5K0WA

Crystal structure of the metallo-beta-lactamase gob-18 from elizabethkingia meningoseptica
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
SAQVVKEPENMPKEWNQAYEPFRIAGNLYYVGTYDLASYLIVTDKGNILINTGTAESFPIIKANIQKLGFNYKDIKILLLTQAHYDHTGALQDFKTETAAKFYVDKADVDVLRTGGKSDYEMGKYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHPGHTKGSCSFIFETKDEKRKYRVLIANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHASQFDLHEKRKEGDPYNPQLFMDKQSYFQNLNDLEKSYLNKIKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B carbapenemase GOB-18
publication title Crystal Structure of the Metallo-beta-Lactamase GOB in the Periplasmic Dizinc Form Reveals an Unusual Metal Site.
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5k0wA00
5EHTA 5ACPA 3SPUA 2BC2A 4EXSA 2BTNA 1X8HA 5AHRA 5LMCA 4UA4A 4RAWA 2BG2A 3R2UA 4C1GA 1BMCA 1YCHA 2OHIA 5ACTA 3AF6A 5LM6A 5K4KA 2GCUA 2YNTA 4ZNBA 5HIPA 2HB9A 3AJ3A 3BK1A 4RL2A 3PG4A 4C1EA 5LCFA 2CBNA 2P18A 2FU9A 2Q0JA 1QH5A 5HH4A 4AWYB 1MQOA 4GYUA 4TYFA 4Z5YA 4XWTA 1BVTA 3ADRA 3DHBA 3RPCA 1A8TA 2VW8A 2BFKA 2BG6A 3KNRA 2FU6A 3ESHA 1JJTA 3PY6A 1DXKA 4XUKA 3PY5A 4D02A 4ZO3A 2Q42A 4UBQA 2AZ4A 2QINA 3JXPA 3AF5A 4J5FA 4NQ2A 2ZNBA 1E5DA 2Y8BA 3IEKA 3SBLA 3BV6A 4KEQA 4HL1A 3X2XA 5B3RA 3I14A 5A0TA 1XM8A 5LS3A 2YNVB 4C09A 5ACUA 4UWOB 2P4ZA 2NYPA 1M2XA 5HH6A 5EV8A 2FM6A 4FR7A 5EW0A 3TP9A 4D1TA 2NZEA 3FCZA 4YSKA 5AXRA 4RM5A 3A4YA 4TZ9A 1X8GA 3ZR9A 5B1UA 4UAMA 2QDSA 3DHAA 1DDKA 5ACSA 2AIOA 4UWSB 3T9MA 5HH5A 4H0DA 4HKYA 2I7XA 3RKJA 5EVDA 1QH3A 4EY2A 4C1HA 1ZTCA 5FQAA 4YSBA 3ZWFA 4NQ6A 2BG8A 3IOFA 5HIOA 2P1EA 2UYXA 1P9EA 3G1PA 5K4NA 3DH8A 2I7VA 4P62A 3SRXA 3L6NA 5KIKA 4Z67A 5IQKA 1K07A 5EV6A 4NQ5A 1KR3A 5ACRA 2BFZA 4AWZA 2YNVA 1XTOA 2FHXB 4EFZA 4WD6A 3LVZA 5ACXA 3WXCA 3SFPA 2NXAA 4PVOA 1WRAA 5K4MA 1VMEA 2GFKA 3KNSA 2BR6A 4EYFA 5K0WA 5LCAA 2I7TA 4TZEA 3IE1A 3X2ZA 1ZKPA 5AEBA 4D1UA 2BFLA 5KILA 2Q9UA 3S0ZA 2ZZIA 4B87A 3SW3A 1DD6A 4ZO2A 5HISA 4C1FA 5EVKA 1JJEA 5FQBA 2YNTB 3IDZA 2M5CA 2QJSA 4FEKA 5A5ZA 5LLDA 2ZO4A 4Z7RA 2WYLA 4JO0A 3IEMA 3BC2A 2Y8AA 4EYLA 3IOGA 3T3OA 4KEPA 2DOOA 4RL0A 3IELA 1VJNA 4C1CA 5EWAA 1YCGA 2ZWRA 5AYAA 3I15A 3IE0A 1HLKA 2XR1A 4F6ZA 3VQZA 2QEDA 2Q0IA 1KO2A 1BC2A 4GCWA 2XF4A 5EH9A 2FK6A 2YNUA 4Z5ZA 3X30A 4BP0A 2OHHA 4NQ4A 5LSCA 4F6HA 4C1DA 4D1WA 5B15A 4EYBA 2GKLA 2WHGA 3I11A 4Z60A 1JT1A 5HIQA 2GMNA 4O98A 4TYTA 4D1VA 1Y44A 5AHOA 5ACQA 4U4LA 4AX1B 2E7YA 4AX0B 2FU8A 5A0VA 3T3NA 5AXOA 1VGNA 2BG7A 4AD9A 5DPXA 3H3EA 3ZQ4A 3I0VA 4UWPB 2A7MA 4EXYA 5ACWA 1YCFA 2M5DA 5LE1A 2BGAA 2BMIA 4FSBA 2DKFA 2YCBA 2GFJA 4BZ3A 4DIKA 4J5HA 4CHLA 1X8IA 4YSLA 4ZEJA 3KL7A 2R2DA 3SD9A 4GYQA 3QH8A 4RBSA 3RKKA 5EVBA 2FU7A 2BG8B 2Y87A 5FQCA 4XWWA 4DILA 1ZNBA 1WUPA 4HL2A 4TZFA 1L9YA 1WUOA 3X2YA 5A87A 1SMLA 4UWRB 2QDTA 1A7TA 2WYMA 2BIBA 5LCHA 3ZNBA 2YNWA 1KO3A 2NZFA 4Z6XA 3P2UA 2BFZB 4TZBA 4RAMA 2WYMC 4PVTA 3I13A 3F9OA 3IE2A 4LE6A 3BK2A 3Q6VA 3DHCA 2WRSA 2YZ3A 5ACVA 3VPEA 4V0HA 1WW1A 2FHXA 2H6AA 2P97A 3MD7A 3FAIA 2OHJA
chains in the Genus database with same CATH superfamily
5EHTA 5ACPA 3SPUA 2BC2A 4EXSA 2BTNA 1X8HA 5AHRA 5LMCA 2CFUA 4UA4A 4RAWA 2BG2A 3R2UA 4C1GA 1BMCA 1YCHA 2OHIA 5ACTA 3AF6A 5LM6A 5K4KA 2GCUA 2YNTA 4ZNBA 5HIPA 2HB9A 5A23A 3AJ3A 3BK1A 4RL2A 3PG4A 4C1EA 5LCFA 2CBNA 2P18A 2FU9A 2Q0JA 1QH5A 5HH4A 4AWYB 1MQOA 4GYUA 4TYFA 4Z5YA 4XWTA 2YHEA 1BVTA 3ADRA 3DHBA 3RPCA 1A8TA 2VW8A 2BFKA 2BG6A 3KNRA 5AJLA 2FU6A 3ESHA 1JJTA 3PY6A 1DXKA 4XUKA 3PY5A 4D02A 4ZO3A 2Q42A 4UBQA 2AZ4A 2QINA 3JXPA 3AF5A 4J5FA 4NQ2A 2ZNBA 1E5DA 2Y8BA 3IEKA 3SBLA 3BV6A 4KEQA 4HL1A 3X2XA 5B3RA 3I14A 5A0TA 1XM8A 5LS3A 2YNVB 4C09A 5ACUA 4UWOB 2P4ZA 2NYPA 1M2XA 5HH6A 5EV8A 2FM6A 4FR7A 5EW0A 3TP9A 4D1TA 2NZEA 3FCZA 4YSKA 5AXRA 4RM5A 3A4YA 4TZ9A 1X8GA 3ZR9A 5B1UA 4UAMA 2QDSA 3DHAA 1DDKA 5ACSA 2AIOA 4UWSB 3T9MA 5HH5A 4H0DA 4HKYA 2I7XA 3RKJA 5EVDA 1QH3A 4EY2A 4C1HA 1ZTCA 5FQAA 4YSBA 3ZWFA 4NQ6A 2BG8A 3IOFA 5HIOA 2P1EA 2UYXA 1P9EA 3G1PA 5K4NA 3DH8A 2I7VA 4P62A 3SRXA 3L6NA 5KIKA 4Z67A 5IQKA 1K07A 5EV6A 4NQ5A 1KR3A 5ACRA 2BFZA 4AWZA 2YNVA 1XTOA 2FHXB 4EFZA 4WD6A 3LVZA 5ACXA 3WXCA 3SFPA 2NXAA 4PVOA 1WRAA 5K4MA 1VMEA 2GFKA 3KNSA 2BR6A 4PDXA 4EYFA 5K0WA 5LCAA 2I7TA 4TZEA 3IE1A 3X2ZA 1ZKPA 5AEBA 4D1UA 2BFLA 5KILA 2Q9UA 3S0ZA 2ZZIA 4B87A 3SW3A 1DD6A 5AIJA 4ZO2A 5HISA 2CG2A 4C1FA 5EVKA 1JJEA 5FQBA 2YNTB 3IDZA 2M5CA 2QJSA 4FEKA 5A5ZA 5LLDA 2ZO4A 4Z7RA 2WYLA 4JO0A 3IEMA 3BC2A 2Y8AA 4EYLA 3IOGA 4NURA 3T3OA 4KEPA 4AXHA 2DOOA 4RL0A 3IELA 4C1CA 1VJNA 4AV7A 5EWAA 1YCGA 2ZWRA 5AYAA 3I15A 3IE0A 1HLKA 2XR1A 4F6ZA 3VQZA 2QEDA 2Q0IA 1KO2A 1BC2A 4GCWA 2XF4A 5EH9A 2FK6A 2YNUA 4Z5ZA 3X30A 4BP0A 2OHHA 4NQ4A 5LSCA 4F6HA 4C1DA 4D1WA 5B15A 4EYBA 2GKLA 2WHGA 3I11A 4Z60A 1JT1A 5HIQA 2GMNA 4O98A 4TYTA 4D1VA 2CFZA 1Y44A 5AHOA 5ACQA 4U4LA 4AX1B 2E7YA 4AX0B 2FU8A 5A0VA 3T3NA 5AXOA 1VGNA 2BG7A 4AD9A 5DPXA 3H3EA 3ZQ4A 3I0VA 4UWPB 2A7MA 4EXYA 5ACWA 1YCFA 2M5DA 5LE1A 2BGAA 2BMIA 4FSBA 2DKFA 2YCBA 2GFJA 4BZ3A 4DIKA 4J5HA 4CHLA 1X8IA 4YSLA 4ZEJA 3KL7A 2R2DA 3SD9A 4GYQA 3QH8A 4RBSA 3RKKA 5EVBA 2FU7A 2BG8B 2CG3A 2Y87A 5FQCA 4XWWA 4DILA 1ZNBA 1WUPA 4HL2A 4TZFA 1L9YA 1WUOA 3X2YA 5A87A 1SMLA 4UWRB 2QDTA 1A7TA 2WYMA 2BIBA 5LCHA 3ZNBA 2YNWA 1KO3A 2NZFA 4Z6XA 3P2UA 2BFZB 4TZBA 4RAMA 2WYMC 4PVTA 3I13A 3F9OA 3IE2A 4LE6A 3BK2A 3Q6VA 3DHCA 2WRSA 2YZ3A 5ACVA 3VPEA 4V0HA 1WW1A 2FHXA 2H6AA 2P97A 3MD7A 3FAIA 2OHJA
chains in the Genus database with same CATH topology
5EHTA 5ACPA 3SPUA 2BC2A 4EXSA 2BTNA 1X8HA 5AHRA 5LMCA 4UA4A 4RAWA 2BG2A 3R2UA 4C1GA 1BMCA 1YCHA 2OHIA 5ACTA 3AF6A 5LM6A 5K4KA 2GCUA 2YNTA 4ZNBA 5HIPA 2HB9A 3AJ3A 3BK1A 4RL2A 3PG4A 4C1EA 5LCFA 2CBNA 2P18A 2FU9A 2Q0JA 1QH5A 5HH4A 4AWYB 1MQOA 4GYUA 4TYFA 4Z5YA 4XWTA 1BVTA 3ADRA 3DHBA 3RPCA 1A8TA 2VW8A 2BFKA 2BG6A 3KNRA 2FU6A 3ESHA 1JJTA 3PY6A 1DXKA 4XUKA 3PY5A 4D02A 4ZO3A 2Q42A 4UBQA 2AZ4A 2QINA 3JXPA 3AF5A 4J5FA 4NQ2A 2ZNBA 1E5DA 2Y8BA 3IEKA 3SBLA 3BV6A 4KEQA 4HL1A 3X2XA 5B3RA 3I14A 5A0TA 1XM8A 5LS3A 2YNVB 4C09A 5ACUA 4UWOB 2P4ZA 2NYPA 1M2XA 5HH6A 5EV8A 2FM6A 4FR7A 5EW0A 3TP9A 4D1TA 2NZEA 3FCZA 4YSKA 5AXRA 4RM5A 3A4YA 4TZ9A 1X8GA 3ZR9A 5B1UA 4UAMA 2QDSA 3DHAA 1DDKA 5ACSA 2AIOA 4UWSB 3T9MA 5HH5A 4H0DA 4HKYA 2I7XA 3RKJA 5EVDA 1QH3A 4EY2A 4C1HA 1ZTCA 5FQAA 4YSBA 3ZWFA 4NQ6A 2BG8A 3IOFA 5HIOA 2P1EA 2UYXA 1P9EA 3G1PA 5K4NA 3DH8A 2I7VA 4P62A 3SRXA 3L6NA 5KIKA 4Z67A 5IQKA 1K07A 5EV6A 4NQ5A 1KR3A 5ACRA 2BFZA 4AWZA 2YNVA 1XTOA 2FHXB 4EFZA 4WD6A 3LVZA 5ACXA 3WXCA 3SFPA 2NXAA 4PVOA 1WRAA 5K4MA 1VMEA 2GFKA 3KNSA 2BR6A 4EYFA 5K0WA 5LCAA 2I7TA 4TZEA 3IE1A 3X2ZA 1ZKPA 5AEBA 4D1UA 2BFLA 5KILA 2Q9UA 3S0ZA 2ZZIA 4B87A 3SW3A 1DD6A 4ZO2A 5HISA 4C1FA 5EVKA 1JJEA 5FQBA 2YNTB 3IDZA 2M5CA 2QJSA 4FEKA 5A5ZA 5LLDA 2ZO4A 4Z7RA 2WYLA 4JO0A 3IEMA 3BC2A 2Y8AA 4EYLA 3IOGA 3T3OA 4KEPA 2DOOA 4RL0A 3IELA 1VJNA 4C1CA 5EWAA 1YCGA 2ZWRA 5AYAA 3I15A 3IE0A 1HLKA 2XR1A 4F6ZA 3VQZA 2QEDA 2Q0IA 1KO2A 1BC2A 4GCWA 2XF4A 5EH9A 2FK6A 2YNUA 4Z5ZA 3X30A 4BP0A 2OHHA 4NQ4A 5LSCA 4F6HA 4C1DA 4D1WA 5B15A 4EYBA 2GKLA 2WHGA 3I11A 4Z60A 1JT1A 5HIQA 2GMNA 4O98A 4TYTA 4D1VA 1Y44A 5AHOA 5ACQA 4U4LA 4AX1B 2E7YA 4AX0B 2FU8A 5A0VA 3T3NA 5AXOA 1VGNA 2BG7A 4AD9A 5DPXA 3H3EA 3ZQ4A 3I0VA 4UWPB 2A7MA 4EXYA 5ACWA 1YCFA 2M5DA 5LE1A 2BGAA 2BMIA 4FSBA 2DKFA 2YCBA 2GFJA 4BZ3A 4DIKA 4J5HA 4CHLA 1X8IA 4YSLA 4ZEJA 3KL7A 2R2DA 3SD9A 4GYQA 3QH8A 4RBSA 3RKKA 5EVBA 2FU7A 2BG8B 2Y87A 5FQCA 4XWWA 4DILA 1ZNBA 1WUPA 4HL2A 4TZFA 1L9YA 1WUOA 3X2YA 5A87A 1SMLA 4UWRB 2QDTA 1A7TA 2WYMA 2BIBA 5LCHA 3ZNBA 2YNWA 1KO3A 2NZFA 4Z6XA 3P2UA 2BFZB 4TZBA 4RAMA 2WYMC 4PVTA 3I13A 3F9OA 3IE2A 4LE6A 3BK2A 3Q6VA 3DHCA 2WRSA 2YZ3A 5ACVA 3VPEA 4V0HA 1WW1A 2FHXA 2H6AA 2P97A 3MD7A 3FAIA 2OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EHT A;  5ACP A;  3SPU A;  2BC2 A;  4EXS A;  2BTN A;  1X8H A;  5AHR A;  5LMC A;  4UA4 A;  4RAW A;  2BG2 A;  3R2U A;  4C1G A;  1BMC A;  1YCH A;  2OHI A;  5ACT A;  3AF6 A;  5LM6 A;  5K4K A;  2GCU A;  2YNT A;  4ZNB A;  5HIP A;  2HB9 A;  3AJ3 A;  3BK1 A;  4RL2 A;  3PG4 A;  4C1E A;  5LCF A;  2CBN A;  2P18 A;  2FU9 A;  2Q0J A;  1QH5 A;  5HH4 A;  4AWY B;  1MQO A;  4GYU A;  4TYF A;  4Z5Y A;  4XWT A;  1BVT A;  3ADR A;  3DHB A;  3RPC A;  1A8T A;  2VW8 A;  2BFK A;  2BG6 A;  3KNR A;  2FU6 A;  3ESH A;  1JJT A;  3PY6 A;  1DXK A;  4XUK A;  3PY5 A;  4D02 A;  4ZO3 A;  2Q42 A;  4UBQ A;  2AZ4 A;  2QIN A;  3JXP A;  3AF5 A;  4J5F A;  4NQ2 A;  2ZNB A;  1E5D A;  2Y8B A;  3IEK A;  3SBL A;  3BV6 A;  4KEQ A;  4HL1 A;  3X2X A;  5B3R A;  3I14 A;  5A0T A;  1XM8 A;  5LS3 A;  2YNV B;  4C09 A;  5ACU A;  4UWO B;  2P4Z A;  2NYP A;  1M2X A;  5HH6 A;  5EV8 A;  2FM6 A;  4FR7 A;  5EW0 A;  3TP9 A;  4D1T A;  2NZE A;  3FCZ A;  4YSK A;  5AXR A;  4RM5 A;  3A4Y A;  4TZ9 A;  1X8G A;  3ZR9 A;  5B1U A;  4UAM A;  2QDS A;  3DHA A;  1DDK A;  5ACS A;  2AIO A;  4UWS B;  3T9M A;  5HH5 A;  4H0D A;  4HKY A;  2I7X A;  3RKJ A;  5EVD A;  1QH3 A;  4EY2 A;  4C1H A;  1ZTC A;  5FQA A;  4YSB A;  3ZWF A;  4NQ6 A;  2BG8 A;  3IOF A;  5HIO A;  2P1E A;  2UYX A;  1P9E A;  3G1P A;  5K4N A;  3DH8 A;  2I7V A;  4P62 A;  3SRX A;  3L6N A;  5KIK A;  4Z67 A;  5IQK A;  1K07 A;  5EV6 A;  4NQ5 A;  1KR3 A;  5ACR A;  2BFZ A;  4AWZ A;  2YNV A;  1XTO A;  2FHX B;  4EFZ A;  4WD6 A;  3LVZ A;  5ACX A;  3WXC A;  3SFP A;  2NXA A;  4PVO A;  1WRA A;  5K4M A;  1VME A;  2GFK A;  3KNS A;  2BR6 A;  4EYF A;  5K0W A;  5LCA A;  2I7T A;  4TZE A;  3IE1 A;  3X2Z A;  1ZKP A;  5AEB A;  4D1U A;  2BFL A;  5KIL A;  2Q9U A;  3S0Z A;  2ZZI A;  4B87 A;  3SW3 A;  1DD6 A;  4ZO2 A;  5HIS A;  4C1F A;  5EVK A;  1JJE A;  5FQB A;  2YNT B;  3IDZ A;  2M5C A;  2QJS A;  4FEK A;  5A5Z A;  5LLD A;  2ZO4 A;  4Z7R A;  2WYL A;  4JO0 A;  3IEM A;  3BC2 A;  2Y8A A;  4EYL A;  3IOG A;  3T3O A;  4KEP A;  2DOO A;  4RL0 A;  3IEL A;  1VJN A;  4C1C A;  5EWA A;  1YCG A;  2ZWR A;  5AYA A;  3I15 A;  3IE0 A;  1HLK A;  2XR1 A;  4F6Z A;  3VQZ A;  2QED A;  2Q0I A;  1KO2 A;  1BC2 A;  4GCW A;  2XF4 A;  5EH9 A;  2FK6 A;  2YNU A;  4Z5Z A;  3X30 A;  4BP0 A;  2OHH A;  4NQ4 A;  5LSC A;  4F6H A;  4C1D A;  4D1W A;  5B15 A;  4EYB A;  2GKL A;  2WHG A;  3I11 A;  4Z60 A;  1JT1 A;  5HIQ A;  2GMN A;  4O98 A;  4TYT A;  4D1V A;  1Y44 A;  5AHO A;  5ACQ A;  4U4L A;  4AX1 B;  2E7Y A;  4AX0 B;  2FU8 A;  5A0V A;  3T3N A;  5AXO A;  1VGN A;  2BG7 A;  4AD9 A;  5DPX A;  3H3E A;  3ZQ4 A;  3I0V A;  4UWP B;  2A7M A;  4EXY A;  5ACW A;  1YCF A;  2M5D A;  5LE1 A;  2BGA A;  2BMI A;  4FSB A;  2DKF A;  2YCB A;  2GFJ A;  4BZ3 A;  4DIK A;  4J5H A;  4CHL A;  1X8I A;  4YSL A;  4ZEJ A;  3KL7 A;  2R2D A;  3SD9 A;  4GYQ A;  3QH8 A;  4RBS A;  3RKK A;  5EVB A;  2FU7 A;  2BG8 B;  2Y87 A;  5FQC A;  4XWW A;  4DIL A;  1ZNB A;  1WUP A;  4HL2 A;  4TZF A;  1L9Y A;  1WUO A;  3X2Y A;  5A87 A;  1SML A;  4UWR B;  2QDT A;  1A7T A;  2WYM A;  2BIB A;  5LCH A;  3ZNB A;  2YNW A;  1KO3 A;  2NZF A;  4Z6X A;  3P2U A;  2BFZ B;  4TZB A;  4RAM A;  2WYM C;  4PVT A;  3I13 A;  3F9O A;  3IE2 A;  4LE6 A;  3BK2 A;  3Q6V A;  3DHC A;  2WRS A;  2YZ3 A;  5ACV A;  3VPE A;  4V0H A;  1WW1 A;  2FHX A;  2H6A A;  2P97 A;  3MD7 A;  3FAI A;  2OHJ A; 
#chains in the Genus database with same CATH topology
 5EHT A;  5ACP A;  3SPU A;  2BC2 A;  4EXS A;  2BTN A;  1X8H A;  5AHR A;  5LMC A;  2CFU A;  4UA4 A;  4RAW A;  2BG2 A;  3R2U A;  4C1G A;  1BMC A;  1YCH A;  2OHI A;  5ACT A;  3AF6 A;  5LM6 A;  5K4K A;  2GCU A;  2YNT A;  4ZNB A;  5HIP A;  2HB9 A;  5A23 A;  3AJ3 A;  3BK1 A;  4RL2 A;  3PG4 A;  4C1E A;  5LCF A;  2CBN A;  2P18 A;  2FU9 A;  2Q0J A;  1QH5 A;  5HH4 A;  4AWY B;  1MQO A;  4GYU A;  4TYF A;  4Z5Y A;  4XWT A;  2YHE A;  1BVT A;  3ADR A;  3DHB A;  3RPC A;  1A8T A;  2VW8 A;  2BFK A;  2BG6 A;  3KNR A;  5AJL A;  2FU6 A;  3ESH A;  1JJT A;  3PY6 A;  1DXK A;  4XUK A;  3PY5 A;  4D02 A;  4ZO3 A;  2Q42 A;  4UBQ A;  2AZ4 A;  2QIN A;  3JXP A;  3AF5 A;  4J5F A;  4NQ2 A;  2ZNB A;  1E5D A;  2Y8B A;  3IEK A;  3SBL A;  3BV6 A;  4KEQ A;  4HL1 A;  3X2X A;  5B3R A;  3I14 A;  5A0T A;  1XM8 A;  5LS3 A;  2YNV B;  4C09 A;  5ACU A;  4UWO B;  2P4Z A;  2NYP A;  1M2X A;  5HH6 A;  5EV8 A;  2FM6 A;  4FR7 A;  5EW0 A;  3TP9 A;  4D1T A;  2NZE A;  3FCZ A;  4YSK A;  5AXR A;  4RM5 A;  3A4Y A;  4TZ9 A;  1X8G A;  3ZR9 A;  5B1U A;  4UAM A;  2QDS A;  3DHA A;  1DDK A;  5ACS A;  2AIO A;  4UWS B;  3T9M A;  5HH5 A;  4H0D A;  4HKY A;  2I7X A;  3RKJ A;  5EVD A;  1QH3 A;  4EY2 A;  4C1H A;  1ZTC A;  5FQA A;  4YSB A;  3ZWF A;  4NQ6 A;  2BG8 A;  3IOF A;  5HIO A;  2P1E A;  2UYX A;  1P9E A;  3G1P A;  5K4N A;  3DH8 A;  2I7V A;  4P62 A;  3SRX A;  3L6N A;  5KIK A;  4Z67 A;  5IQK A;  1K07 A;  5EV6 A;  4NQ5 A;  1KR3 A;  5ACR A;  2BFZ A;  4AWZ A;  2YNV A;  1XTO A;  2FHX B;  4EFZ A;  4WD6 A;  3LVZ A;  5ACX A;  3WXC A;  3SFP A;  2NXA A;  4PVO A;  1WRA A;  5K4M A;  1VME A;  2GFK A;  3KNS A;  2BR6 A;  4PDX A;  4EYF A;  5K0W A;  5LCA A;  2I7T A;  4TZE A;  3IE1 A;  3X2Z A;  1ZKP A;  5AEB A;  4D1U A;  2BFL A;  5KIL A;  2Q9U A;  3S0Z A;  2ZZI A;  4B87 A;  3SW3 A;  1DD6 A;  5AIJ A;  4ZO2 A;  5HIS A;  2CG2 A;  4C1F A;  5EVK A;  1JJE A;  5FQB A;  2YNT B;  3IDZ A;  2M5C A;  2QJS A;  4FEK A;  5A5Z A;  5LLD A;  2ZO4 A;  4Z7R A;  2WYL A;  4JO0 A;  3IEM A;  3BC2 A;  2Y8A A;  4EYL A;  3IOG A;  4NUR A;  3T3O A;  4KEP A;  4AXH A;  2DOO A;  4RL0 A;  3IEL A;  4C1C A;  1VJN A;  4AV7 A;  5EWA A;  1YCG A;  2ZWR A;  5AYA A;  3I15 A;  3IE0 A;  1HLK A;  2XR1 A;  4F6Z A;  3VQZ A;  2QED A;  2Q0I A;  1KO2 A;  1BC2 A;  4GCW A;  2XF4 A;  5EH9 A;  2FK6 A;  2YNU A;  4Z5Z A;  3X30 A;  4BP0 A;  2OHH A;  4NQ4 A;  5LSC A;  4F6H A;  4C1D A;  4D1W A;  5B15 A;  4EYB A;  2GKL A;  2WHG A;  3I11 A;  4Z60 A;  1JT1 A;  5HIQ A;  2GMN A;  4O98 A;  4TYT A;  4D1V A;  2CFZ A;  1Y44 A;  5AHO A;  5ACQ A;  4U4L A;  4AX1 B;  2E7Y A;  4AX0 B;  2FU8 A;  5A0V A;  3T3N A;  5AXO A;  1VGN A;  2BG7 A;  4AD9 A;  5DPX A;  3H3E A;  3ZQ4 A;  3I0V A;  4UWP B;  2A7M A;  4EXY A;  5ACW A;  1YCF A;  2M5D A;  5LE1 A;  2BGA A;  2BMI A;  4FSB A;  2DKF A;  2YCB A;  2GFJ A;  4BZ3 A;  4DIK A;  4J5H A;  4CHL A;  1X8I A;  4YSL A;  4ZEJ A;  3KL7 A;  2R2D A;  3SD9 A;  4GYQ A;  3QH8 A;  4RBS A;  3RKK A;  5EVB A;  2FU7 A;  2BG8 B;  2CG3 A;  2Y87 A;  5FQC A;  4XWW A;  4DIL A;  1ZNB A;  1WUP A;  4HL2 A;  4TZF A;  1L9Y A;  1WUO A;  3X2Y A;  5A87 A;  1SML A;  4UWR B;  2QDT A;  1A7T A;  2WYM A;  2BIB A;  5LCH A;  3ZNB A;  2YNW A;  1KO3 A;  2NZF A;  4Z6X A;  3P2U A;  2BFZ B;  4TZB A;  4RAM A;  2WYM C;  4PVT A;  3I13 A;  3F9O A;  3IE2 A;  4LE6 A;  3BK2 A;  3Q6V A;  3DHC A;  2WRS A;  2YZ3 A;  5ACV A;  3VPE A;  4V0H A;  1WW1 A;  2FHX A;  2H6A A;  2P97 A;  3MD7 A;  3FAI A;  2OHJ A; 
#chains in the Genus database with same CATH homology
 5EHT A;  5ACP A;  3SPU A;  2BC2 A;  4EXS A;  2BTN A;  1X8H A;  5AHR A;  5LMC A;  4UA4 A;  4RAW A;  2BG2 A;  3R2U A;  4C1G A;  1BMC A;  1YCH A;  2OHI A;  5ACT A;  3AF6 A;  5LM6 A;  5K4K A;  2GCU A;  2YNT A;  4ZNB A;  5HIP A;  2HB9 A;  3AJ3 A;  3BK1 A;  4RL2 A;  3PG4 A;  4C1E A;  5LCF A;  2CBN A;  2P18 A;  2FU9 A;  2Q0J A;  1QH5 A;  5HH4 A;  4AWY B;  1MQO A;  4GYU A;  4TYF A;  4Z5Y A;  4XWT A;  1BVT A;  3ADR A;  3DHB A;  3RPC A;  1A8T A;  2VW8 A;  2BFK A;  2BG6 A;  3KNR A;  2FU6 A;  3ESH A;  1JJT A;  3PY6 A;  1DXK A;  4XUK A;  3PY5 A;  4D02 A;  4ZO3 A;  2Q42 A;  4UBQ A;  2AZ4 A;  2QIN A;  3JXP A;  3AF5 A;  4J5F A;  4NQ2 A;  2ZNB A;  1E5D A;  2Y8B A;  3IEK A;  3SBL A;  3BV6 A;  4KEQ A;  4HL1 A;  3X2X A;  5B3R A;  3I14 A;  5A0T A;  1XM8 A;  5LS3 A;  2YNV B;  4C09 A;  5ACU A;  4UWO B;  2P4Z A;  2NYP A;  1M2X A;  5HH6 A;  5EV8 A;  2FM6 A;  4FR7 A;  5EW0 A;  3TP9 A;  4D1T A;  2NZE A;  3FCZ A;  4YSK A;  5AXR A;  4RM5 A;  3A4Y A;  4TZ9 A;  1X8G A;  3ZR9 A;  5B1U A;  4UAM A;  2QDS A;  3DHA A;  1DDK A;  5ACS A;  2AIO A;  4UWS B;  3T9M A;  5HH5 A;  4H0D A;  4HKY A;  2I7X A;  3RKJ A;  5EVD A;  1QH3 A;  4EY2 A;  4C1H A;  1ZTC A;  5FQA A;  4YSB A;  3ZWF A;  4NQ6 A;  2BG8 A;  3IOF A;  5HIO A;  2P1E A;  2UYX A;  1P9E A;  3G1P A;  5K4N A;  3DH8 A;  2I7V A;  4P62 A;  3SRX A;  3L6N A;  5KIK A;  4Z67 A;  5IQK A;  1K07 A;  5EV6 A;  4NQ5 A;  1KR3 A;  5ACR A;  2BFZ A;  4AWZ A;  2YNV A;  1XTO A;  2FHX B;  4EFZ A;  4WD6 A;  3LVZ A;  5ACX A;  3WXC A;  3SFP A;  2NXA A;  4PVO A;  1WRA A;  5K4M A;  1VME A;  2GFK A;  3KNS A;  2BR6 A;  4EYF A;  5K0W A;  5LCA A;  2I7T A;  4TZE A;  3IE1 A;  3X2Z A;  1ZKP A;  5AEB A;  4D1U A;  2BFL A;  5KIL A;  2Q9U A;  3S0Z A;  2ZZI A;  4B87 A;  3SW3 A;  1DD6 A;  4ZO2 A;  5HIS A;  4C1F A;  5EVK A;  1JJE A;  5FQB A;  2YNT B;  3IDZ A;  2M5C A;  2QJS A;  4FEK A;  5A5Z A;  5LLD A;  2ZO4 A;  4Z7R A;  2WYL A;  4JO0 A;  3IEM A;  3BC2 A;  2Y8A A;  4EYL A;  3IOG A;  3T3O A;  4KEP A;  2DOO A;  4RL0 A;  3IEL A;  1VJN A;  4C1C A;  5EWA A;  1YCG A;  2ZWR A;  5AYA A;  3I15 A;  3IE0 A;  1HLK A;  2XR1 A;  4F6Z A;  3VQZ A;  2QED A;  2Q0I A;  1KO2 A;  1BC2 A;  4GCW A;  2XF4 A;  5EH9 A;  2FK6 A;  2YNU A;  4Z5Z A;  3X30 A;  4BP0 A;  2OHH A;  4NQ4 A;  5LSC A;  4F6H A;  4C1D A;  4D1W A;  5B15 A;  4EYB A;  2GKL A;  2WHG A;  3I11 A;  4Z60 A;  1JT1 A;  5HIQ A;  2GMN A;  4O98 A;  4TYT A;  4D1V A;  1Y44 A;  5AHO A;  5ACQ A;  4U4L A;  4AX1 B;  2E7Y A;  4AX0 B;  2FU8 A;  5A0V A;  3T3N A;  5AXO A;  1VGN A;  2BG7 A;  4AD9 A;  5DPX A;  3H3E A;  3ZQ4 A;  3I0V A;  4UWP B;  2A7M A;  4EXY A;  5ACW A;  1YCF A;  2M5D A;  5LE1 A;  2BGA A;  2BMI A;  4FSB A;  2DKF A;  2YCB A;  2GFJ A;  4BZ3 A;  4DIK A;  4J5H A;  4CHL A;  1X8I A;  4YSL A;  4ZEJ A;  3KL7 A;  2R2D A;  3SD9 A;  4GYQ A;  3QH8 A;  4RBS A;  3RKK A;  5EVB A;  2FU7 A;  2BG8 B;  2Y87 A;  5FQC A;  4XWW A;  4DIL A;  1ZNB A;  1WUP A;  4HL2 A;  4TZF A;  1L9Y A;  1WUO A;  3X2Y A;  5A87 A;  1SML A;  4UWR B;  2QDT A;  1A7T A;  2WYM A;  2BIB A;  5LCH A;  3ZNB A;  2YNW A;  1KO3 A;  2NZF A;  4Z6X A;  3P2U A;  2BFZ B;  4TZB A;  4RAM A;  2WYM C;  4PVT A;  3I13 A;  3F9O A;  3IE2 A;  4LE6 A;  3BK2 A;  3Q6V A;  3DHC A;  2WRS A;  2YZ3 A;  5ACV A;  3VPE A;  4V0H A;  1WW1 A;  2FHX A;  2H6A A;  2P97 A;  3MD7 A;  3FAI A;  2OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...