 2VW8A 1ZNBA 5B15A 1E5DA 3PY5A 4UWSB 5ACXA 4Z7RA 3ZWFA 4ZEJA 3I15A 1ZKPA 3H3EA 2FHXA 3KNRA 4YSBA 2BG7A 3SD9A 1MQOA 4Z6XA 2FU8A 3BK2A 3FCZA 5LM6A 3IDZA 3X2XA 5K0WA 5ACQA 5KILA 4ZO2A 1L9YA 2NYPA 2GMNA 4RM5A 1BMCA 4C1EA 2BFZB 2BG2A 5HIOA 5ACTA 4GCWA 4HL2A 4D1UA 1VMEA 2WRSA 3QH8A 1KO2A 2WYMA 2XR1A 2YNVA 2BIBA 4C1HA 5DPXA 1P9EA 4CHLA 2XF4A 4ZNBA 3S0ZA 4UWRB 4TZFA 4V0HA 1VJNA 4EYBA 4FSBA 1HLKA 2BMIA 4PVTA 3KNSA 2I7VA 5FQAA 3PG4A 5EW0A 3BC2A 5ACRA 5EHTA 5AXRA 2ZO4A 5FQCA 4LE6A 1DD6A 4EXYA 3IE1A 5HIPA 2YZ3A 1DDKA 2BFZA 2GKLA 5ACVA 4TYTA 2ZZIA 1WUOA 5EWAA 4C09A 4D1VA 5LS3A 3MD7A 2GFJA 5LE1A 4DILA 5HISA 4F6HA 1WW1A 5K4MA 3R2UA 4AD9A 5ACUA 1KO3A 2P4ZA 3ZNBA 4EYLA 3DHAA 1ZTCA 5EVDA 4Z67A 2NZEA 4RL0A 4BZ3A 2OHHA 4D1WA 1X8GA 4FEKA 4UAMA 4U4LA 5K4KA 2BG6A 2BGAA 2BG8B 2FU7A 2ZNBA 4TYFA 4HL1A 3VQZA 2P97A 1Y44A 1YCGA 4J5FA 3G1PA 2ZWRA 3Q6VA 3T3OA 2BR6A 4TZEA 3PY6A 3I13A 2BFLA 1WRAA 5A5ZA 4EXSA 1XTOA 1YCFA 2UYXA 3IE0A 3SW3A 2WYMC 4UA4A 4BP0A 1BC2A 5LCHA 3JXPA 4DIKA 3ZR9A 3BV6A 4YSLA 5KIKA 3IOFA 3L6NA 3LVZA 5AHOA 4AWYB 4JO0A 1X8HA 1JJEA 3SFPA 5AHRA 4C1GA 2HB9A 3I14A 2P1EA 4B87A 4ZO3A 1K07A 4HKYA 5LLDA 4FR7A 2Q0JA 1SMLA 3SRXA 3P2UA 3DHCA 4UBQA 4RAMA 4AX0B 5LCAA 2R2DA 2GFKA 4NQ2A 2M5CA 1X8IA 3DHBA 2YNWA 4Z5YA 2NZFA 4F6ZA 4UWOB 1VGNA 2QINA 2H6AA 3F9OA 5EV6A 2Q9UA 3AF6A 5EVBA 4AX1B 3X2ZA 2Y8BA 2AZ4A 3X2YA 2OHJA 3AJ3A 2Y8AA 2FK6A 2BTNA 3WXCA 4O98A 5LSCA 4NQ6A 2I7XA 3DH8A 3IOGA 3RKJA 4EYFA 4TZ9A 4PVOA 4GYQA 2QDTA 2FU6A 3T9MA 5B3RA 2CBNA 4RL2A 2Q42A 5AEBA 2NXAA 2WYLA 5EH9A 3A4YA 5B1UA 2Q0IA 3IE2A 3IELA 5ACPA 1M2XA 1QH3A 4NQ5A 4P62A 2YNVB 4UWPB 2GCUA 5HH6A 5LMCA 3ESHA 3FAIA 4NQ4A 4TZBA 1KR3A 4D1TA 3I11A 2I7TA 2YCBA 5K4NA 1QH5A 1BVTA 2YNTB 1DXKA 3SBLA 4XWWA 5ACWA 4RBSA 4KEPA 4Z5ZA 5EVKA 3KL7A 4WD6A 5A0VA 4YSKA 5HIQA 2DKFA 2AIOA 3AF5A 4XWTA 3X30A 5ACSA 3SPUA 2BG8A 2FM6A 2YNUA 2E7YA 3ZQ4A 4C1DA 4EFZA 4D02A 3ADRA 2BFKA 1XM8A 1JT1A 4GYUA 5HH4A 5LCFA 3I0VA 5A87A 5A0TA 2OHIA 2A7MA 1A7TA 2YNTA 4KEQA 4C1CA 3IEMA 1JJTA 1WUPA 2M5DA 2FHXB 4H0DA 3RKKA 5EV8A 5AXOA 4Z60A 2WHGA 5FQBA 5AYAA 2P18A 3VPEA 5HH5A 2QEDA 3IEKA 3T3NA 3RPCA 2DOOA 4RAWA 3BK1A 3TP9A 2Y87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1F A;  4J5H A;  4AWZ A;  4EY2 A;  2QDS A;  1A8T A;  4XUK A;  2FU9 A;  2QJS A;  1YCH A;  2BC2 A;  5IQK A;  2VW8 A;  1ZNB A;  5B15 A;  1E5D A;  3PY5 A;  4UWS B;  5ACX A;  4Z7R A;  3ZWF A;  4ZEJ A;  3I15 A;  1ZKP A;  3H3E A;  2FHX A;  3KNR A;  4YSB A;  2BG7 A;  3SD9 A;  1MQO A;  4Z6X A;  2FU8 A;  3BK2 A;  3FCZ A;  5LM6 A;  3IDZ A;  3X2X A;  5K0W A;  5ACQ A;  5KIL A;  4ZO2 A;  1L9Y A;  2NYP A;  2GMN A;  4RM5 A;  1BMC A;  4C1E A;  2BFZ B;  2BG2 A;  5HIO A;  5ACT A;  4GCW A;  4HL2 A;  4D1U A;  1VME A;  2WRS A;  3QH8 A;  1KO2 A;  2WYM A;  2XR1 A;  2YNV A;  2BIB A;  4C1H A;  5DPX A;  1P9E A;  4CHL A;  2XF4 A;  4ZNB A;  3S0Z A;  4UWR B;  4TZF A;  4V0H A;  1VJN A;  4EYB A;  4FSB A;  1HLK A;  2BMI A;  4PVT A;  3KNS A;  2I7V A;  5FQA A;  3PG4 A;  5EW0 A;  3BC2 A;  5ACR A;  5EHT A;  5AXR A;  2ZO4 A;  5FQC A;  4LE6 A;  1DD6 A;  4EXY A;  3IE1 A;  5HIP A;  2YZ3 A;  1DDK A;  2BFZ A;  2GKL A;  5ACV A;  4TYT A;  2ZZI A;  1WUO A;  5EWA A;  4C09 A;  4D1V A;  5LS3 A;  3MD7 A;  2GFJ A;  5LE1 A;  4DIL A;  5HIS A;  4F6H A;  1WW1 A;  5K4M A;  3R2U A;  4AD9 A;  5ACU A;  1KO3 A;  2P4Z A;  3ZNB A;  4EYL A;  3DHA A;  1ZTC A;  5EVD A;  4Z67 A;  2NZE A;  4RL0 A;  4BZ3 A;  2OHH A;  4D1W A;  1X8G A;  4FEK A;  4UAM A;  4U4L A;  5K4K A;  2BG6 A;  2BGA A;  2BG8 B;  2FU7 A;  2ZNB A;  4TYF A;  4HL1 A;  3VQZ A;  2P97 A;  1Y44 A;  1YCG A;  4J5F A;  3G1P A;  2ZWR A;  3Q6V A;  3T3O A;  2BR6 A;  4TZE A;  3PY6 A;  3I13 A;  2BFL A;  1WRA A;  5A5Z A;  4EXS A;  1XTO A;  1YCF A;  2UYX A;  3IE0 A;  3SW3 A;  2WYM C;  4UA4 A;  4BP0 A;  1BC2 A;  5LCH A;  3JXP A;  4DIK A;  3ZR9 A;  3BV6 A;  4YSL A;  5KIK A;  3IOF A;  3L6N A;  3LVZ A;  5AHO A;  4AWY B;  4JO0 A;  1X8H A;  1JJE A;  3SFP A;  5AHR A;  4C1G A;  2HB9 A;  3I14 A;  2P1E A;  4B87 A;  4ZO3 A;  1K07 A;  4HKY A;  5LLD A;  4FR7 A;  2Q0J A;  1SML A;  3SRX A;  3P2U A;  3DHC A;  4UBQ A;  4RAM A;  4AX0 B;  5LCA A;  2R2D A;  2GFK A;  4NQ2 A;  2M5C A;  1X8I A;  3DHB A;  2YNW A;  4Z5Y A;  2NZF A;  4F6Z A;  4UWO B;  1VGN A;  2QIN A;  2H6A A;  3F9O A;  5EV6 A;  2Q9U A;  3AF6 A;  5EVB A;  4AX1 B;  3X2Z A;  2Y8B A;  2AZ4 A;  3X2Y A;  2OHJ A;  3AJ3 A;  2Y8A A;  2FK6 A;  2BTN A;  3WXC A;  4O98 A;  5LSC A;  4NQ6 A;  2I7X A;  3DH8 A;  3IOG A;  3RKJ A;  4EYF A;  4TZ9 A;  4PVO A;  4GYQ A;  2QDT A;  2FU6 A;  3T9M A;  5B3R A;  2CBN A;  4RL2 A;  2Q42 A;  5AEB A;  2NXA A;  2WYL A;  5EH9 A;  3A4Y A;  5B1U A;  2Q0I A;  3IE2 A;  3IEL A;  5ACP A;  1M2X A;  1QH3 A;  4NQ5 A;  4P62 A;  2YNV B;  4UWP B;  2GCU A;  5HH6 A;  5LMC A;  3ESH A;  3FAI A;  4NQ4 A;  4TZB A;  1KR3 A;  4D1T A;  3I11 A;  2I7T A;  2YCB A;  5K4N A;  1QH5 A;  1BVT A;  2YNT B;  1DXK A;  3SBL A;  4XWW A;  5ACW A;  4RBS A;  4KEP A;  4Z5Z A;  5EVK A;  3KL7 A;  4WD6 A;  5A0V A;  4YSK A;  5HIQ A;  2DKF A;  2AIO A;  3AF5 A;  4XWT A;  3X30 A;  5ACS A;  3SPU A;  2BG8 A;  2FM6 A;  2YNU A;  2E7Y A;  3ZQ4 A;  4C1D A;  4EFZ A;  4D02 A;  3ADR A;  2BFK A;  1XM8 A;  1JT1 A;  4GYU A;  5HH4 A;  5LCF A;  3I0V A;  5A87 A;  5A0T A;  2OHI A;  2A7M A;  1A7T A;  2YNT A;  4KEQ A;  4C1C A;  3IEM A;  1JJT A;  1WUP A;  2M5D A;  2FHX B;  4H0D A;  3RKK A;  5EV8 A;  5AXO A;  4Z60 A;  2WHG A;  5FQB A;  5AYA A;  2P18 A;  3VPE A;  5HH5 A;  2QED A;  3IEK A;  3T3N A;  3RPC A;  2DOO A;  4RAW A;  3BK1 A;  3TP9 A;  2Y87 A; 
#chains in the Genus database with same CATH topology
 4C1F A;  4J5H A;  4AWZ A;  4EY2 A;  2QDS A;  1A8T A;  4XUK A;  2FU9 A;  2QJS A;  1YCH A;  2BC2 A;  5IQK A;  2VW8 A;  1ZNB A;  5B15 A;  1E5D A;  3PY5 A;  4UWS B;  5ACX A;  4Z7R A;  3ZWF A;  4ZEJ A;  3I15 A;  1ZKP A;  3H3E A;  2FHX A;  3KNR A;  4YSB A;  2BG7 A;  3SD9 A;  2CG3 A;  1MQO A;  4Z6X A;  2FU8 A;  3BK2 A;  3FCZ A;  5LM6 A;  3IDZ A;  3X2X A;  5K0W A;  5ACQ A;  5KIL A;  4ZO2 A;  1L9Y A;  2NYP A;  2GMN A;  4RM5 A;  1BMC A;  4C1E A;  2BFZ B;  2BG2 A;  5HIO A;  5ACT A;  4GCW A;  4HL2 A;  4D1U A;  1VME A;  2WRS A;  3QH8 A;  1KO2 A;  2WYM A;  2XR1 A;  2YNV A;  2BIB A;  4C1H A;  2CFZ A;  5DPX A;  1P9E A;  4CHL A;  2XF4 A;  4ZNB A;  3S0Z A;  4UWR B;  4TZF A;  4V0H A;  1VJN A;  4FSB A;  4EYB A;  1HLK A;  2BMI A;  4PVT A;  3KNS A;  2I7V A;  5FQA A;  3PG4 A;  5EW0 A;  3BC2 A;  5ACR A;  5EHT A;  5AXR A;  2ZO4 A;  5FQC A;  4LE6 A;  1DD6 A;  4EXY A;  3IE1 A;  5HIP A;  2YZ3 A;  1DDK A;  2BFZ A;  2GKL A;  5ACV A;  4TYT A;  2ZZI A;  1WUO A;  5EWA A;  4C09 A;  4D1V A;  5LS3 A;  3MD7 A;  2GFJ A;  5LE1 A;  4DIL A;  5HIS A;  4F6H A;  1WW1 A;  5K4M A;  3R2U A;  4AD9 A;  5ACU A;  1KO3 A;  2P4Z A;  3ZNB A;  4EYL A;  3DHA A;  1ZTC A;  4PDX A;  5EVD A;  4Z67 A;  2NZE A;  4RL0 A;  4BZ3 A;  2OHH A;  4D1W A;  1X8G A;  4FEK A;  4UAM A;  4U4L A;  5K4K A;  2YHE A;  2BG6 A;  2BGA A;  2BG8 B;  2FU7 A;  2ZNB A;  4TYF A;  4HL1 A;  3VQZ A;  2P97 A;  5A23 A;  1Y44 A;  1YCG A;  4J5F A;  3G1P A;  2ZWR A;  3Q6V A;  3T3O A;  2BR6 A;  4TZE A;  3PY6 A;  3I13 A;  2BFL A;  1WRA A;  5A5Z A;  4EXS A;  1XTO A;  1YCF A;  2UYX A;  3IE0 A;  3SW3 A;  2WYM C;  4UA4 A;  4BP0 A;  1BC2 A;  5LCH A;  3JXP A;  4DIK A;  3ZR9 A;  3BV6 A;  4YSL A;  5KIK A;  3IOF A;  3L6N A;  3LVZ A;  5AHO A;  4AWY B;  4JO0 A;  1X8H A;  1JJE A;  3SFP A;  5AHR A;  4C1G A;  2HB9 A;  3I14 A;  2P1E A;  4B87 A;  4ZO3 A;  1K07 A;  4HKY A;  5LLD A;  4FR7 A;  2Q0J A;  1SML A;  3SRX A;  5AIJ A;  3P2U A;  3DHC A;  4UBQ A;  4RAM A;  4AX0 B;  5LCA A;  2R2D A;  2GFK A;  4NQ2 A;  2M5C A;  1X8I A;  3DHB A;  2YNW A;  4Z5Y A;  2NZF A;  4F6Z A;  4UWO B;  1VGN A;  2QIN A;  2H6A A;  3F9O A;  5EV6 A;  2Q9U A;  3AF6 A;  5EVB A;  4AX1 B;  3X2Z A;  2Y8B A;  2AZ4 A;  3X2Y A;  2OHJ A;  3AJ3 A;  2Y8A A;  2FK6 A;  2BTN A;  3WXC A;  4O98 A;  5LSC A;  4NQ6 A;  2I7X A;  3DH8 A;  3IOG A;  3RKJ A;  4EYF A;  4TZ9 A;  4PVO A;  4GYQ A;  2QDT A;  2FU6 A;  3T9M A;  5AJL A;  5B3R A;  2CBN A;  4RL2 A;  2Q42 A;  5AEB A;  2NXA A;  2WYL A;  5EH9 A;  3A4Y A;  5B1U A;  2Q0I A;  3IE2 A;  3IEL A;  5ACP A;  1M2X A;  4AV7 A;  1QH3 A;  4NQ5 A;  4P62 A;  2YNV B;  4UWP B;  2GCU A;  5HH6 A;  5LMC A;  3ESH A;  3FAI A;  4NQ4 A;  4TZB A;  1KR3 A;  4D1T A;  3I11 A;  2I7T A;  2YCB A;  5K4N A;  1QH5 A;  1BVT A;  2YNT B;  1DXK A;  3SBL A;  2CFU A;  4XWW A;  5ACW A;  4RBS A;  4KEP A;  4Z5Z A;  5EVK A;  3KL7 A;  4WD6 A;  5A0V A;  4YSK A;  5HIQ A;  2DKF A;  2AIO A;  3AF5 A;  4XWT A;  3X30 A;  5ACS A;  3SPU A;  2BG8 A;  2FM6 A;  2YNU A;  2E7Y A;  3ZQ4 A;  4C1D A;  4EFZ A;  4D02 A;  3ADR A;  2BFK A;  1XM8 A;  1JT1 A;  4GYU A;  5HH4 A;  5LCF A;  3I0V A;  5A87 A;  5A0T A;  2OHI A;  2CG2 A;  2A7M A;  1A7T A;  2YNT A;  4KEQ A;  4C1C A;  3IEM A;  1JJT A;  4NUR A;  1WUP A;  2M5D A;  2FHX B;  4H0D A;  3RKK A;  5EV8 A;  4AXH A;  5AXO A;  4Z60 A;  2WHG A;  5FQB A;  5AYA A;  2P18 A;  3VPE A;  5HH5 A;  2QED A;  3IEK A;  3T3N A;  3RPC A;  2DOO A;  4RAW A;  3BK1 A;  3TP9 A;  2Y87 A; 
#chains in the Genus database with same CATH homology
 4C1F A;  4J5H A;  4AWZ A;  4EY2 A;  2QDS A;  1A8T A;  4XUK A;  2FU9 A;  2QJS A;  1YCH A;  2BC2 A;  5IQK A;  2VW8 A;  1ZNB A;  5B15 A;  1E5D A;  3PY5 A;  4UWS B;  5ACX A;  4Z7R A;  3ZWF A;  4ZEJ A;  3I15 A;  1ZKP A;  3H3E A;  2FHX A;  3KNR A;  4YSB A;  2BG7 A;  3SD9 A;  1MQO A;  4Z6X A;  2FU8 A;  3BK2 A;  3FCZ A;  5LM6 A;  3IDZ A;  3X2X A;  5K0W A;  5ACQ A;  5KIL A;  4ZO2 A;  1L9Y A;  2NYP A;  2GMN A;  4RM5 A;  1BMC A;  4C1E A;  2BFZ B;  2BG2 A;  5HIO A;  5ACT A;  4GCW A;  4HL2 A;  4D1U A;  1VME A;  2WRS A;  3QH8 A;  1KO2 A;  2WYM A;  2XR1 A;  2YNV A;  2BIB A;  4C1H A;  5DPX A;  1P9E A;  4CHL A;  2XF4 A;  4ZNB A;  3S0Z A;  4UWR B;  4TZF A;  4V0H A;  1VJN A;  4EYB A;  4FSB A;  1HLK A;  2BMI A;  4PVT A;  3KNS A;  2I7V A;  5FQA A;  3PG4 A;  5EW0 A;  3BC2 A;  5ACR A;  5EHT A;  5AXR A;  2ZO4 A;  5FQC A;  4LE6 A;  1DD6 A;  4EXY A;  3IE1 A;  5HIP A;  2YZ3 A;  1DDK A;  2BFZ A;  2GKL A;  5ACV A;  4TYT A;  2ZZI A;  1WUO A;  5EWA A;  4C09 A;  4D1V A;  5LS3 A;  3MD7 A;  2GFJ A;  5LE1 A;  4DIL A;  5HIS A;  4F6H A;  1WW1 A;  5K4M A;  3R2U A;  4AD9 A;  5ACU A;  1KO3 A;  2P4Z A;  3ZNB A;  4EYL A;  3DHA A;  1ZTC A;  5EVD A;  4Z67 A;  2NZE A;  4RL0 A;  4BZ3 A;  2OHH A;  4D1W A;  1X8G A;  4FEK A;  4UAM A;  4U4L A;  5K4K A;  2BG6 A;  2BGA A;  2BG8 B;  2FU7 A;  2ZNB A;  4TYF A;  4HL1 A;  3VQZ A;  2P97 A;  1Y44 A;  1YCG A;  4J5F A;  3G1P A;  2ZWR A;  3Q6V A;  3T3O A;  2BR6 A;  4TZE A;  3PY6 A;  3I13 A;  2BFL A;  1WRA A;  5A5Z A;  4EXS A;  1XTO A;  1YCF A;  2UYX A;  3IE0 A;  3SW3 A;  2WYM C;  4UA4 A;  4BP0 A;  1BC2 A;  5LCH A;  3JXP A;  4DIK A;  3ZR9 A;  3BV6 A;  4YSL A;  5KIK A;  3IOF A;  3L6N A;  3LVZ A;  5AHO A;  4AWY B;  4JO0 A;  1X8H A;  1JJE A;  3SFP A;  5AHR A;  4C1G A;  2HB9 A;  3I14 A;  2P1E A;  4B87 A;  4ZO3 A;  1K07 A;  4HKY A;  5LLD A;  4FR7 A;  2Q0J A;  1SML A;  3SRX A;  3P2U A;  3DHC A;  4UBQ A;  4RAM A;  4AX0 B;  5LCA A;  2R2D A;  2GFK A;  4NQ2 A;  2M5C A;  1X8I A;  3DHB A;  2YNW A;  4Z5Y A;  2NZF A;  4F6Z A;  4UWO B;  1VGN A;  2QIN A;  2H6A A;  3F9O A;  5EV6 A;  2Q9U A;  3AF6 A;  5EVB A;  4AX1 B;  3X2Z A;  2Y8B A;  2AZ4 A;  3X2Y A;  2OHJ A;  3AJ3 A;  2Y8A A;  2FK6 A;  2BTN A;  3WXC A;  4O98 A;  5LSC A;  4NQ6 A;  2I7X A;  3DH8 A;  3IOG A;  3RKJ A;  4EYF A;  4TZ9 A;  4PVO A;  4GYQ A;  2QDT A;  2FU6 A;  3T9M A;  5B3R A;  2CBN A;  4RL2 A;  2Q42 A;  5AEB A;  2NXA A;  2WYL A;  5EH9 A;  3A4Y A;  5B1U A;  2Q0I A;  3IE2 A;  3IEL A;  5ACP A;  1M2X A;  1QH3 A;  4NQ5 A;  4P62 A;  2YNV B;  4UWP B;  2GCU A;  5HH6 A;  5LMC A;  3ESH A;  3FAI A;  4NQ4 A;  4TZB A;  1KR3 A;  4D1T A;  3I11 A;  2I7T A;  2YCB A;  5K4N A;  1QH5 A;  1BVT A;  2YNT B;  1DXK A;  3SBL A;  4XWW A;  5ACW A;  4RBS A;  4KEP A;  4Z5Z A;  5EVK A;  3KL7 A;  4WD6 A;  5A0V A;  4YSK A;  5HIQ A;  2DKF A;  2AIO A;  3AF5 A;  4XWT A;  3X30 A;  5ACS A;  3SPU A;  2BG8 A;  2FM6 A;  2YNU A;  2E7Y A;  3ZQ4 A;  4C1D A;  4EFZ A;  4D02 A;  3ADR A;  2BFK A;  1XM8 A;  1JT1 A;  4GYU A;  5HH4 A;  5LCF A;  3I0V A;  5A87 A;  5A0T A;  2OHI A;  2A7M A;  1A7T A;  2YNT A;  4KEQ A;  4C1C A;  3IEM A;  1JJT A;  1WUP A;  2M5D A;  2FHX B;  4H0D A;  3RKK A;  5EV8 A;  5AXO A;  4Z60 A;  2WHG A;  5FQB A;  5AYA A;  2P18 A;  3VPE A;  5HH5 A;  2QED A;  3IEK A;  3T3N A;  3RPC A;  2DOO A;  4RAW A;  3BK1 A;  3TP9 A;  2Y87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...