5K0WA

Crystal structure of the metallo-beta-lactamase gob-18 from elizabethkingia meningoseptica
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
SAQVVKEPENMPKEWNQAYEPFRIAGNLYYVGTYDLASYLIVTDKGNILINTGTAESFPIIKANIQKLGFNYKDIKILLLTQAHYDHTGALQDFKTETAAKFYVDKADVDVLRTGGKSDYEMGKYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHPGHTKGSCSFIFETKDEKRKYRVLIANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHASQFDLHEKRKEGDPYNPQLFMDKQSYFQNLNDLEKSYLNKIKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Metallo-beta-Lactamase GOB in the Periplasmic Dizinc Form Reveals an Unusual Metal Site.
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
molecule keywords Class B carbapenemase GOB-18
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5k0wA00
4Z7RA 4DILA 3ZNBA 2Q9UA 5A5ZA 1KR3A 2GFKA 4D02A 3BK1A 2OHJA 2WRSA 5KILA 2FHXB 1JT1A 2H6AA 3IOGA 2BGAA 3VQZA 5B1UA 2BIBA 2BC2A 2ZNBA 3RPCA 4TYFA 3KL7A 4AD9A 4ZO2A 5FQAA 4RBSA 3I13A 2BMIA 1VGNA 5LM6A 2BFLA 1X8IA 4HL2A 1BVTA 4TZBA 2I7XA 1DXKA 5K4NA 2ZO4A 4UWRB 2R2DA 5A0VA 1WW1A 2WYLA 2NZFA 1YCFA 3DHAA 5KIKA 3VPEA 3A4YA 4ZNBA 4V0HA 5EVKA 5EH9A 2FM6A 3SD9A 4WD6A 2CBNA 3KNSA 4XWWA 5HH6A 5K0WA 3S0ZA 1WUPA 2BG2A 4O98A 4RM5A 2I7VA 2YNTA 3IE2A 2FK6A 1DDKA 3Q6VA 1L9YA 5B3RA 4D1TA 3QH8A 5K4KA 4C1CA 2GFJA 4KEQA 2QEDA 1JJEA 2ZZIA 3FAIA 4HKYA 2Q0IA 3BV6A 2OHHA 1BC2A 2BG6A 2P4ZA 2Q0JA 2AIOA 3PY5A 4EYFA 2XF4A 3R2UA 1MQOA 2QJSA 2GCUA 2BTNA 3FCZA 2WHGA 1ZTCA 4EYBA 4AX0B 3BC2A 1VMEA 2Y87A 3I14A 2NZEA 5HH5A 4UA4A 3DHBA 1A8TA 2YNVA 3ZWFA 3JXPA 3X2ZA 3I15A 1YCHA 4C1HA 2M5CA 4Z67A 2FU9A 2GMNA 2AZ4A 1E5DA 5LLDA 2NYPA 2FU6A 5ACQA 4DIKA 4C09A 2YCBA 1BMCA 2UYXA 4JO0A 3SRXA 4RL0A 5LCAA 4AWYB 4NQ4A 1P9EA 3IELA 5EVDA 4B87A 4EXYA 5ACXA 2Y8AA 3PY6A 2DKFA 2FHXA 2OHIA 4ZEJA 2WYMC 2NXAA 3IE1A 2Q42A 2YNVB 3SBLA 4Z6XA 2DOOA 5AHOA 1SMLA 3AF6A 4UBQA 5A87A 4NQ6A 4FSBA 3TP9A 5LCHA 2P18A 4Z5YA 4FEKA 5HIPA 4H0DA 3SFPA 1WUOA 5IQKA 1VJNA 4UWSB 4Z60A 5HISA 5ACRA 3BK2A 4YSBA 4F6HA 2M5DA 3IE0A 4XWTA 4YSKA 5LMCA 5ACPA 4D1VA 4YSLA 3X30A 5AYAA 2I7TA 2A7MA 3AJ3A 4J5FA 3PG4A 3WXCA 3ZQ4A 2HB9A 4TYTA 5LSCA 3MD7A 3ZR9A 5HIOA 2BFZB 5A0TA 3T9MA 1QH3A 4UWOB 5K4MA 4ZO3A 4P62A 4UWPB 4LE6A 4HL1A 5FQBA 3LVZA 4TZEA 4AWZA 3G1PA 3RKKA 3T3NA 1ZNBA 4RL2A 4CHLA 3L6NA 3SPUA 2QINA 4AX1B 4C1EA 3IDZA 3IEKA 1YCGA 1X8GA 2XR1A 1M2XA 1X8HA 2QDTA 4FR7A 5EV8A 4U4LA 2YNUA 5EVBA 3F9OA 5ACVA 4GCWA 4TZFA 5ACTA 5LS3A 1Y44A 2E7YA 1A7TA 5ACSA 5HIQA 4C1FA 5B15A 4J5HA 4F6ZA 4GYQA 5EV6A 4GYUA 5ACWA 4EY2A 2P97A 3ADRA 2BG7A 2BFKA 3DHCA 4Z5ZA 3ESHA 3RKJA 3X2YA 2QDSA 5EW0A 5AEBA 4EYLA 3DH8A 3X2XA 3AF5A 3IEMA 2BG8B 3SW3A 3KNRA 4XUKA 3I0VA 2FU8A 2P1EA 4C1GA 2WYMA 4D1WA 1ZKPA 4PVOA 5LCFA 5EHTA 5DPXA 5AXOA 3I11A 2VW8A 3H3EA 2YZ3A 4UAMA 5AHRA 4D1UA 4C1DA 5AXRA 3P2UA 1JJTA 4NQ2A 2BFZA 4RAWA 4EFZA 5LE1A 2FU7A 4BP0A 1KO3A 1WRAA 1K07A 1HLKA 4BZ3A 1XTOA 2BR6A 1QH5A 2BG8A 2ZWRA 2YNTB 4KEPA 4RAMA 2Y8BA 5FQCA 1KO2A 2YNWA 1XM8A 5HH4A 5EWAA 4PVTA 3T3OA 4NQ5A 1DD6A 3IOFA 2GKLA 4TZ9A 5ACUA 4EXSA
chains in the Genus database with same CATH superfamily
4Z7RA 4DILA 3ZNBA 2Q9UA 5A5ZA 1KR3A 2GFKA 4D02A 3BK1A 2OHJA 2WRSA 5AJLA 5KILA 2FHXB 2CG2A 1JT1A 2H6AA 3IOGA 2BGAA 3VQZA 5B1UA 2BIBA 2BC2A 2ZNBA 3RPCA 4TYFA 3KL7A 4AD9A 4ZO2A 5FQAA 4RBSA 3I13A 2BMIA 1VGNA 5LM6A 2BFLA 1X8IA 4HL2A 1BVTA 4TZBA 2I7XA 1DXKA 5K4NA 2ZO4A 4UWRB 2R2DA 5A0VA 1WW1A 2WYLA 2NZFA 1YCFA 3DHAA 5KIKA 3VPEA 3A4YA 4ZNBA 4V0HA 5EVKA 5EH9A 2FM6A 3SD9A 4WD6A 2CBNA 3KNSA 4XWWA 5HH6A 5K0WA 3S0ZA 1WUPA 2BG2A 4O98A 4RM5A 2I7VA 2YNTA 3IE2A 2FK6A 1DDKA 3Q6VA 1L9YA 5B3RA 4D1TA 3QH8A 5K4KA 4C1CA 2GFJA 4KEQA 2QEDA 1JJEA 2ZZIA 3FAIA 4HKYA 2Q0IA 3BV6A 2OHHA 1BC2A 2BG6A 2P4ZA 2Q0JA 2AIOA 3PY5A 4EYFA 4NURA 2XF4A 3R2UA 1MQOA 2QJSA 2GCUA 4AXHA 2BTNA 3FCZA 2WHGA 1ZTCA 4EYBA 4AX0B 3BC2A 1VMEA 2Y87A 3I14A 2NZEA 5HH5A 4UA4A 3DHBA 1A8TA 2YNVA 3ZWFA 5AIJA 3JXPA 3X2ZA 3I15A 1YCHA 4C1HA 2M5CA 4Z67A 2FU9A 2GMNA 2AZ4A 1E5DA 5LLDA 2NYPA 2FU6A 5ACQA 4DIKA 4C09A 2YCBA 1BMCA 2UYXA 2CFZA 4JO0A 3SRXA 4RL0A 5LCAA 4AWYB 4NQ4A 1P9EA 3IELA 5EVDA 4B87A 4EXYA 5ACXA 2Y8AA 3PY6A 2DKFA 2FHXA 2OHIA 4ZEJA 2WYMC 2NXAA 3IE1A 2Q42A 2YNVB 3SBLA 4Z6XA 2DOOA 5AHOA 1SMLA 3AF6A 4UBQA 5A87A 4NQ6A 4FSBA 3TP9A 5LCHA 2P18A 4Z5YA 4FEKA 5HIPA 2CG3A 4H0DA 3SFPA 1WUOA 5IQKA 1VJNA 4UWSB 4Z60A 5HISA 5ACRA 3BK2A 4AV7A 4YSBA 4F6HA 2M5DA 3IE0A 4XWTA 4YSKA 5LMCA 5ACPA 4D1VA 4YSLA 3X30A 5AYAA 2I7TA 2A7MA 3AJ3A 4J5FA 3PG4A 3WXCA 3ZQ4A 2HB9A 4TYTA 5LSCA 3MD7A 3ZR9A 5HIOA 2YHEA 2BFZB 5A0TA 3T9MA 1QH3A 4UWOB 2CFUA 5K4MA 4ZO3A 4P62A 4UWPB 4LE6A 4HL1A 5FQBA 3LVZA 4TZEA 4AWZA 3G1PA 3RKKA 3T3NA 1ZNBA 4RL2A 4CHLA 3L6NA 3SPUA 2QINA 4AX1B 4C1EA 5A23A 3IDZA 4PDXA 3IEKA 1YCGA 1X8GA 2XR1A 1M2XA 1X8HA 2QDTA 4FR7A 5EV8A 4U4LA 2YNUA 5EVBA 3F9OA 5ACVA 4GCWA 4TZFA 5ACTA 5LS3A 1Y44A 2E7YA 1A7TA 5ACSA 5HIQA 4C1FA 5B15A 4J5HA 4F6ZA 4GYQA 5EV6A 4GYUA 5ACWA 4EY2A 2P97A 3ADRA 2BG7A 2BFKA 3DHCA 4Z5ZA 3ESHA 3RKJA 3X2YA 2QDSA 5EW0A 5AEBA 4EYLA 3DH8A 3X2XA 3AF5A 3IEMA 2BG8B 3SW3A 3KNRA 4XUKA 3I0VA 2FU8A 2P1EA 4C1GA 2WYMA 4D1WA 1ZKPA 4PVOA 5LCFA 5EHTA 5DPXA 5AXOA 3I11A 2VW8A 3H3EA 2YZ3A 4UAMA 5AHRA 4D1UA 4C1DA 5AXRA 3P2UA 1JJTA 4NQ2A 2BFZA 4RAWA 4EFZA 5LE1A 2FU7A 4BP0A 1KO3A 1WRAA 1K07A 1HLKA 4BZ3A 1XTOA 2BR6A 1QH5A 2BG8A 2ZWRA 2YNTB 4KEPA 4RAMA 2Y8BA 5FQCA 1KO2A 2YNWA 1XM8A 5HH4A 5EWAA 4PVTA 3T3OA 4NQ5A 1DD6A 3IOFA 2GKLA 4TZ9A 5ACUA 4EXSA
chains in the Genus database with same CATH topology
4Z7RA 4DILA 3ZNBA 2Q9UA 5A5ZA 1KR3A 2GFKA 4D02A 3BK1A 2OHJA 2WRSA 5KILA 2FHXB 1JT1A 2H6AA 3IOGA 2BGAA 3VQZA 5B1UA 2BIBA 2BC2A 2ZNBA 3RPCA 4TYFA 3KL7A 4AD9A 4ZO2A 5FQAA 4RBSA 3I13A 2BMIA 1VGNA 5LM6A 2BFLA 1X8IA 4HL2A 1BVTA 4TZBA 2I7XA 1DXKA 5K4NA 2ZO4A 4UWRB 2R2DA 5A0VA 1WW1A 2WYLA 2NZFA 1YCFA 3DHAA 5KIKA 3VPEA 3A4YA 4ZNBA 4V0HA 5EVKA 5EH9A 2FM6A 3SD9A 4WD6A 2CBNA 3KNSA 4XWWA 5HH6A 5K0WA 3S0ZA 1WUPA 2BG2A 4O98A 4RM5A 2I7VA 2YNTA 3IE2A 2FK6A 1DDKA 3Q6VA 1L9YA 5B3RA 4D1TA 3QH8A 5K4KA 4C1CA 2GFJA 4KEQA 2QEDA 1JJEA 2ZZIA 3FAIA 4HKYA 2Q0IA 3BV6A 2OHHA 1BC2A 2BG6A 2P4ZA 2Q0JA 2AIOA 3PY5A 4EYFA 2XF4A 3R2UA 1MQOA 2QJSA 2GCUA 2BTNA 3FCZA 2WHGA 1ZTCA 4EYBA 4AX0B 3BC2A 1VMEA 2Y87A 3I14A 2NZEA 5HH5A 4UA4A 3DHBA 1A8TA 2YNVA 3ZWFA 3JXPA 3X2ZA 3I15A 1YCHA 4C1HA 2M5CA 4Z67A 2FU9A 2GMNA 2AZ4A 1E5DA 5LLDA 2NYPA 2FU6A 5ACQA 4DIKA 4C09A 2YCBA 1BMCA 2UYXA 4JO0A 3SRXA 4RL0A 5LCAA 4AWYB 4NQ4A 1P9EA 3IELA 5EVDA 4B87A 4EXYA 5ACXA 2Y8AA 3PY6A 2DKFA 2FHXA 2OHIA 4ZEJA 2WYMC 2NXAA 3IE1A 2Q42A 2YNVB 3SBLA 4Z6XA 2DOOA 5AHOA 1SMLA 3AF6A 4UBQA 5A87A 4NQ6A 4FSBA 3TP9A 5LCHA 2P18A 4Z5YA 4FEKA 5HIPA 4H0DA 3SFPA 1WUOA 5IQKA 1VJNA 4UWSB 4Z60A 5HISA 5ACRA 3BK2A 4YSBA 4F6HA 2M5DA 3IE0A 4XWTA 4YSKA 5LMCA 5ACPA 4D1VA 4YSLA 3X30A 5AYAA 2I7TA 2A7MA 3AJ3A 4J5FA 3PG4A 3WXCA 3ZQ4A 2HB9A 4TYTA 5LSCA 3MD7A 3ZR9A 5HIOA 2BFZB 5A0TA 3T9MA 1QH3A 4UWOB 5K4MA 4ZO3A 4P62A 4UWPB 4LE6A 4HL1A 5FQBA 3LVZA 4TZEA 4AWZA 3G1PA 3RKKA 3T3NA 1ZNBA 4RL2A 4CHLA 3L6NA 3SPUA 2QINA 4AX1B 4C1EA 3IDZA 3IEKA 1YCGA 1X8GA 2XR1A 1M2XA 1X8HA 2QDTA 4FR7A 5EV8A 4U4LA 2YNUA 5EVBA 3F9OA 5ACVA 4GCWA 4TZFA 5ACTA 5LS3A 1Y44A 2E7YA 1A7TA 5ACSA 5HIQA 4C1FA 5B15A 4J5HA 4F6ZA 4GYQA 5EV6A 4GYUA 5ACWA 4EY2A 2P97A 3ADRA 2BG7A 2BFKA 3DHCA 4Z5ZA 3ESHA 3RKJA 3X2YA 2QDSA 5EW0A 5AEBA 4EYLA 3DH8A 3X2XA 3AF5A 3IEMA 2BG8B 3SW3A 3KNRA 4XUKA 3I0VA 2FU8A 2P1EA 4C1GA 2WYMA 4D1WA 1ZKPA 4PVOA 5LCFA 5EHTA 5DPXA 5AXOA 3I11A 2VW8A 3H3EA 2YZ3A 4UAMA 5AHRA 4D1UA 4C1DA 5AXRA 3P2UA 1JJTA 4NQ2A 2BFZA 4RAWA 4EFZA 5LE1A 2FU7A 4BP0A 1KO3A 1WRAA 1K07A 1HLKA 4BZ3A 1XTOA 2BR6A 1QH5A 2BG8A 2ZWRA 2YNTB 4KEPA 4RAMA 2Y8BA 5FQCA 1KO2A 2YNWA 1XM8A 5HH4A 5EWAA 4PVTA 3T3OA 4NQ5A 1DD6A 3IOFA 2GKLA 4TZ9A 5ACUA 4EXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7R A;  4DIL A;  3ZNB A;  2Q9U A;  5A5Z A;  1KR3 A;  2GFK A;  4D02 A;  3BK1 A;  2OHJ A;  2WRS A;  5KIL A;  2FHX B;  1JT1 A;  2H6A A;  3IOG A;  2BGA A;  3VQZ A;  5B1U A;  2BIB A;  2BC2 A;  2ZNB A;  3RPC A;  4TYF A;  3KL7 A;  4AD9 A;  4ZO2 A;  5FQA A;  4RBS A;  3I13 A;  2BMI A;  1VGN A;  5LM6 A;  2BFL A;  1X8I A;  4HL2 A;  1BVT A;  4TZB A;  2I7X A;  1DXK A;  5K4N A;  2ZO4 A;  4UWR B;  2R2D A;  5A0V A;  1WW1 A;  2WYL A;  2NZF A;  1YCF A;  3DHA A;  5KIK A;  3VPE A;  3A4Y A;  4ZNB A;  4V0H A;  5EVK A;  5EH9 A;  2FM6 A;  3SD9 A;  4WD6 A;  2CBN A;  3KNS A;  4XWW A;  5HH6 A;  5K0W A;  3S0Z A;  1WUP A;  2BG2 A;  4O98 A;  4RM5 A;  2I7V A;  2YNT A;  3IE2 A;  2FK6 A;  1DDK A;  3Q6V A;  1L9Y A;  5B3R A;  4D1T A;  3QH8 A;  5K4K A;  4C1C A;  2GFJ A;  4KEQ A;  2QED A;  1JJE A;  2ZZI A;  3FAI A;  4HKY A;  2Q0I A;  3BV6 A;  2OHH A;  1BC2 A;  2BG6 A;  2P4Z A;  2Q0J A;  2AIO A;  3PY5 A;  4EYF A;  2XF4 A;  3R2U A;  1MQO A;  2QJS A;  2GCU A;  2BTN A;  3FCZ A;  2WHG A;  1ZTC A;  4EYB A;  4AX0 B;  3BC2 A;  1VME A;  2Y87 A;  3I14 A;  2NZE A;  5HH5 A;  4UA4 A;  3DHB A;  1A8T A;  2YNV A;  3ZWF A;  3JXP A;  3X2Z A;  3I15 A;  1YCH A;  4C1H A;  2M5C A;  4Z67 A;  2FU9 A;  2GMN A;  2AZ4 A;  1E5D A;  5LLD A;  2NYP A;  2FU6 A;  5ACQ A;  4DIK A;  4C09 A;  2YCB A;  1BMC A;  2UYX A;  4JO0 A;  3SRX A;  4RL0 A;  5LCA A;  4AWY B;  4NQ4 A;  1P9E A;  3IEL A;  5EVD A;  4B87 A;  4EXY A;  5ACX A;  2Y8A A;  3PY6 A;  2DKF A;  2FHX A;  2OHI A;  4ZEJ A;  2WYM C;  2NXA A;  3IE1 A;  2Q42 A;  2YNV B;  3SBL A;  4Z6X A;  2DOO A;  5AHO A;  1SML A;  3AF6 A;  4UBQ A;  5A87 A;  4NQ6 A;  4FSB A;  3TP9 A;  5LCH A;  2P18 A;  4Z5Y A;  4FEK A;  5HIP A;  4H0D A;  3SFP A;  1WUO A;  5IQK A;  1VJN A;  4UWS B;  4Z60 A;  5HIS A;  5ACR A;  3BK2 A;  4YSB A;  4F6H A;  2M5D A;  3IE0 A;  4XWT A;  4YSK A;  5LMC A;  5ACP A;  4D1V A;  4YSL A;  3X30 A;  5AYA A;  2I7T A;  2A7M A;  3AJ3 A;  4J5F A;  3PG4 A;  3WXC A;  3ZQ4 A;  2HB9 A;  4TYT A;  5LSC A;  3MD7 A;  3ZR9 A;  5HIO A;  2BFZ B;  5A0T A;  3T9M A;  1QH3 A;  4UWO B;  5K4M A;  4ZO3 A;  4P62 A;  4UWP B;  4LE6 A;  4HL1 A;  5FQB A;  3LVZ A;  4TZE A;  4AWZ A;  3G1P A;  3RKK A;  3T3N A;  1ZNB A;  4RL2 A;  4CHL A;  3L6N A;  3SPU A;  2QIN A;  4AX1 B;  4C1E A;  3IDZ A;  3IEK A;  1YCG A;  1X8G A;  2XR1 A;  1M2X A;  1X8H A;  2QDT A;  4FR7 A;  5EV8 A;  4U4L A;  2YNU A;  5EVB A;  3F9O A;  5ACV A;  4GCW A;  4TZF A;  5ACT A;  5LS3 A;  1Y44 A;  2E7Y A;  1A7T A;  5ACS A;  5HIQ A;  4C1F A;  5B15 A;  4J5H A;  4F6Z A;  4GYQ A;  5EV6 A;  4GYU A;  5ACW A;  4EY2 A;  2P97 A;  3ADR A;  2BG7 A;  2BFK A;  3DHC A;  4Z5Z A;  3ESH A;  3RKJ A;  3X2Y A;  2QDS A;  5EW0 A;  5AEB A;  4EYL A;  3DH8 A;  3X2X A;  3AF5 A;  3IEM A;  2BG8 B;  3SW3 A;  3KNR A;  4XUK A;  3I0V A;  2FU8 A;  2P1E A;  4C1G A;  2WYM A;  4D1W A;  1ZKP A;  4PVO A;  5LCF A;  5EHT A;  5DPX A;  5AXO A;  3I11 A;  2VW8 A;  3H3E A;  2YZ3 A;  4UAM A;  5AHR A;  4D1U A;  4C1D A;  5AXR A;  3P2U A;  1JJT A;  4NQ2 A;  2BFZ A;  4RAW A;  4EFZ A;  5LE1 A;  2FU7 A;  4BP0 A;  1KO3 A;  1WRA A;  1K07 A;  1HLK A;  4BZ3 A;  1XTO A;  2BR6 A;  1QH5 A;  2BG8 A;  2ZWR A;  2YNT B;  4KEP A;  4RAM A;  2Y8B A;  5FQC A;  1KO2 A;  2YNW A;  1XM8 A;  5HH4 A;  5EWA A;  4PVT A;  3T3O A;  4NQ5 A;  1DD6 A;  3IOF A;  2GKL A;  4TZ9 A;  5ACU A;  4EXS A; 
#chains in the Genus database with same CATH topology
 4Z7R A;  4DIL A;  3ZNB A;  2Q9U A;  5A5Z A;  1KR3 A;  2GFK A;  4D02 A;  3BK1 A;  2OHJ A;  2WRS A;  5AJL A;  5KIL A;  2FHX B;  2CG2 A;  1JT1 A;  2H6A A;  3IOG A;  2BGA A;  3VQZ A;  5B1U A;  2BIB A;  2BC2 A;  2ZNB A;  3RPC A;  4TYF A;  3KL7 A;  4AD9 A;  4ZO2 A;  5FQA A;  4RBS A;  3I13 A;  2BMI A;  1VGN A;  5LM6 A;  2BFL A;  1X8I A;  4HL2 A;  1BVT A;  4TZB A;  2I7X A;  1DXK A;  5K4N A;  2ZO4 A;  4UWR B;  2R2D A;  5A0V A;  1WW1 A;  2WYL A;  2NZF A;  1YCF A;  3DHA A;  5KIK A;  3VPE A;  3A4Y A;  4ZNB A;  4V0H A;  5EVK A;  5EH9 A;  2FM6 A;  3SD9 A;  4WD6 A;  2CBN A;  3KNS A;  4XWW A;  5HH6 A;  5K0W A;  3S0Z A;  1WUP A;  2BG2 A;  4O98 A;  4RM5 A;  2I7V A;  2YNT A;  3IE2 A;  2FK6 A;  1DDK A;  3Q6V A;  1L9Y A;  5B3R A;  4D1T A;  3QH8 A;  5K4K A;  4C1C A;  2GFJ A;  4KEQ A;  2QED A;  1JJE A;  2ZZI A;  3FAI A;  4HKY A;  2Q0I A;  3BV6 A;  2OHH A;  1BC2 A;  2BG6 A;  2P4Z A;  2Q0J A;  2AIO A;  3PY5 A;  4EYF A;  4NUR A;  2XF4 A;  3R2U A;  1MQO A;  2QJS A;  2GCU A;  4AXH A;  2BTN A;  3FCZ A;  2WHG A;  1ZTC A;  4EYB A;  4AX0 B;  3BC2 A;  1VME A;  2Y87 A;  3I14 A;  2NZE A;  5HH5 A;  4UA4 A;  3DHB A;  1A8T A;  2YNV A;  3ZWF A;  5AIJ A;  3JXP A;  3X2Z A;  3I15 A;  1YCH A;  4C1H A;  2M5C A;  4Z67 A;  2FU9 A;  2GMN A;  2AZ4 A;  1E5D A;  5LLD A;  2NYP A;  2FU6 A;  5ACQ A;  4DIK A;  4C09 A;  2YCB A;  1BMC A;  2UYX A;  2CFZ A;  4JO0 A;  3SRX A;  4RL0 A;  5LCA A;  4AWY B;  4NQ4 A;  1P9E A;  3IEL A;  5EVD A;  4B87 A;  4EXY A;  5ACX A;  2Y8A A;  3PY6 A;  2DKF A;  2FHX A;  2OHI A;  4ZEJ A;  2WYM C;  2NXA A;  3IE1 A;  2Q42 A;  2YNV B;  3SBL A;  4Z6X A;  2DOO A;  5AHO A;  1SML A;  3AF6 A;  4UBQ A;  5A87 A;  4NQ6 A;  4FSB A;  3TP9 A;  5LCH A;  2P18 A;  4Z5Y A;  4FEK A;  5HIP A;  2CG3 A;  4H0D A;  3SFP A;  1WUO A;  5IQK A;  1VJN A;  4UWS B;  4Z60 A;  5HIS A;  5ACR A;  3BK2 A;  4AV7 A;  4YSB A;  4F6H A;  2M5D A;  3IE0 A;  4XWT A;  4YSK A;  5LMC A;  5ACP A;  4D1V A;  4YSL A;  3X30 A;  5AYA A;  2I7T A;  2A7M A;  3AJ3 A;  4J5F A;  3PG4 A;  3WXC A;  3ZQ4 A;  2HB9 A;  4TYT A;  5LSC A;  3MD7 A;  3ZR9 A;  5HIO A;  2YHE A;  2BFZ B;  5A0T A;  3T9M A;  1QH3 A;  4UWO B;  2CFU A;  5K4M A;  4ZO3 A;  4P62 A;  4UWP B;  4LE6 A;  4HL1 A;  5FQB A;  3LVZ A;  4TZE A;  4AWZ A;  3G1P A;  3RKK A;  3T3N A;  1ZNB A;  4RL2 A;  4CHL A;  3L6N A;  3SPU A;  2QIN A;  4AX1 B;  4C1E A;  5A23 A;  3IDZ A;  4PDX A;  3IEK A;  1YCG A;  1X8G A;  2XR1 A;  1M2X A;  1X8H A;  2QDT A;  4FR7 A;  5EV8 A;  4U4L A;  2YNU A;  5EVB A;  3F9O A;  5ACV A;  4GCW A;  4TZF A;  5ACT A;  5LS3 A;  1Y44 A;  2E7Y A;  1A7T A;  5ACS A;  5HIQ A;  4C1F A;  5B15 A;  4J5H A;  4F6Z A;  4GYQ A;  5EV6 A;  4GYU A;  5ACW A;  4EY2 A;  2P97 A;  3ADR A;  2BG7 A;  2BFK A;  3DHC A;  4Z5Z A;  3ESH A;  3RKJ A;  3X2Y A;  2QDS A;  5EW0 A;  5AEB A;  4EYL A;  3DH8 A;  3X2X A;  3AF5 A;  3IEM A;  2BG8 B;  3SW3 A;  3KNR A;  4XUK A;  3I0V A;  2FU8 A;  2P1E A;  4C1G A;  2WYM A;  4D1W A;  1ZKP A;  4PVO A;  5LCF A;  5EHT A;  5DPX A;  5AXO A;  3I11 A;  2VW8 A;  3H3E A;  2YZ3 A;  4UAM A;  5AHR A;  4D1U A;  4C1D A;  5AXR A;  3P2U A;  1JJT A;  4NQ2 A;  2BFZ A;  4RAW A;  4EFZ A;  5LE1 A;  2FU7 A;  4BP0 A;  1KO3 A;  1WRA A;  1K07 A;  1HLK A;  4BZ3 A;  1XTO A;  2BR6 A;  1QH5 A;  2BG8 A;  2ZWR A;  2YNT B;  4KEP A;  4RAM A;  2Y8B A;  5FQC A;  1KO2 A;  2YNW A;  1XM8 A;  5HH4 A;  5EWA A;  4PVT A;  3T3O A;  4NQ5 A;  1DD6 A;  3IOF A;  2GKL A;  4TZ9 A;  5ACU A;  4EXS A; 
#chains in the Genus database with same CATH homology
 4Z7R A;  4DIL A;  3ZNB A;  2Q9U A;  5A5Z A;  1KR3 A;  2GFK A;  4D02 A;  3BK1 A;  2OHJ A;  2WRS A;  5KIL A;  2FHX B;  1JT1 A;  2H6A A;  3IOG A;  2BGA A;  3VQZ A;  5B1U A;  2BIB A;  2BC2 A;  2ZNB A;  3RPC A;  4TYF A;  3KL7 A;  4AD9 A;  4ZO2 A;  5FQA A;  4RBS A;  3I13 A;  2BMI A;  1VGN A;  5LM6 A;  2BFL A;  1X8I A;  4HL2 A;  1BVT A;  4TZB A;  2I7X A;  1DXK A;  5K4N A;  2ZO4 A;  4UWR B;  2R2D A;  5A0V A;  1WW1 A;  2WYL A;  2NZF A;  1YCF A;  3DHA A;  5KIK A;  3VPE A;  3A4Y A;  4ZNB A;  4V0H A;  5EVK A;  5EH9 A;  2FM6 A;  3SD9 A;  4WD6 A;  2CBN A;  3KNS A;  4XWW A;  5HH6 A;  5K0W A;  3S0Z A;  1WUP A;  2BG2 A;  4O98 A;  4RM5 A;  2I7V A;  2YNT A;  3IE2 A;  2FK6 A;  1DDK A;  3Q6V A;  1L9Y A;  5B3R A;  4D1T A;  3QH8 A;  5K4K A;  4C1C A;  2GFJ A;  4KEQ A;  2QED A;  1JJE A;  2ZZI A;  3FAI A;  4HKY A;  2Q0I A;  3BV6 A;  2OHH A;  1BC2 A;  2BG6 A;  2P4Z A;  2Q0J A;  2AIO A;  3PY5 A;  4EYF A;  2XF4 A;  3R2U A;  1MQO A;  2QJS A;  2GCU A;  2BTN A;  3FCZ A;  2WHG A;  1ZTC A;  4EYB A;  4AX0 B;  3BC2 A;  1VME A;  2Y87 A;  3I14 A;  2NZE A;  5HH5 A;  4UA4 A;  3DHB A;  1A8T A;  2YNV A;  3ZWF A;  3JXP A;  3X2Z A;  3I15 A;  1YCH A;  4C1H A;  2M5C A;  4Z67 A;  2FU9 A;  2GMN A;  2AZ4 A;  1E5D A;  5LLD A;  2NYP A;  2FU6 A;  5ACQ A;  4DIK A;  4C09 A;  2YCB A;  1BMC A;  2UYX A;  4JO0 A;  3SRX A;  4RL0 A;  5LCA A;  4AWY B;  4NQ4 A;  1P9E A;  3IEL A;  5EVD A;  4B87 A;  4EXY A;  5ACX A;  2Y8A A;  3PY6 A;  2DKF A;  2FHX A;  2OHI A;  4ZEJ A;  2WYM C;  2NXA A;  3IE1 A;  2Q42 A;  2YNV B;  3SBL A;  4Z6X A;  2DOO A;  5AHO A;  1SML A;  3AF6 A;  4UBQ A;  5A87 A;  4NQ6 A;  4FSB A;  3TP9 A;  5LCH A;  2P18 A;  4Z5Y A;  4FEK A;  5HIP A;  4H0D A;  3SFP A;  1WUO A;  5IQK A;  1VJN A;  4UWS B;  4Z60 A;  5HIS A;  5ACR A;  3BK2 A;  4YSB A;  4F6H A;  2M5D A;  3IE0 A;  4XWT A;  4YSK A;  5LMC A;  5ACP A;  4D1V A;  4YSL A;  3X30 A;  5AYA A;  2I7T A;  2A7M A;  3AJ3 A;  4J5F A;  3PG4 A;  3WXC A;  3ZQ4 A;  2HB9 A;  4TYT A;  5LSC A;  3MD7 A;  3ZR9 A;  5HIO A;  2BFZ B;  5A0T A;  3T9M A;  1QH3 A;  4UWO B;  5K4M A;  4ZO3 A;  4P62 A;  4UWP B;  4LE6 A;  4HL1 A;  5FQB A;  3LVZ A;  4TZE A;  4AWZ A;  3G1P A;  3RKK A;  3T3N A;  1ZNB A;  4RL2 A;  4CHL A;  3L6N A;  3SPU A;  2QIN A;  4AX1 B;  4C1E A;  3IDZ A;  3IEK A;  1YCG A;  1X8G A;  2XR1 A;  1M2X A;  1X8H A;  2QDT A;  4FR7 A;  5EV8 A;  4U4L A;  2YNU A;  5EVB A;  3F9O A;  5ACV A;  4GCW A;  4TZF A;  5ACT A;  5LS3 A;  1Y44 A;  2E7Y A;  1A7T A;  5ACS A;  5HIQ A;  4C1F A;  5B15 A;  4J5H A;  4F6Z A;  4GYQ A;  5EV6 A;  4GYU A;  5ACW A;  4EY2 A;  2P97 A;  3ADR A;  2BG7 A;  2BFK A;  3DHC A;  4Z5Z A;  3ESH A;  3RKJ A;  3X2Y A;  2QDS A;  5EW0 A;  5AEB A;  4EYL A;  3DH8 A;  3X2X A;  3AF5 A;  3IEM A;  2BG8 B;  3SW3 A;  3KNR A;  4XUK A;  3I0V A;  2FU8 A;  2P1E A;  4C1G A;  2WYM A;  4D1W A;  1ZKP A;  4PVO A;  5LCF A;  5EHT A;  5DPX A;  5AXO A;  3I11 A;  2VW8 A;  3H3E A;  2YZ3 A;  4UAM A;  5AHR A;  4D1U A;  4C1D A;  5AXR A;  3P2U A;  1JJT A;  4NQ2 A;  2BFZ A;  4RAW A;  4EFZ A;  5LE1 A;  2FU7 A;  4BP0 A;  1KO3 A;  1WRA A;  1K07 A;  1HLK A;  4BZ3 A;  1XTO A;  2BR6 A;  1QH5 A;  2BG8 A;  2ZWR A;  2YNT B;  4KEP A;  4RAM A;  2Y8B A;  5FQC A;  1KO2 A;  2YNW A;  1XM8 A;  5HH4 A;  5EWA A;  4PVT A;  3T3O A;  4NQ5 A;  1DD6 A;  3IOF A;  2GKL A;  4TZ9 A;  5ACU A;  4EXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...