5EV6A

Crystal structure of the native, di-zinc metallo-beta-lactamase imp-1
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
total genus 64
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ev6A00
2BG8A 1X8HA 4CHLA 4D1WA 5HIPA 3ZWFA 4YSBA 2YNWA 2HB9A 1YCGA 4EFZA 3LVZA 1HLKA 3X2ZA 3I15A 1X8IA 2P4ZA 3S0ZA 4C1FA 4UWPB 5B1UA 2BR6A 5HIOA 3Q6VA 1ZNBA 5FQCA 2QJSA 2OHHA 3SRXA 4HKYA 2BG8B 1A8TA 5FQBA 1DXKA 2I7VA 2A7MA 5EW0A 2XR1A 5AXRA 4HL1A 5ACTA 5ACVA 2BFKA 4C1CA 2BFZB 2FK6A 3ESHA 2BG2A 2Y8BA 3IE2A 3WXCA 5LSCA 5EVDA 4V0HA 2XF4A 4AWZA 3SFPA 3SBLA 3QH8A 4C1EA 4U4LA 4UA4A 2BFZA 2P1EA 2GCUA 4UAMA 1WRAA 4FR7A 5EVKA 4NQ2A 1KO3A 3ADRA 4TZFA 2BFLA 4RAMA 4Z67A 5KIKA 2QINA 1SMLA 2YNVB 2FHXA 4EYBA 3PY5A 3IEKA 2VW8A 5K4MA 3BC2A 1XM8A 1ZKPA 2GFJA 5HH6A 4D1TA 2QDTA 4GCWA 4RM5A 1Y44A 3MD7A 2OHIA 4O98A 5AHRA 5ACRA 2Q0JA 2BGAA 4Z5ZA 3X30A 4B87A 1K07A 2BMIA 1M2XA 3PY6A 4GYQA 3I0VA 4DILA 5LS3A 3BV6A 2AIOA 3IDZA 5A87A 5ACSA 2YNTA 5ACQA 3DHBA 2NZEA 5ACPA 2QDSA 1YCHA 4NQ6A 4EYLA 3X2YA 4WD6A 1A7TA 4J5FA 4XUKA 2QEDA 4PVOA 5LCAA 2WYLA 4XWWA 3IEMA 4BP0A 3AF6A 2ZO4A 3T9MA 2M5CA 3P2UA 3KL7A 5ACUA 2YNVA 4RBSA 4KEPA 4RL2A 1XTOA 2GFKA 3I13A 5K4NA 2CBNA 5EV6A 4LE6A 3DHAA 2WHGA 4TYFA 1JJEA 4NQ5A 4KEQA 1WUPA 4J5HA 2FU6A 3L6NA 5EWAA 3G1PA 1WUOA 4EYFA 3KNRA 5LCHA 3R2UA 3FCZA 4Z60A 2FU8A 4FSBA 3ZQ4A 4JO0A 3VPEA 5EV8A 3IOGA 2I7XA 1MQOA 4NQ4A 2GKLA 5HH5A 1KO2A 2WYMC 2FM6A 4UWOB 3ZR9A 5K4KA 5EH9A 5HISA 5FQAA 5HIQA 2P97A 4H0DA 3DH8A 2UYXA 1P9EA 1BMCA 4EY2A 4D1UA 5K0WA 4AX0B 2YZ3A 3I14A 2YCBA 4FEKA 3JXPA 4UBQA 4UWRB 4AD9A 1JT1A 2FU9A 5AYAA 1X8GA 4BZ3A 4D02A 4TYTA 1BVTA 4Z7RA 5LE1A 2YNTB 4Z6XA 3ZNBA 1E5DA 4C1DA 2NXAA 2NZFA 2Q42A 3SPUA 3KNSA 2DOOA 2BG6A 4F6HA 5DPXA 2AZ4A 2BTNA 2R2DA 2Y8AA 1QH5A 4EXSA 3BK1A 1DDKA 4P62A 3SW3A 2H6AA 2GMNA 2ZWRA 4PVTA 4ZO3A 2I7TA 5A0TA 3RPCA 1WW1A 3IE1A 1VMEA 2E7YA 2ZZIA 4Z5YA 2ZNBA 5EHTA 4EXYA 2WRSA 1QH3A 4TZBA 4ZO2A 3X2XA 3IE0A 5HH4A 4XWTA 3A4YA 3VQZA 5A0VA 2BIBA 4TZEA 1YCFA 4ZNBA 4TZ9A 3RKKA 2BC2A 3H3EA 1DD6A 5AHOA 4ZEJA 4C09A 4YSKA 3T3OA 2NYPA 5LLDA 3TP9A 5EVBA 1JJTA 3IOFA 1ZTCA 3RKJA 4D1VA 4HL2A 4RAWA 3T3NA 1KR3A 1L9YA 4GYUA 4C1HA 5B15A 1VJNA 3IELA 5LMCA 5LM6A 2OHJA 3SD9A 5AEBA 4F6ZA 2BG7A 2FHXB 3DHCA 3I11A 4DIKA 4C1GA 3PG4A 2P18A 3F9OA 4UWSB 2WYMA 5ACWA 2FU7A 2Y87A 2YNUA 1VGNA 5A5ZA 1BC2A 3FAIA 4AX1B 4RL0A 5AXOA 5B3RA 5ACXA 5LCFA 3BK2A 3AJ3A 4AWYB 2M5DA 4YSLA 5IQKA 5KILA 2Q0IA 3AF5A 2DKFA 2Q9UA
chains in the Genus database with same CATH superfamily
2CG2A 2BG8A 1X8HA 4CHLA 4D1WA 5HIPA 5A23A 3ZWFA 4YSBA 2YNWA 2HB9A 1YCGA 4EFZA 3LVZA 1HLKA 3X2ZA 5AIJA 3I15A 1X8IA 2P4ZA 3S0ZA 4C1FA 4UWPB 2YHEA 5B1UA 2BR6A 5HIOA 3Q6VA 1ZNBA 5FQCA 2QJSA 2OHHA 3SRXA 2CFUA 4HKYA 2BG8B 1A8TA 5FQBA 1DXKA 2I7VA 2A7MA 5EW0A 2XR1A 5AXRA 4HL1A 5ACTA 5ACVA 2BFKA 4C1CA 2BFZB 2FK6A 3ESHA 2BG2A 2Y8BA 3IE2A 4NURA 3WXCA 5LSCA 5EVDA 4V0HA 2XF4A 4AWZA 3SFPA 3SBLA 3QH8A 4C1EA 4U4LA 4UA4A 2BFZA 2P1EA 2GCUA 4UAMA 1WRAA 4FR7A 5EVKA 4NQ2A 1KO3A 3ADRA 4TZFA 4AV7A 2BFLA 4RAMA 4Z67A 5KIKA 2QINA 1SMLA 2YNVB 2FHXA 4EYBA 3PY5A 3IEKA 2VW8A 5K4MA 3BC2A 1XM8A 1ZKPA 2GFJA 5HH6A 4D1TA 2QDTA 4GCWA 4RM5A 1Y44A 3MD7A 2OHIA 4O98A 5AHRA 5ACRA 2Q0JA 2BGAA 4Z5ZA 3X30A 4B87A 1K07A 2BMIA 1M2XA 3PY6A 4GYQA 3I0VA 4DILA 5LS3A 3BV6A 2AIOA 3IDZA 5A87A 5ACSA 2YNTA 5ACQA 4PDXA 3DHBA 2NZEA 5ACPA 2QDSA 1YCHA 4NQ6A 4EYLA 3X2YA 4WD6A 1A7TA 4J5FA 4XUKA 2QEDA 4PVOA 5LCAA 2WYLA 4XWWA 3IEMA 4BP0A 3AF6A 2ZO4A 3T9MA 2M5CA 3P2UA 3KL7A 5ACUA 2YNVA 4RBSA 4KEPA 4RL2A 1XTOA 2GFKA 3I13A 5K4NA 2CBNA 5EV6A 4LE6A 3DHAA 2WHGA 4TYFA 1JJEA 4NQ5A 4KEQA 1WUPA 4J5HA 2FU6A 3L6NA 5EWAA 3G1PA 4AXHA 1WUOA 4EYFA 3KNRA 5LCHA 3R2UA 3FCZA 4Z60A 2FU8A 4FSBA 3ZQ4A 4JO0A 3VPEA 5EV8A 3IOGA 2I7XA 1MQOA 4NQ4A 2GKLA 5HH5A 1KO2A 2WYMC 2FM6A 4UWOB 3ZR9A 5K4KA 5EH9A 5HISA 5FQAA 5HIQA 2P97A 4H0DA 3DH8A 2UYXA 1P9EA 1BMCA 4EY2A 4D1UA 5K0WA 4AX0B 2YZ3A 3I14A 2YCBA 4FEKA 3JXPA 4UBQA 4UWRB 4AD9A 1JT1A 2FU9A 5AYAA 1X8GA 4BZ3A 4D02A 4TYTA 1BVTA 4Z7RA 5LE1A 2YNTB 4Z6XA 3ZNBA 1E5DA 4C1DA 2NXAA 2NZFA 2Q42A 3SPUA 3KNSA 2DOOA 2BG6A 4F6HA 5DPXA 2AZ4A 2BTNA 2R2DA 2Y8AA 1QH5A 4EXSA 3BK1A 1DDKA 4P62A 3SW3A 2H6AA 2GMNA 2ZWRA 4PVTA 4ZO3A 2I7TA 5A0TA 3RPCA 1WW1A 3IE1A 1VMEA 2E7YA 2ZZIA 4Z5YA 2ZNBA 5EHTA 4EXYA 2CG3A 2WRSA 1QH3A 4TZBA 4ZO2A 3X2XA 3IE0A 5HH4A 4XWTA 3A4YA 3VQZA 5A0VA 2BIBA 4TZEA 1YCFA 4ZNBA 4TZ9A 3RKKA 2BC2A 3H3EA 1DD6A 5AHOA 4ZEJA 4C09A 4YSKA 3T3OA 2NYPA 5LLDA 3TP9A 5EVBA 1JJTA 3IOFA 1ZTCA 3RKJA 4D1VA 4HL2A 4RAWA 3T3NA 1KR3A 1L9YA 4GYUA 4C1HA 5B15A 1VJNA 3IELA 5LMCA 5LM6A 2OHJA 3SD9A 5AEBA 4F6ZA 2BG7A 2FHXB 3DHCA 3I11A 2CFZA 4DIKA 4C1GA 3PG4A 2P18A 3F9OA 4UWSB 2WYMA 5ACWA 2FU7A 2Y87A 2YNUA 1VGNA 5A5ZA 1BC2A 3FAIA 4AX1B 4RL0A 5AXOA 5B3RA 5ACXA 5LCFA 3BK2A 3AJ3A 5AJLA 2M5DA 4YSLA 4AWYB 5IQKA 5KILA 2Q0IA 3AF5A 2DKFA 2Q9UA
chains in the Genus database with same CATH topology
2BG8A 1X8HA 4CHLA 4D1WA 5HIPA 3ZWFA 4YSBA 2YNWA 2HB9A 1YCGA 4EFZA 3LVZA 1HLKA 3X2ZA 3I15A 1X8IA 2P4ZA 3S0ZA 4C1FA 4UWPB 5B1UA 2BR6A 5HIOA 3Q6VA 1ZNBA 5FQCA 2QJSA 2OHHA 3SRXA 4HKYA 2BG8B 1A8TA 5FQBA 1DXKA 2I7VA 2A7MA 5EW0A 2XR1A 5AXRA 4HL1A 5ACTA 5ACVA 2BFKA 4C1CA 2BFZB 2FK6A 3ESHA 2BG2A 2Y8BA 3IE2A 3WXCA 5LSCA 5EVDA 4V0HA 2XF4A 4AWZA 3SFPA 3SBLA 3QH8A 4C1EA 4U4LA 4UA4A 2BFZA 2P1EA 2GCUA 4UAMA 1WRAA 4FR7A 5EVKA 4NQ2A 1KO3A 3ADRA 4TZFA 2BFLA 4RAMA 4Z67A 5KIKA 2QINA 1SMLA 2YNVB 2FHXA 4EYBA 3PY5A 3IEKA 2VW8A 5K4MA 3BC2A 1XM8A 1ZKPA 2GFJA 5HH6A 4D1TA 2QDTA 4GCWA 4RM5A 1Y44A 3MD7A 2OHIA 4O98A 5AHRA 5ACRA 2Q0JA 2BGAA 4Z5ZA 3X30A 4B87A 1K07A 2BMIA 1M2XA 3PY6A 4GYQA 3I0VA 4DILA 5LS3A 3BV6A 2AIOA 3IDZA 5A87A 5ACSA 2YNTA 5ACQA 3DHBA 2NZEA 5ACPA 2QDSA 1YCHA 4NQ6A 4EYLA 3X2YA 4WD6A 1A7TA 4J5FA 4XUKA 2QEDA 4PVOA 5LCAA 2WYLA 4XWWA 3IEMA 4BP0A 3AF6A 2ZO4A 3T9MA 2M5CA 3P2UA 3KL7A 5ACUA 2YNVA 4RBSA 4KEPA 4RL2A 1XTOA 2GFKA 3I13A 5K4NA 2CBNA 5EV6A 4LE6A 3DHAA 2WHGA 4TYFA 1JJEA 4NQ5A 4KEQA 1WUPA 4J5HA 2FU6A 3L6NA 5EWAA 3G1PA 1WUOA 4EYFA 3KNRA 5LCHA 3R2UA 3FCZA 4Z60A 2FU8A 4FSBA 3ZQ4A 4JO0A 3VPEA 5EV8A 3IOGA 2I7XA 1MQOA 4NQ4A 2GKLA 5HH5A 1KO2A 2WYMC 2FM6A 4UWOB 3ZR9A 5K4KA 5EH9A 5HISA 5FQAA 5HIQA 2P97A 4H0DA 3DH8A 2UYXA 1P9EA 1BMCA 4EY2A 4D1UA 5K0WA 4AX0B 2YZ3A 3I14A 2YCBA 4FEKA 3JXPA 4UBQA 4UWRB 4AD9A 1JT1A 2FU9A 5AYAA 1X8GA 4BZ3A 4D02A 4TYTA 1BVTA 4Z7RA 5LE1A 2YNTB 4Z6XA 3ZNBA 1E5DA 4C1DA 2NXAA 2NZFA 2Q42A 3SPUA 3KNSA 2DOOA 2BG6A 4F6HA 5DPXA 2AZ4A 2BTNA 2R2DA 2Y8AA 1QH5A 4EXSA 3BK1A 1DDKA 4P62A 3SW3A 2H6AA 2GMNA 2ZWRA 4PVTA 4ZO3A 2I7TA 5A0TA 3RPCA 1WW1A 3IE1A 1VMEA 2E7YA 2ZZIA 4Z5YA 2ZNBA 5EHTA 4EXYA 2WRSA 1QH3A 4TZBA 4ZO2A 3X2XA 3IE0A 5HH4A 4XWTA 3A4YA 3VQZA 5A0VA 2BIBA 4TZEA 1YCFA 4ZNBA 4TZ9A 3RKKA 2BC2A 3H3EA 1DD6A 5AHOA 4ZEJA 4C09A 4YSKA 3T3OA 2NYPA 5LLDA 3TP9A 5EVBA 1JJTA 3IOFA 1ZTCA 3RKJA 4D1VA 4HL2A 4RAWA 3T3NA 1KR3A 1L9YA 4GYUA 4C1HA 5B15A 1VJNA 3IELA 5LMCA 5LM6A 2OHJA 3SD9A 5AEBA 4F6ZA 2BG7A 2FHXB 3DHCA 3I11A 4DIKA 4C1GA 3PG4A 2P18A 3F9OA 4UWSB 2WYMA 5ACWA 2FU7A 2Y87A 2YNUA 1VGNA 5A5ZA 1BC2A 3FAIA 4AX1B 4RL0A 5AXOA 5B3RA 5ACXA 5LCFA 3BK2A 3AJ3A 4AWYB 2M5DA 4YSLA 5IQKA 5KILA 2Q0IA 3AF5A 2DKFA 2Q9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG8 A;  1X8H A;  4CHL A;  4D1W A;  5HIP A;  3ZWF A;  4YSB A;  2YNW A;  2HB9 A;  1YCG A;  4EFZ A;  3LVZ A;  1HLK A;  3X2Z A;  3I15 A;  1X8I A;  2P4Z A;  3S0Z A;  4C1F A;  4UWP B;  5B1U A;  2BR6 A;  5HIO A;  3Q6V A;  1ZNB A;  5FQC A;  2QJS A;  2OHH A;  3SRX A;  4HKY A;  2BG8 B;  1A8T A;  5FQB A;  1DXK A;  2I7V A;  2A7M A;  5EW0 A;  2XR1 A;  5AXR A;  4HL1 A;  5ACT A;  5ACV A;  2BFK A;  4C1C A;  2BFZ B;  2FK6 A;  3ESH A;  2BG2 A;  2Y8B A;  3IE2 A;  3WXC A;  5LSC A;  5EVD A;  4V0H A;  2XF4 A;  4AWZ A;  3SFP A;  3SBL A;  3QH8 A;  4C1E A;  4U4L A;  4UA4 A;  2BFZ A;  2P1E A;  2GCU A;  4UAM A;  1WRA A;  4FR7 A;  5EVK A;  4NQ2 A;  1KO3 A;  3ADR A;  4TZF A;  2BFL A;  4RAM A;  4Z67 A;  5KIK A;  2QIN A;  1SML A;  2YNV B;  2FHX A;  4EYB A;  3PY5 A;  3IEK A;  2VW8 A;  5K4M A;  3BC2 A;  1XM8 A;  1ZKP A;  2GFJ A;  5HH6 A;  4D1T A;  2QDT A;  4GCW A;  4RM5 A;  1Y44 A;  3MD7 A;  2OHI A;  4O98 A;  5AHR A;  5ACR A;  2Q0J A;  2BGA A;  4Z5Z A;  3X30 A;  4B87 A;  1K07 A;  2BMI A;  1M2X A;  3PY6 A;  4GYQ A;  3I0V A;  4DIL A;  5LS3 A;  3BV6 A;  2AIO A;  3IDZ A;  5A87 A;  5ACS A;  2YNT A;  5ACQ A;  3DHB A;  2NZE A;  5ACP A;  2QDS A;  1YCH A;  4NQ6 A;  4EYL A;  3X2Y A;  4WD6 A;  1A7T A;  4J5F A;  4XUK A;  2QED A;  4PVO A;  5LCA A;  2WYL A;  4XWW A;  3IEM A;  4BP0 A;  3AF6 A;  2ZO4 A;  3T9M A;  2M5C A;  3P2U A;  3KL7 A;  5ACU A;  2YNV A;  4RBS A;  4KEP A;  4RL2 A;  1XTO A;  2GFK A;  3I13 A;  5K4N A;  2CBN A;  5EV6 A;  4LE6 A;  3DHA A;  2WHG A;  4TYF A;  1JJE A;  4NQ5 A;  4KEQ A;  1WUP A;  4J5H A;  2FU6 A;  3L6N A;  5EWA A;  3G1P A;  1WUO A;  4EYF A;  3KNR A;  5LCH A;  3R2U A;  3FCZ A;  4Z60 A;  2FU8 A;  4FSB A;  3ZQ4 A;  4JO0 A;  3VPE A;  5EV8 A;  3IOG A;  2I7X A;  1MQO A;  4NQ4 A;  2GKL A;  5HH5 A;  1KO2 A;  2WYM C;  2FM6 A;  4UWO B;  3ZR9 A;  5K4K A;  5EH9 A;  5HIS A;  5FQA A;  5HIQ A;  2P97 A;  4H0D A;  3DH8 A;  2UYX A;  1P9E A;  1BMC A;  4EY2 A;  4D1U A;  5K0W A;  4AX0 B;  2YZ3 A;  3I14 A;  2YCB A;  4FEK A;  3JXP A;  4UBQ A;  4UWR B;  4AD9 A;  1JT1 A;  2FU9 A;  5AYA A;  1X8G A;  4BZ3 A;  4D02 A;  4TYT A;  1BVT A;  4Z7R A;  5LE1 A;  2YNT B;  4Z6X A;  3ZNB A;  1E5D A;  4C1D A;  2NXA A;  2NZF A;  2Q42 A;  3SPU A;  3KNS A;  2DOO A;  2BG6 A;  4F6H A;  5DPX A;  2AZ4 A;  2BTN A;  2R2D A;  2Y8A A;  1QH5 A;  4EXS A;  3BK1 A;  1DDK A;  4P62 A;  3SW3 A;  2H6A A;  2GMN A;  2ZWR A;  4PVT A;  4ZO3 A;  2I7T A;  5A0T A;  3RPC A;  1WW1 A;  3IE1 A;  1VME A;  2E7Y A;  2ZZI A;  4Z5Y A;  2ZNB A;  5EHT A;  4EXY A;  2WRS A;  1QH3 A;  4TZB A;  4ZO2 A;  3X2X A;  3IE0 A;  5HH4 A;  4XWT A;  3A4Y A;  3VQZ A;  5A0V A;  2BIB A;  4TZE A;  1YCF A;  4ZNB A;  4TZ9 A;  3RKK A;  2BC2 A;  3H3E A;  1DD6 A;  5AHO A;  4ZEJ A;  4C09 A;  4YSK A;  3T3O A;  2NYP A;  5LLD A;  3TP9 A;  5EVB A;  1JJT A;  3IOF A;  1ZTC A;  3RKJ A;  4D1V A;  4HL2 A;  4RAW A;  3T3N A;  1KR3 A;  1L9Y A;  4GYU A;  4C1H A;  5B15 A;  1VJN A;  3IEL A;  5LMC A;  5LM6 A;  2OHJ A;  3SD9 A;  5AEB A;  4F6Z A;  2BG7 A;  2FHX B;  3DHC A;  3I11 A;  4DIK A;  4C1G A;  3PG4 A;  2P18 A;  3F9O A;  4UWS B;  2WYM A;  5ACW A;  2FU7 A;  2Y87 A;  2YNU A;  1VGN A;  5A5Z A;  1BC2 A;  3FAI A;  4AX1 B;  4RL0 A;  5AXO A;  5B3R A;  5ACX A;  5LCF A;  3BK2 A;  3AJ3 A;  4AWY B;  2M5D A;  4YSL A;  5IQK A;  5KIL A;  2Q0I A;  3AF5 A;  2DKF A;  2Q9U A; 
#chains in the Genus database with same CATH topology
 2CG2 A;  2BG8 A;  1X8H A;  4CHL A;  4D1W A;  5HIP A;  5A23 A;  3ZWF A;  4YSB A;  2YNW A;  2HB9 A;  1YCG A;  4EFZ A;  3LVZ A;  1HLK A;  3X2Z A;  5AIJ A;  3I15 A;  1X8I A;  2P4Z A;  3S0Z A;  4C1F A;  4UWP B;  2YHE A;  5B1U A;  2BR6 A;  5HIO A;  3Q6V A;  1ZNB A;  5FQC A;  2QJS A;  2OHH A;  3SRX A;  2CFU A;  4HKY A;  2BG8 B;  1A8T A;  5FQB A;  1DXK A;  2I7V A;  2A7M A;  5EW0 A;  2XR1 A;  5AXR A;  4HL1 A;  5ACT A;  5ACV A;  2BFK A;  4C1C A;  2BFZ B;  2FK6 A;  3ESH A;  2BG2 A;  2Y8B A;  3IE2 A;  4NUR A;  3WXC A;  5LSC A;  5EVD A;  4V0H A;  2XF4 A;  4AWZ A;  3SFP A;  3SBL A;  3QH8 A;  4C1E A;  4U4L A;  4UA4 A;  2BFZ A;  2P1E A;  2GCU A;  4UAM A;  1WRA A;  4FR7 A;  5EVK A;  4NQ2 A;  1KO3 A;  3ADR A;  4TZF A;  4AV7 A;  2BFL A;  4RAM A;  4Z67 A;  5KIK A;  2QIN A;  1SML A;  2YNV B;  2FHX A;  4EYB A;  3PY5 A;  3IEK A;  2VW8 A;  5K4M A;  3BC2 A;  1XM8 A;  1ZKP A;  2GFJ A;  5HH6 A;  4D1T A;  2QDT A;  4GCW A;  4RM5 A;  1Y44 A;  3MD7 A;  2OHI A;  4O98 A;  5AHR A;  5ACR A;  2Q0J A;  2BGA A;  4Z5Z A;  3X30 A;  4B87 A;  1K07 A;  2BMI A;  1M2X A;  3PY6 A;  4GYQ A;  3I0V A;  4DIL A;  5LS3 A;  3BV6 A;  2AIO A;  3IDZ A;  5A87 A;  5ACS A;  2YNT A;  5ACQ A;  4PDX A;  3DHB A;  2NZE A;  5ACP A;  2QDS A;  1YCH A;  4NQ6 A;  4EYL A;  3X2Y A;  4WD6 A;  1A7T A;  4J5F A;  4XUK A;  2QED A;  4PVO A;  5LCA A;  2WYL A;  4XWW A;  3IEM A;  4BP0 A;  3AF6 A;  2ZO4 A;  3T9M A;  2M5C A;  3P2U A;  3KL7 A;  5ACU A;  2YNV A;  4RBS A;  4KEP A;  4RL2 A;  1XTO A;  2GFK A;  3I13 A;  5K4N A;  2CBN A;  5EV6 A;  4LE6 A;  3DHA A;  2WHG A;  4TYF A;  1JJE A;  4NQ5 A;  4KEQ A;  1WUP A;  4J5H A;  2FU6 A;  3L6N A;  5EWA A;  3G1P A;  4AXH A;  1WUO A;  4EYF A;  3KNR A;  5LCH A;  3R2U A;  3FCZ A;  4Z60 A;  2FU8 A;  4FSB A;  3ZQ4 A;  4JO0 A;  3VPE A;  5EV8 A;  3IOG A;  2I7X A;  1MQO A;  4NQ4 A;  2GKL A;  5HH5 A;  1KO2 A;  2WYM C;  2FM6 A;  4UWO B;  3ZR9 A;  5K4K A;  5EH9 A;  5HIS A;  5FQA A;  5HIQ A;  2P97 A;  4H0D A;  3DH8 A;  2UYX A;  1P9E A;  1BMC A;  4EY2 A;  4D1U A;  5K0W A;  4AX0 B;  2YZ3 A;  3I14 A;  2YCB A;  4FEK A;  3JXP A;  4UBQ A;  4UWR B;  4AD9 A;  1JT1 A;  2FU9 A;  5AYA A;  1X8G A;  4BZ3 A;  4D02 A;  4TYT A;  1BVT A;  4Z7R A;  5LE1 A;  2YNT B;  4Z6X A;  3ZNB A;  1E5D A;  4C1D A;  2NXA A;  2NZF A;  2Q42 A;  3SPU A;  3KNS A;  2DOO A;  2BG6 A;  4F6H A;  5DPX A;  2AZ4 A;  2BTN A;  2R2D A;  2Y8A A;  1QH5 A;  4EXS A;  3BK1 A;  1DDK A;  4P62 A;  3SW3 A;  2H6A A;  2GMN A;  2ZWR A;  4PVT A;  4ZO3 A;  2I7T A;  5A0T A;  3RPC A;  1WW1 A;  3IE1 A;  1VME A;  2E7Y A;  2ZZI A;  4Z5Y A;  2ZNB A;  5EHT A;  4EXY A;  2CG3 A;  2WRS A;  1QH3 A;  4TZB A;  4ZO2 A;  3X2X A;  3IE0 A;  5HH4 A;  4XWT A;  3A4Y A;  3VQZ A;  5A0V A;  2BIB A;  4TZE A;  1YCF A;  4ZNB A;  4TZ9 A;  3RKK A;  2BC2 A;  3H3E A;  1DD6 A;  5AHO A;  4ZEJ A;  4C09 A;  4YSK A;  3T3O A;  2NYP A;  5LLD A;  3TP9 A;  5EVB A;  1JJT A;  3IOF A;  1ZTC A;  3RKJ A;  4D1V A;  4HL2 A;  4RAW A;  3T3N A;  1KR3 A;  1L9Y A;  4GYU A;  4C1H A;  5B15 A;  1VJN A;  3IEL A;  5LMC A;  5LM6 A;  2OHJ A;  3SD9 A;  5AEB A;  4F6Z A;  2BG7 A;  2FHX B;  3DHC A;  3I11 A;  2CFZ A;  4DIK A;  4C1G A;  3PG4 A;  2P18 A;  3F9O A;  4UWS B;  2WYM A;  5ACW A;  2FU7 A;  2Y87 A;  2YNU A;  1VGN A;  5A5Z A;  1BC2 A;  3FAI A;  4AX1 B;  4RL0 A;  5AXO A;  5B3R A;  5ACX A;  5LCF A;  3BK2 A;  3AJ3 A;  5AJL A;  2M5D A;  4YSL A;  4AWY B;  5IQK A;  5KIL A;  2Q0I A;  3AF5 A;  2DKF A;  2Q9U A; 
#chains in the Genus database with same CATH homology
 2BG8 A;  1X8H A;  4CHL A;  4D1W A;  5HIP A;  3ZWF A;  4YSB A;  2YNW A;  2HB9 A;  1YCG A;  4EFZ A;  3LVZ A;  1HLK A;  3X2Z A;  3I15 A;  1X8I A;  2P4Z A;  3S0Z A;  4C1F A;  4UWP B;  5B1U A;  2BR6 A;  5HIO A;  3Q6V A;  1ZNB A;  5FQC A;  2QJS A;  2OHH A;  3SRX A;  4HKY A;  2BG8 B;  1A8T A;  5FQB A;  1DXK A;  2I7V A;  2A7M A;  5EW0 A;  2XR1 A;  5AXR A;  4HL1 A;  5ACT A;  5ACV A;  2BFK A;  4C1C A;  2BFZ B;  2FK6 A;  3ESH A;  2BG2 A;  2Y8B A;  3IE2 A;  3WXC A;  5LSC A;  5EVD A;  4V0H A;  2XF4 A;  4AWZ A;  3SFP A;  3SBL A;  3QH8 A;  4C1E A;  4U4L A;  4UA4 A;  2BFZ A;  2P1E A;  2GCU A;  4UAM A;  1WRA A;  4FR7 A;  5EVK A;  4NQ2 A;  1KO3 A;  3ADR A;  4TZF A;  2BFL A;  4RAM A;  4Z67 A;  5KIK A;  2QIN A;  1SML A;  2YNV B;  2FHX A;  4EYB A;  3PY5 A;  3IEK A;  2VW8 A;  5K4M A;  3BC2 A;  1XM8 A;  1ZKP A;  2GFJ A;  5HH6 A;  4D1T A;  2QDT A;  4GCW A;  4RM5 A;  1Y44 A;  3MD7 A;  2OHI A;  4O98 A;  5AHR A;  5ACR A;  2Q0J A;  2BGA A;  4Z5Z A;  3X30 A;  4B87 A;  1K07 A;  2BMI A;  1M2X A;  3PY6 A;  4GYQ A;  3I0V A;  4DIL A;  5LS3 A;  3BV6 A;  2AIO A;  3IDZ A;  5A87 A;  5ACS A;  2YNT A;  5ACQ A;  3DHB A;  2NZE A;  5ACP A;  2QDS A;  1YCH A;  4NQ6 A;  4EYL A;  3X2Y A;  4WD6 A;  1A7T A;  4J5F A;  4XUK A;  2QED A;  4PVO A;  5LCA A;  2WYL A;  4XWW A;  3IEM A;  4BP0 A;  3AF6 A;  2ZO4 A;  3T9M A;  2M5C A;  3P2U A;  3KL7 A;  5ACU A;  2YNV A;  4RBS A;  4KEP A;  4RL2 A;  1XTO A;  2GFK A;  3I13 A;  5K4N A;  2CBN A;  5EV6 A;  4LE6 A;  3DHA A;  2WHG A;  4TYF A;  1JJE A;  4NQ5 A;  4KEQ A;  1WUP A;  4J5H A;  2FU6 A;  3L6N A;  5EWA A;  3G1P A;  1WUO A;  4EYF A;  3KNR A;  5LCH A;  3R2U A;  3FCZ A;  4Z60 A;  2FU8 A;  4FSB A;  3ZQ4 A;  4JO0 A;  3VPE A;  5EV8 A;  3IOG A;  2I7X A;  1MQO A;  4NQ4 A;  2GKL A;  5HH5 A;  1KO2 A;  2WYM C;  2FM6 A;  4UWO B;  3ZR9 A;  5K4K A;  5EH9 A;  5HIS A;  5FQA A;  5HIQ A;  2P97 A;  4H0D A;  3DH8 A;  2UYX A;  1P9E A;  1BMC A;  4EY2 A;  4D1U A;  5K0W A;  4AX0 B;  2YZ3 A;  3I14 A;  2YCB A;  4FEK A;  3JXP A;  4UBQ A;  4UWR B;  4AD9 A;  1JT1 A;  2FU9 A;  5AYA A;  1X8G A;  4BZ3 A;  4D02 A;  4TYT A;  1BVT A;  4Z7R A;  5LE1 A;  2YNT B;  4Z6X A;  3ZNB A;  1E5D A;  4C1D A;  2NXA A;  2NZF A;  2Q42 A;  3SPU A;  3KNS A;  2DOO A;  2BG6 A;  4F6H A;  5DPX A;  2AZ4 A;  2BTN A;  2R2D A;  2Y8A A;  1QH5 A;  4EXS A;  3BK1 A;  1DDK A;  4P62 A;  3SW3 A;  2H6A A;  2GMN A;  2ZWR A;  4PVT A;  4ZO3 A;  2I7T A;  5A0T A;  3RPC A;  1WW1 A;  3IE1 A;  1VME A;  2E7Y A;  2ZZI A;  4Z5Y A;  2ZNB A;  5EHT A;  4EXY A;  2WRS A;  1QH3 A;  4TZB A;  4ZO2 A;  3X2X A;  3IE0 A;  5HH4 A;  4XWT A;  3A4Y A;  3VQZ A;  5A0V A;  2BIB A;  4TZE A;  1YCF A;  4ZNB A;  4TZ9 A;  3RKK A;  2BC2 A;  3H3E A;  1DD6 A;  5AHO A;  4ZEJ A;  4C09 A;  4YSK A;  3T3O A;  2NYP A;  5LLD A;  3TP9 A;  5EVB A;  1JJT A;  3IOF A;  1ZTC A;  3RKJ A;  4D1V A;  4HL2 A;  4RAW A;  3T3N A;  1KR3 A;  1L9Y A;  4GYU A;  4C1H A;  5B15 A;  1VJN A;  3IEL A;  5LMC A;  5LM6 A;  2OHJ A;  3SD9 A;  5AEB A;  4F6Z A;  2BG7 A;  2FHX B;  3DHC A;  3I11 A;  4DIK A;  4C1G A;  3PG4 A;  2P18 A;  3F9O A;  4UWS B;  2WYM A;  5ACW A;  2FU7 A;  2Y87 A;  2YNU A;  1VGN A;  5A5Z A;  1BC2 A;  3FAI A;  4AX1 B;  4RL0 A;  5AXO A;  5B3R A;  5ACX A;  5LCF A;  3BK2 A;  3AJ3 A;  4AWY B;  2M5D A;  4YSL A;  5IQK A;  5KIL A;  2Q0I A;  3AF5 A;  2DKF A;  2Q9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...