5K0WA

Crystal structure of the metallo-beta-lactamase gob-18 from elizabethkingia meningoseptica
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
SAQVVKEPENMPKEWNQAYEPFRIAGNLYYVGTYDLASYLIVTDKGNILINTGTAESFPIIKANIQKLGFNYKDIKILLLTQAHYDHTGALQDFKTETAAKFYVDKADVDVLRTGGKSDYEMGKYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHPGHTKGSCSFIFETKDEKRKYRVLIANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHASQFDLHEKRKEGDPYNPQLFMDKQSYFQNLNDLEKSYLNKIKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Metallo-beta-Lactamase GOB in the Periplasmic Dizinc Form Reveals an Unusual Metal Site.
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
molecule keywords Class B carbapenemase GOB-18
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5k0wA00
4TZBA 2FM6A 4UWOB 2QDTA 4HKYA 3QH8A 4HL2A 2FU6A 4Z60A 4ZEJA 5LLDA 3IE2A 2AZ4A 2UYXA 3P2UA 2FK6A 4KEPA 1MQOA 3SFPA 5AHRA 4DIKA 3ADRA 3DHBA 1K07A 1DXKA 5EV8A 2BFZB 3TP9A 2WHGA 2FU8A 1M2XA 3LVZA 4NQ2A 4GYUA 2OHIA 3KL7A 3IOGA 4C1CA 2GKLA 2Q0JA 4EYBA 3BC2A 2BG7A 2DKFA 3DHCA 3RPCA 2QINA 4HL1A 1SMLA 3IE0A 2QEDA 4RAMA 4UWSB 3SPUA 3DHAA 1E5DA 5FQCA 4B87A 5B1UA 5HISA 5ACQA 4NQ4A 3BV6A 1HLKA 3BK2A 2GCUA 1WUOA 5EVDA 4WD6A 4O98A 4Z67A 3I11A 3SRXA 5A87A 2ZZIA 5HIQA 3SBLA 4PVTA 1WUPA 1ZTCA 3ZR9A 3SD9A 2YNVB 4J5HA 2OHJA 3VQZA 2YCBA 2H6AA 2YNTB 3SW3A 3BK1A 4D1WA 2YNTA 5EV6A 2Q9UA 3R2UA 4C1DA 2CBNA 1KO2A 5FQAA 2P18A 5ACVA 4GYQA 4F6HA 2DOOA 3PG4A 3F9OA 3T3OA 3ZNBA 4UWRB 4AX0B 2WYLA 5ACSA 5K0WA 2GFJA 4XUKA 4ZO3A 1A8TA 1VGNA 5AYAA 2YNWA 5B3RA 2WYMC 1YCHA 4UA4A 4AX1B 1QH3A 1YCFA 4ZO2A 2BMIA 3A4YA 4RBSA 3RKKA 5HH4A 1KR3A 3FAIA 2I7TA 2NZEA 4XWWA 4RL0A 5HH5A 3IEMA 2A7MA 1X8GA 2BG2A 3AF5A 3IEKA 4AD9A 4XWTA 5EW0A 5DPXA 5KIKA 5ACTA 4NQ6A 5EVKA 3ESHA 2GFKA 4AWZA 4YSLA 2HB9A 4C1HA 4Z7RA 3VPEA 5K4NA 4EFZA 4H0DA 4P62A 2QDSA 2YZ3A 3G1PA 4BP0A 1JT1A 5LM6A 4F6ZA 2I7VA 4FEKA 4D02A 1ZNBA 5HIPA 5K4MA 4C1EA 5ACRA 4RM5A 2M5CA 2Q42A 4TYFA 5ACWA 1BVTA 2OHHA 3KNSA 5LMCA 2BFLA 5K4KA 2NXAA 4Z5YA 4EYFA 5EHTA 4BZ3A 2AIOA 5FQBA 1QH5A 3ZQ4A 2XF4A 5AXRA 5ACPA 5LCAA 1VMEA 2Q0IA 4UWPB 2BIBA 1X8HA 4UAMA 2YNUA 2FU9A 3MD7A 2P4ZA 1P9EA 2Y8BA 3KNRA 3T9MA 2Y87A 2NZFA 5A0TA 2WRSA 3DH8A 4TYTA 4LE6A 4AWYB 5HIOA 1L9YA 4C1GA 5LE1A 5IQKA 3I15A 2BGAA 1A7TA 2BTNA 4Z6XA 4C1FA 2I7XA 4D1UA 5B15A 2XR1A 1BMCA 5A0VA 1KO3A 3L6NA 3PY5A 5KILA 5EH9A 2FHXB 4TZEA 4FR7A 4U4LA 5AXOA 5ACUA 4EXYA 4YSBA 5LCHA 1X8IA 4TZ9A 2ZO4A 4V0HA 2BFZA 4C09A 1JJEA 3RKJA 1DDKA 4PVOA 3IOFA 1WW1A 2P97A 5LSCA 3Q6VA 4NQ5A 4EXSA 4EY2A 2QJSA 1XTOA 2BFKA 3X2ZA 2P1EA 2M5DA 3IE1A 3FCZA 1Y44A 3T3NA 4CHLA 3H3EA 4TZFA 4GCWA 3JXPA 4RL2A 2BR6A 2YNVA 4JO0A 2ZNBA 2WYMA 2BC2A 4Z5ZA 3PY6A 5A5ZA 2GMNA 2FHXA 4DILA 1BC2A 2R2DA 1DD6A 2FU7A 4ZNBA 3I13A 2E7YA 3I0VA 5LS3A 4UBQA 3AJ3A 3X2XA 2Y8AA 4KEQA 5EWAA 2BG8A 5ACXA 4YSKA 3IELA 2NYPA 2VW8A 5HH6A 5EVBA 3IDZA 3ZWFA 4D1TA 4EYLA 3AF6A 2ZWRA 4FSBA 3I14A 1ZKPA 2BG8B 5LCFA 3X30A 5AHOA 3WXCA 1YCGA 4D1VA 3X2YA 2BG6A 4J5FA 4RAWA 1VJNA 5AEBA 3S0ZA 1JJTA 1XM8A 1WRAA
chains in the Genus database with same CATH superfamily
4TZBA 2FM6A 4UWOB 5AJLA 2QDTA 4HKYA 3QH8A 4HL2A 2FU6A 4Z60A 4ZEJA 5LLDA 3IE2A 2AZ4A 2UYXA 3P2UA 2FK6A 4KEPA 1MQOA 3SFPA 5AHRA 4DIKA 3ADRA 3DHBA 1K07A 1DXKA 4PDXA 5EV8A 2BFZB 3TP9A 2WHGA 2FU8A 1M2XA 3LVZA 4NQ2A 4GYUA 2OHIA 3KL7A 2YHEA 3IOGA 4C1CA 2GKLA 2Q0JA 4EYBA 3BC2A 2BG7A 2DKFA 3DHCA 3RPCA 2QINA 4HL1A 1SMLA 3IE0A 2QEDA 4RAMA 4UWSB 3SPUA 3DHAA 1E5DA 5FQCA 4B87A 5B1UA 5HISA 5ACQA 5AIJA 4NQ4A 3BV6A 1HLKA 3BK2A 2GCUA 1WUOA 5EVDA 4WD6A 4O98A 4Z67A 3I11A 3SRXA 5A87A 2ZZIA 5HIQA 3SBLA 4PVTA 1WUPA 1ZTCA 3ZR9A 3SD9A 2YNVB 2CFUA 4J5HA 2OHJA 3VQZA 2YCBA 2H6AA 2YNTB 3SW3A 5A23A 3BK1A 4D1WA 2YNTA 5EV6A 2CG2A 2Q9UA 3R2UA 4C1DA 2CBNA 1KO2A 5FQAA 2P18A 5ACVA 4GYQA 4F6HA 2DOOA 3PG4A 3F9OA 3T3OA 3ZNBA 4UWRB 4AX0B 2WYLA 5ACSA 5K0WA 2GFJA 4XUKA 4ZO3A 1A8TA 1VGNA 5AYAA 2YNWA 5B3RA 2WYMC 1YCHA 4UA4A 4AX1B 1QH3A 1YCFA 4ZO2A 2BMIA 3A4YA 4RBSA 3RKKA 5HH4A 1KR3A 3FAIA 2I7TA 2NZEA 4XWWA 4RL0A 5HH5A 3IEMA 2A7MA 1X8GA 2BG2A 3AF5A 3IEKA 4AD9A 4XWTA 5EW0A 5DPXA 5KIKA 5ACTA 4NQ6A 5EVKA 3ESHA 2GFKA 4AWZA 4YSLA 2HB9A 4C1HA 4Z7RA 3VPEA 5K4NA 4EFZA 4H0DA 4P62A 2QDSA 2YZ3A 3G1PA 4BP0A 1JT1A 5LM6A 4F6ZA 2I7VA 4FEKA 4D02A 1ZNBA 5HIPA 5K4MA 4C1EA 5ACRA 4RM5A 2M5CA 2Q42A 4TYFA 5ACWA 1BVTA 2OHHA 3KNSA 5LMCA 2BFLA 5K4KA 4AXHA 2NXAA 4Z5YA 4EYFA 5EHTA 4BZ3A 2AIOA 5FQBA 2CG3A 4AV7A 1QH5A 3ZQ4A 2XF4A 5AXRA 5ACPA 5LCAA 1VMEA 2Q0IA 4UWPB 2BIBA 1X8HA 4UAMA 2YNUA 2FU9A 3MD7A 2P4ZA 1P9EA 2Y8BA 3KNRA 3T9MA 2Y87A 2NZFA 5A0TA 2WRSA 3DH8A 4TYTA 4LE6A 4AWYB 5HIOA 1L9YA 4C1GA 5LE1A 5IQKA 2CFZA 3I15A 2BGAA 1A7TA 2BTNA 4Z6XA 4C1FA 2I7XA 4D1UA 5B15A 2XR1A 1BMCA 5A0VA 1KO3A 3L6NA 3PY5A 5KILA 5EH9A 2FHXB 4TZEA 4FR7A 4U4LA 5AXOA 5ACUA 4EXYA 4YSBA 5LCHA 1X8IA 4TZ9A 2ZO4A 4V0HA 2BFZA 4C09A 1JJEA 3RKJA 1DDKA 4PVOA 3IOFA 1WW1A 2P97A 5LSCA 3Q6VA 4NQ5A 4EXSA 4EY2A 2QJSA 1XTOA 2BFKA 3X2ZA 2P1EA 2M5DA 3IE1A 3FCZA 1Y44A 3T3NA 4CHLA 3H3EA 4TZFA 4GCWA 3JXPA 4RL2A 2BR6A 2YNVA 4JO0A 2ZNBA 2WYMA 2BC2A 4Z5ZA 3PY6A 5A5ZA 2GMNA 2FHXA 4DILA 1BC2A 2R2DA 1DD6A 2FU7A 4ZNBA 3I13A 4NURA 2E7YA 3I0VA 5LS3A 4UBQA 3AJ3A 3X2XA 2Y8AA 4KEQA 5EWAA 2BG8A 5ACXA 4YSKA 3IELA 2NYPA 2VW8A 5HH6A 5EVBA 3IDZA 3ZWFA 4D1TA 4EYLA 3AF6A 2ZWRA 4FSBA 3I14A 1ZKPA 2BG8B 5LCFA 3X30A 5AHOA 3WXCA 1YCGA 4D1VA 3X2YA 2BG6A 4J5FA 4RAWA 1VJNA 5AEBA 3S0ZA 1JJTA 1XM8A 1WRAA
chains in the Genus database with same CATH topology
4TZBA 2FM6A 4UWOB 2QDTA 4HKYA 3QH8A 4HL2A 2FU6A 4Z60A 4ZEJA 5LLDA 3IE2A 2AZ4A 2UYXA 3P2UA 2FK6A 4KEPA 1MQOA 3SFPA 5AHRA 4DIKA 3ADRA 3DHBA 1K07A 1DXKA 5EV8A 2BFZB 3TP9A 2WHGA 2FU8A 1M2XA 3LVZA 4NQ2A 4GYUA 2OHIA 3KL7A 3IOGA 4C1CA 2GKLA 2Q0JA 4EYBA 3BC2A 2BG7A 2DKFA 3DHCA 3RPCA 2QINA 4HL1A 1SMLA 3IE0A 2QEDA 4RAMA 4UWSB 3SPUA 3DHAA 1E5DA 5FQCA 4B87A 5B1UA 5HISA 5ACQA 4NQ4A 3BV6A 1HLKA 3BK2A 2GCUA 1WUOA 5EVDA 4WD6A 4O98A 4Z67A 3I11A 3SRXA 5A87A 2ZZIA 5HIQA 3SBLA 4PVTA 1WUPA 1ZTCA 3ZR9A 3SD9A 2YNVB 4J5HA 2OHJA 3VQZA 2YCBA 2H6AA 2YNTB 3SW3A 3BK1A 4D1WA 2YNTA 5EV6A 2Q9UA 3R2UA 4C1DA 2CBNA 1KO2A 5FQAA 2P18A 5ACVA 4GYQA 4F6HA 2DOOA 3PG4A 3F9OA 3T3OA 3ZNBA 4UWRB 4AX0B 2WYLA 5ACSA 5K0WA 2GFJA 4XUKA 4ZO3A 1A8TA 1VGNA 5AYAA 2YNWA 5B3RA 2WYMC 1YCHA 4UA4A 4AX1B 1QH3A 1YCFA 4ZO2A 2BMIA 3A4YA 4RBSA 3RKKA 5HH4A 1KR3A 3FAIA 2I7TA 2NZEA 4XWWA 4RL0A 5HH5A 3IEMA 2A7MA 1X8GA 2BG2A 3AF5A 3IEKA 4AD9A 4XWTA 5EW0A 5DPXA 5KIKA 5ACTA 4NQ6A 5EVKA 3ESHA 2GFKA 4AWZA 4YSLA 2HB9A 4C1HA 4Z7RA 3VPEA 5K4NA 4EFZA 4H0DA 4P62A 2QDSA 2YZ3A 3G1PA 4BP0A 1JT1A 5LM6A 4F6ZA 2I7VA 4FEKA 4D02A 1ZNBA 5HIPA 5K4MA 4C1EA 5ACRA 4RM5A 2M5CA 2Q42A 4TYFA 5ACWA 1BVTA 2OHHA 3KNSA 5LMCA 2BFLA 5K4KA 2NXAA 4Z5YA 4EYFA 5EHTA 4BZ3A 2AIOA 5FQBA 1QH5A 3ZQ4A 2XF4A 5AXRA 5ACPA 5LCAA 1VMEA 2Q0IA 4UWPB 2BIBA 1X8HA 4UAMA 2YNUA 2FU9A 3MD7A 2P4ZA 1P9EA 2Y8BA 3KNRA 3T9MA 2Y87A 2NZFA 5A0TA 2WRSA 3DH8A 4TYTA 4LE6A 4AWYB 5HIOA 1L9YA 4C1GA 5LE1A 5IQKA 3I15A 2BGAA 1A7TA 2BTNA 4Z6XA 4C1FA 2I7XA 4D1UA 5B15A 2XR1A 1BMCA 5A0VA 1KO3A 3L6NA 3PY5A 5KILA 5EH9A 2FHXB 4TZEA 4FR7A 4U4LA 5AXOA 5ACUA 4EXYA 4YSBA 5LCHA 1X8IA 4TZ9A 2ZO4A 4V0HA 2BFZA 4C09A 1JJEA 3RKJA 1DDKA 4PVOA 3IOFA 1WW1A 2P97A 5LSCA 3Q6VA 4NQ5A 4EXSA 4EY2A 2QJSA 1XTOA 2BFKA 3X2ZA 2P1EA 2M5DA 3IE1A 3FCZA 1Y44A 3T3NA 4CHLA 3H3EA 4TZFA 4GCWA 3JXPA 4RL2A 2BR6A 2YNVA 4JO0A 2ZNBA 2WYMA 2BC2A 4Z5ZA 3PY6A 5A5ZA 2GMNA 2FHXA 4DILA 1BC2A 2R2DA 1DD6A 2FU7A 4ZNBA 3I13A 2E7YA 3I0VA 5LS3A 4UBQA 3AJ3A 3X2XA 2Y8AA 4KEQA 5EWAA 2BG8A 5ACXA 4YSKA 3IELA 2NYPA 2VW8A 5HH6A 5EVBA 3IDZA 3ZWFA 4D1TA 4EYLA 3AF6A 2ZWRA 4FSBA 3I14A 1ZKPA 2BG8B 5LCFA 3X30A 5AHOA 3WXCA 1YCGA 4D1VA 3X2YA 2BG6A 4J5FA 4RAWA 1VJNA 5AEBA 3S0ZA 1JJTA 1XM8A 1WRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZB A;  2FM6 A;  4UWO B;  2QDT A;  4HKY A;  3QH8 A;  4HL2 A;  2FU6 A;  4Z60 A;  4ZEJ A;  5LLD A;  3IE2 A;  2AZ4 A;  2UYX A;  3P2U A;  2FK6 A;  4KEP A;  1MQO A;  3SFP A;  5AHR A;  4DIK A;  3ADR A;  3DHB A;  1K07 A;  1DXK A;  5EV8 A;  2BFZ B;  3TP9 A;  2WHG A;  2FU8 A;  1M2X A;  3LVZ A;  4NQ2 A;  4GYU A;  2OHI A;  3KL7 A;  3IOG A;  4C1C A;  2GKL A;  2Q0J A;  4EYB A;  3BC2 A;  2BG7 A;  2DKF A;  3DHC A;  3RPC A;  2QIN A;  4HL1 A;  1SML A;  3IE0 A;  2QED A;  4RAM A;  4UWS B;  3SPU A;  3DHA A;  1E5D A;  5FQC A;  4B87 A;  5B1U A;  5HIS A;  5ACQ A;  4NQ4 A;  3BV6 A;  1HLK A;  3BK2 A;  2GCU A;  1WUO A;  5EVD A;  4WD6 A;  4O98 A;  4Z67 A;  3I11 A;  3SRX A;  5A87 A;  2ZZI A;  5HIQ A;  3SBL A;  4PVT A;  1WUP A;  1ZTC A;  3ZR9 A;  3SD9 A;  2YNV B;  4J5H A;  2OHJ A;  3VQZ A;  2YCB A;  2H6A A;  2YNT B;  3SW3 A;  3BK1 A;  4D1W A;  2YNT A;  5EV6 A;  2Q9U A;  3R2U A;  4C1D A;  2CBN A;  1KO2 A;  5FQA A;  2P18 A;  5ACV A;  4GYQ A;  4F6H A;  2DOO A;  3PG4 A;  3F9O A;  3T3O A;  3ZNB A;  4UWR B;  4AX0 B;  2WYL A;  5ACS A;  5K0W A;  2GFJ A;  4XUK A;  4ZO3 A;  1A8T A;  1VGN A;  5AYA A;  2YNW A;  5B3R A;  2WYM C;  1YCH A;  4UA4 A;  4AX1 B;  1QH3 A;  1YCF A;  4ZO2 A;  2BMI A;  3A4Y A;  4RBS A;  3RKK A;  5HH4 A;  1KR3 A;  3FAI A;  2I7T A;  2NZE A;  4XWW A;  4RL0 A;  5HH5 A;  3IEM A;  2A7M A;  1X8G A;  2BG2 A;  3AF5 A;  3IEK A;  4AD9 A;  4XWT A;  5EW0 A;  5DPX A;  5KIK A;  5ACT A;  4NQ6 A;  5EVK A;  3ESH A;  2GFK A;  4AWZ A;  4YSL A;  2HB9 A;  4C1H A;  4Z7R A;  3VPE A;  5K4N A;  4EFZ A;  4H0D A;  4P62 A;  2QDS A;  2YZ3 A;  3G1P A;  4BP0 A;  1JT1 A;  5LM6 A;  4F6Z A;  2I7V A;  4FEK A;  4D02 A;  1ZNB A;  5HIP A;  5K4M A;  4C1E A;  5ACR A;  4RM5 A;  2M5C A;  2Q42 A;  4TYF A;  5ACW A;  1BVT A;  2OHH A;  3KNS A;  5LMC A;  2BFL A;  5K4K A;  2NXA A;  4Z5Y A;  4EYF A;  5EHT A;  4BZ3 A;  2AIO A;  5FQB A;  1QH5 A;  3ZQ4 A;  2XF4 A;  5AXR A;  5ACP A;  5LCA A;  1VME A;  2Q0I A;  4UWP B;  2BIB A;  1X8H A;  4UAM A;  2YNU A;  2FU9 A;  3MD7 A;  2P4Z A;  1P9E A;  2Y8B A;  3KNR A;  3T9M A;  2Y87 A;  2NZF A;  5A0T A;  2WRS A;  3DH8 A;  4TYT A;  4LE6 A;  4AWY B;  5HIO A;  1L9Y A;  4C1G A;  5LE1 A;  5IQK A;  3I15 A;  2BGA A;  1A7T A;  2BTN A;  4Z6X A;  4C1F A;  2I7X A;  4D1U A;  5B15 A;  2XR1 A;  1BMC A;  5A0V A;  1KO3 A;  3L6N A;  3PY5 A;  5KIL A;  5EH9 A;  2FHX B;  4TZE A;  4FR7 A;  4U4L A;  5AXO A;  5ACU A;  4EXY A;  4YSB A;  5LCH A;  1X8I A;  4TZ9 A;  2ZO4 A;  4V0H A;  2BFZ A;  4C09 A;  1JJE A;  3RKJ A;  1DDK A;  4PVO A;  3IOF A;  1WW1 A;  2P97 A;  5LSC A;  3Q6V A;  4NQ5 A;  4EXS A;  4EY2 A;  2QJS A;  1XTO A;  2BFK A;  3X2Z A;  2P1E A;  2M5D A;  3IE1 A;  3FCZ A;  1Y44 A;  3T3N A;  4CHL A;  3H3E A;  4TZF A;  4GCW A;  3JXP A;  4RL2 A;  2BR6 A;  2YNV A;  4JO0 A;  2ZNB A;  2WYM A;  2BC2 A;  4Z5Z A;  3PY6 A;  5A5Z A;  2GMN A;  2FHX A;  4DIL A;  1BC2 A;  2R2D A;  1DD6 A;  2FU7 A;  4ZNB A;  3I13 A;  2E7Y A;  3I0V A;  5LS3 A;  4UBQ A;  3AJ3 A;  3X2X A;  2Y8A A;  4KEQ A;  5EWA A;  2BG8 A;  5ACX A;  4YSK A;  3IEL A;  2NYP A;  2VW8 A;  5HH6 A;  5EVB A;  3IDZ A;  3ZWF A;  4D1T A;  4EYL A;  3AF6 A;  2ZWR A;  4FSB A;  3I14 A;  1ZKP A;  2BG8 B;  5LCF A;  3X30 A;  5AHO A;  3WXC A;  1YCG A;  4D1V A;  3X2Y A;  2BG6 A;  4J5F A;  4RAW A;  1VJN A;  5AEB A;  3S0Z A;  1JJT A;  1XM8 A;  1WRA A; 
#chains in the Genus database with same CATH topology
 4TZB A;  2FM6 A;  4UWO B;  5AJL A;  2QDT A;  4HKY A;  3QH8 A;  4HL2 A;  2FU6 A;  4Z60 A;  4ZEJ A;  5LLD A;  3IE2 A;  2AZ4 A;  2UYX A;  3P2U A;  2FK6 A;  4KEP A;  1MQO A;  3SFP A;  5AHR A;  4DIK A;  3ADR A;  3DHB A;  1K07 A;  1DXK A;  4PDX A;  5EV8 A;  2BFZ B;  3TP9 A;  2WHG A;  2FU8 A;  1M2X A;  3LVZ A;  4NQ2 A;  4GYU A;  2OHI A;  3KL7 A;  2YHE A;  3IOG A;  4C1C A;  2GKL A;  2Q0J A;  4EYB A;  3BC2 A;  2BG7 A;  2DKF A;  3DHC A;  3RPC A;  2QIN A;  4HL1 A;  1SML A;  3IE0 A;  2QED A;  4RAM A;  4UWS B;  3SPU A;  3DHA A;  1E5D A;  5FQC A;  4B87 A;  5B1U A;  5HIS A;  5ACQ A;  5AIJ A;  4NQ4 A;  3BV6 A;  1HLK A;  3BK2 A;  2GCU A;  1WUO A;  5EVD A;  4WD6 A;  4O98 A;  4Z67 A;  3I11 A;  3SRX A;  5A87 A;  2ZZI A;  5HIQ A;  3SBL A;  4PVT A;  1WUP A;  1ZTC A;  3ZR9 A;  3SD9 A;  2YNV B;  2CFU A;  4J5H A;  2OHJ A;  3VQZ A;  2YCB A;  2H6A A;  2YNT B;  3SW3 A;  5A23 A;  3BK1 A;  4D1W A;  2YNT A;  5EV6 A;  2CG2 A;  2Q9U A;  3R2U A;  4C1D A;  2CBN A;  1KO2 A;  5FQA A;  2P18 A;  5ACV A;  4GYQ A;  4F6H A;  2DOO A;  3PG4 A;  3F9O A;  3T3O A;  3ZNB A;  4UWR B;  4AX0 B;  2WYL A;  5ACS A;  5K0W A;  2GFJ A;  4XUK A;  4ZO3 A;  1A8T A;  1VGN A;  5AYA A;  2YNW A;  5B3R A;  2WYM C;  1YCH A;  4UA4 A;  4AX1 B;  1QH3 A;  1YCF A;  4ZO2 A;  2BMI A;  3A4Y A;  4RBS A;  3RKK A;  5HH4 A;  1KR3 A;  3FAI A;  2I7T A;  2NZE A;  4XWW A;  4RL0 A;  5HH5 A;  3IEM A;  2A7M A;  1X8G A;  2BG2 A;  3AF5 A;  3IEK A;  4AD9 A;  4XWT A;  5EW0 A;  5DPX A;  5KIK A;  5ACT A;  4NQ6 A;  5EVK A;  3ESH A;  2GFK A;  4AWZ A;  4YSL A;  2HB9 A;  4C1H A;  4Z7R A;  3VPE A;  5K4N A;  4EFZ A;  4H0D A;  4P62 A;  2QDS A;  2YZ3 A;  3G1P A;  4BP0 A;  1JT1 A;  5LM6 A;  4F6Z A;  2I7V A;  4FEK A;  4D02 A;  1ZNB A;  5HIP A;  5K4M A;  4C1E A;  5ACR A;  4RM5 A;  2M5C A;  2Q42 A;  4TYF A;  5ACW A;  1BVT A;  2OHH A;  3KNS A;  5LMC A;  2BFL A;  5K4K A;  4AXH A;  2NXA A;  4Z5Y A;  4EYF A;  5EHT A;  4BZ3 A;  2AIO A;  5FQB A;  2CG3 A;  4AV7 A;  1QH5 A;  3ZQ4 A;  2XF4 A;  5AXR A;  5ACP A;  5LCA A;  1VME A;  2Q0I A;  4UWP B;  2BIB A;  1X8H A;  4UAM A;  2YNU A;  2FU9 A;  3MD7 A;  2P4Z A;  1P9E A;  2Y8B A;  3KNR A;  3T9M A;  2Y87 A;  2NZF A;  5A0T A;  2WRS A;  3DH8 A;  4TYT A;  4LE6 A;  4AWY B;  5HIO A;  1L9Y A;  4C1G A;  5LE1 A;  5IQK A;  2CFZ A;  3I15 A;  2BGA A;  1A7T A;  2BTN A;  4Z6X A;  4C1F A;  2I7X A;  4D1U A;  5B15 A;  2XR1 A;  1BMC A;  5A0V A;  1KO3 A;  3L6N A;  3PY5 A;  5KIL A;  5EH9 A;  2FHX B;  4TZE A;  4FR7 A;  4U4L A;  5AXO A;  5ACU A;  4EXY A;  4YSB A;  5LCH A;  1X8I A;  4TZ9 A;  2ZO4 A;  4V0H A;  2BFZ A;  4C09 A;  1JJE A;  3RKJ A;  1DDK A;  4PVO A;  3IOF A;  1WW1 A;  2P97 A;  5LSC A;  3Q6V A;  4NQ5 A;  4EXS A;  4EY2 A;  2QJS A;  1XTO A;  2BFK A;  3X2Z A;  2P1E A;  2M5D A;  3IE1 A;  3FCZ A;  1Y44 A;  3T3N A;  4CHL A;  3H3E A;  4TZF A;  4GCW A;  3JXP A;  4RL2 A;  2BR6 A;  2YNV A;  4JO0 A;  2ZNB A;  2WYM A;  2BC2 A;  4Z5Z A;  3PY6 A;  5A5Z A;  2GMN A;  2FHX A;  4DIL A;  1BC2 A;  2R2D A;  1DD6 A;  2FU7 A;  4ZNB A;  3I13 A;  4NUR A;  2E7Y A;  3I0V A;  5LS3 A;  4UBQ A;  3AJ3 A;  3X2X A;  2Y8A A;  4KEQ A;  5EWA A;  2BG8 A;  5ACX A;  4YSK A;  3IEL A;  2NYP A;  2VW8 A;  5HH6 A;  5EVB A;  3IDZ A;  3ZWF A;  4D1T A;  4EYL A;  3AF6 A;  2ZWR A;  4FSB A;  3I14 A;  1ZKP A;  2BG8 B;  5LCF A;  3X30 A;  5AHO A;  3WXC A;  1YCG A;  4D1V A;  3X2Y A;  2BG6 A;  4J5F A;  4RAW A;  1VJN A;  5AEB A;  3S0Z A;  1JJT A;  1XM8 A;  1WRA A; 
#chains in the Genus database with same CATH homology
 4TZB A;  2FM6 A;  4UWO B;  2QDT A;  4HKY A;  3QH8 A;  4HL2 A;  2FU6 A;  4Z60 A;  4ZEJ A;  5LLD A;  3IE2 A;  2AZ4 A;  2UYX A;  3P2U A;  2FK6 A;  4KEP A;  1MQO A;  3SFP A;  5AHR A;  4DIK A;  3ADR A;  3DHB A;  1K07 A;  1DXK A;  5EV8 A;  2BFZ B;  3TP9 A;  2WHG A;  2FU8 A;  1M2X A;  3LVZ A;  4NQ2 A;  4GYU A;  2OHI A;  3KL7 A;  3IOG A;  4C1C A;  2GKL A;  2Q0J A;  4EYB A;  3BC2 A;  2BG7 A;  2DKF A;  3DHC A;  3RPC A;  2QIN A;  4HL1 A;  1SML A;  3IE0 A;  2QED A;  4RAM A;  4UWS B;  3SPU A;  3DHA A;  1E5D A;  5FQC A;  4B87 A;  5B1U A;  5HIS A;  5ACQ A;  4NQ4 A;  3BV6 A;  1HLK A;  3BK2 A;  2GCU A;  1WUO A;  5EVD A;  4WD6 A;  4O98 A;  4Z67 A;  3I11 A;  3SRX A;  5A87 A;  2ZZI A;  5HIQ A;  3SBL A;  4PVT A;  1WUP A;  1ZTC A;  3ZR9 A;  3SD9 A;  2YNV B;  4J5H A;  2OHJ A;  3VQZ A;  2YCB A;  2H6A A;  2YNT B;  3SW3 A;  3BK1 A;  4D1W A;  2YNT A;  5EV6 A;  2Q9U A;  3R2U A;  4C1D A;  2CBN A;  1KO2 A;  5FQA A;  2P18 A;  5ACV A;  4GYQ A;  4F6H A;  2DOO A;  3PG4 A;  3F9O A;  3T3O A;  3ZNB A;  4UWR B;  4AX0 B;  2WYL A;  5ACS A;  5K0W A;  2GFJ A;  4XUK A;  4ZO3 A;  1A8T A;  1VGN A;  5AYA A;  2YNW A;  5B3R A;  2WYM C;  1YCH A;  4UA4 A;  4AX1 B;  1QH3 A;  1YCF A;  4ZO2 A;  2BMI A;  3A4Y A;  4RBS A;  3RKK A;  5HH4 A;  1KR3 A;  3FAI A;  2I7T A;  2NZE A;  4XWW A;  4RL0 A;  5HH5 A;  3IEM A;  2A7M A;  1X8G A;  2BG2 A;  3AF5 A;  3IEK A;  4AD9 A;  4XWT A;  5EW0 A;  5DPX A;  5KIK A;  5ACT A;  4NQ6 A;  5EVK A;  3ESH A;  2GFK A;  4AWZ A;  4YSL A;  2HB9 A;  4C1H A;  4Z7R A;  3VPE A;  5K4N A;  4EFZ A;  4H0D A;  4P62 A;  2QDS A;  2YZ3 A;  3G1P A;  4BP0 A;  1JT1 A;  5LM6 A;  4F6Z A;  2I7V A;  4FEK A;  4D02 A;  1ZNB A;  5HIP A;  5K4M A;  4C1E A;  5ACR A;  4RM5 A;  2M5C A;  2Q42 A;  4TYF A;  5ACW A;  1BVT A;  2OHH A;  3KNS A;  5LMC A;  2BFL A;  5K4K A;  2NXA A;  4Z5Y A;  4EYF A;  5EHT A;  4BZ3 A;  2AIO A;  5FQB A;  1QH5 A;  3ZQ4 A;  2XF4 A;  5AXR A;  5ACP A;  5LCA A;  1VME A;  2Q0I A;  4UWP B;  2BIB A;  1X8H A;  4UAM A;  2YNU A;  2FU9 A;  3MD7 A;  2P4Z A;  1P9E A;  2Y8B A;  3KNR A;  3T9M A;  2Y87 A;  2NZF A;  5A0T A;  2WRS A;  3DH8 A;  4TYT A;  4LE6 A;  4AWY B;  5HIO A;  1L9Y A;  4C1G A;  5LE1 A;  5IQK A;  3I15 A;  2BGA A;  1A7T A;  2BTN A;  4Z6X A;  4C1F A;  2I7X A;  4D1U A;  5B15 A;  2XR1 A;  1BMC A;  5A0V A;  1KO3 A;  3L6N A;  3PY5 A;  5KIL A;  5EH9 A;  2FHX B;  4TZE A;  4FR7 A;  4U4L A;  5AXO A;  5ACU A;  4EXY A;  4YSB A;  5LCH A;  1X8I A;  4TZ9 A;  2ZO4 A;  4V0H A;  2BFZ A;  4C09 A;  1JJE A;  3RKJ A;  1DDK A;  4PVO A;  3IOF A;  1WW1 A;  2P97 A;  5LSC A;  3Q6V A;  4NQ5 A;  4EXS A;  4EY2 A;  2QJS A;  1XTO A;  2BFK A;  3X2Z A;  2P1E A;  2M5D A;  3IE1 A;  3FCZ A;  1Y44 A;  3T3N A;  4CHL A;  3H3E A;  4TZF A;  4GCW A;  3JXP A;  4RL2 A;  2BR6 A;  2YNV A;  4JO0 A;  2ZNB A;  2WYM A;  2BC2 A;  4Z5Z A;  3PY6 A;  5A5Z A;  2GMN A;  2FHX A;  4DIL A;  1BC2 A;  2R2D A;  1DD6 A;  2FU7 A;  4ZNB A;  3I13 A;  2E7Y A;  3I0V A;  5LS3 A;  4UBQ A;  3AJ3 A;  3X2X A;  2Y8A A;  4KEQ A;  5EWA A;  2BG8 A;  5ACX A;  4YSK A;  3IEL A;  2NYP A;  2VW8 A;  5HH6 A;  5EVB A;  3IDZ A;  3ZWF A;  4D1T A;  4EYL A;  3AF6 A;  2ZWR A;  4FSB A;  3I14 A;  1ZKP A;  2BG8 B;  5LCF A;  3X30 A;  5AHO A;  3WXC A;  1YCG A;  4D1V A;  3X2Y A;  2BG6 A;  4J5F A;  4RAW A;  1VJN A;  5AEB A;  3S0Z A;  1JJT A;  1XM8 A;  1WRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...