5K0WA

Crystal structure of the metallo-beta-lactamase gob-18 from elizabethkingia meningoseptica
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
b'SAQVVKEPENMPKEWNQAYEPFRIAGNLYYVGTYDLASYLIVTDKGNILINTGTAESFPIIKANIQKLGFNYKDIKILLLTQAHYDHTGALQDFKTETAAKFYVDKADVDVLRTGGKSDYEMGKYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHPGHTKGSCSFIFETKDEKRKYRVLIANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHASQFDLHEKRKEGDPYNPQLFMDKQSYFQNLNDLEKSYLNKIKKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Class B carbapenemase GOB-18
molecule tags Hydrolase
source organism Elizabethkingia meningoseptica
publication title Crystal Structure of the Metallo-beta-Lactamase GOB in the Periplasmic Dizinc Form Reveals an Unusual Metal Site.
pubmed doi rcsb
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5k0wA00
3P2UA 4YSBA 1WRAA 4KEQA 5B15A 3IOGA 4TZBA 2YNTA 3AF5A 5AHRA 4AX1B 4D1UA 2DOOA 4UBQA 2BG2A 4AWZA 5HH6A 2QEDA 2Y8BA 3FAIA 3ADRA 4BP0A 3SFPA 4RL2A 4NQ5A 2WHGA 4YSLA 2BGAA 3KNSA 1MQOA 4Z7RA 4ZNBA 4D1TA 1DD6A 1A8TA 4P62A 2NZFA 3PY5A 4CHLA 4UA4A 1X8HA 5LM6A 1ZKPA 5ACQA 3AF6A 2FU8A 4F6HA 5AXOA 4NQ6A 2BG6A 5AXRA 3IDZA 3KNRA 1WW1A 3DHBA 1VGNA 3IEKA 4TZ9A 3DHAA 2QINA 3DHCA 4PVOA 2AZ4A 1K07A 4TZEA 4EYBA 4GYQA 2YNVB 2FHXB 2BFKA 3S0ZA 5EVBA 4O98A 2XF4A 5B1UA 4EY2A 3SRXA 4AD9A 3ZR9A 2Q0JA 4UWRB 3X2YA 4C09A 5ACXA 2M5DA 4XWWA 2OHJA 4D1WA 1VJNA 1P9EA 3R2UA 3T9MA 3X30A 1WUOA 5HIPA 4GCWA 3I11A 4UWPB 2GKLA 4NQ2A 2GFJA 4Z5ZA 4UWSB 4ZEJA 4FR7A 2VW8A 2Q9UA 3ZQ4A 5B3RA 2R2DA 5LE1A 4EXSA 1E5DA 2XR1A 3RKKA 2Q42A 3Q6VA 4XWTA 4HKYA 3SPUA 5HH4A 4DILA 3IELA 4C1HA 2Y8AA 1BVTA 1DDKA 5LS3A 4D1VA 2BG7A 5LCHA 5EWAA 3DH8A 5FQAA 4UWOB 5IQKA 2NXAA 4AX0B 2P1EA 4WD6A 4Z6XA 5ACTA 5A5ZA 3LVZA 2YNUA 3TP9A 5K4NA 5AEBA 3PG4A 5LMCA 1YCGA 3L6NA 2BC2A 3SD9A 5EV6A 1M2XA 3H3EA 4J5FA 5LCAA 3KL7A 3I14A 2BFZA 4RAWA 1HLKA 2GFKA 2QDSA 2DKFA 4KEPA 2YZ3A 5EW0A 2NZEA 3VQZA 1A7TA 5A0VA 4PVTA 2WYMC 4V0HA 4RAMA 4RBSA 5AYAA 4RL0A 1ZNBA 4EFZA 2E7YA 2P18A 3FCZA 5ACVA 3T3OA 3BC2A 2I7TA 2YCBA 2BG8B 3IOFA 4GYUA 2WYMA 2WYLA 3A4YA 3WXCA 4B87A 5HH5A 3IE2A 5ACUA 3PY6A 3IE0A 4RM5A 2Q0IA 1JJEA 3BK1A 5HIOA 1Y44A 4Z60A 2ZO4A 4U4LA 5ACSA 4NQ4A 2I7VA 5AHOA 5K4MA 4ZO3A 4Z5YA 5K4KA 4HL1A 2WRSA 4LE6A 3BV6A 4C1FA 1JJTA 2QDTA 1YCHA 2A7MA 2BMIA 2P97A 1SMLA 2QJSA 3MD7A 3AJ3A 1KO3A 2BG8A 4F6ZA 5LCFA 5LLDA 4EYFA 3ZWFA 4D02A 1XTOA 2CBNA 3ZNBA 2GCUA 4TZFA 1JT1A 2FHXA 2ZNBA 2I7XA 3G1PA 1YCFA 1X8GA 4TYFA 5HIQA 5FQCA 2BFZB 1KO2A 4J5HA 5A0TA 3X2XA 2BFLA 2UYXA 4YSKA 5EV8A 2ZZIA 2GMNA 4C1DA 4Z67A 5ACRA 3IEMA 5A87A 5KIKA 3X2ZA 2NYPA 3SW3A 3I0VA 2P4ZA 5EH9A 2FU7A 1BC2A 2M5CA 1WUPA 5ACWA 4H0DA 2FM6A 2YNVA 4ZO2A 3I13A 1VMEA 1DXKA 4C1EA 1BMCA 1ZTCA 2FU9A 2OHHA 2ZWRA 4EXYA 4C1GA 5DPXA 5FQBA 5EHTA 5HISA 5ACPA 5KILA 1L9YA 2YNTB 3SBLA 2OHIA 4EYLA 1KR3A 3VPEA 2FU6A 5K0WA 3ESHA 3IE1A 2Y87A 2FK6A 1QH5A 4DIKA 4BZ3A 2YNWA 4TYTA 3I15A 2HB9A 5EVDA 1XM8A 4XUKA 4UAMA 1QH3A 4AWYB 3F9OA 4C1CA 3JXPA 5EVKA 3T3NA 2BIBA 3BK2A 3QH8A 2BTNA 4HL2A 2H6AA 3RKJA 4FSBA 2BR6A 4JO0A 4FEKA 3RPCA 5LSCA 1X8IA 2AIOA
chains in the Genus database with same CATH superfamily
3P2UA 4YSBA 1WRAA 4KEQA 5B15A 3IOGA 4TZBA 2YNTA 3AF5A 5AHRA 4AX1B 4D1UA 2DOOA 4UBQA 2BG2A 4AWZA 5HH6A 2QEDA 2Y8BA 3FAIA 3ADRA 4BP0A 3SFPA 4RL2A 4NQ5A 2WHGA 4YSLA 2BGAA 3KNSA 1MQOA 4Z7RA 4ZNBA 2CG3A 4D1TA 1DD6A 1A8TA 4P62A 2NZFA 3PY5A 4CHLA 4UA4A 1X8HA 5LM6A 1ZKPA 5ACQA 3AF6A 2FU8A 4F6HA 5AXOA 4NQ6A 2BG6A 5AXRA 3IDZA 3KNRA 1WW1A 3DHBA 1VGNA 3IEKA 4TZ9A 3DHAA 2QINA 3DHCA 4PVOA 2AZ4A 1K07A 4TZEA 4EYBA 4GYQA 2YNVB 2FHXB 2BFKA 3S0ZA 5EVBA 4O98A 2XF4A 5B1UA 5AIJA 4EY2A 3SRXA 4AD9A 3ZR9A 2Q0JA 4UWRB 3X2YA 4C09A 5ACXA 2M5DA 4XWWA 4AV7A 2OHJA 4D1WA 1VJNA 1P9EA 3R2UA 3T9MA 3X30A 1WUOA 5HIPA 4GCWA 3I11A 4UWPB 2GKLA 4NQ2A 2GFJA 4Z5ZA 4UWSB 4ZEJA 4FR7A 2VW8A 2Q9UA 3ZQ4A 5B3RA 2R2DA 5LE1A 4EXSA 1E5DA 2XR1A 3RKKA 2Q42A 3Q6VA 4XWTA 4HKYA 3SPUA 5HH4A 4DILA 3IELA 2YHEA 4C1HA 2Y8AA 1BVTA 1DDKA 5LS3A 4D1VA 2BG7A 5LCHA 5EWAA 3DH8A 5FQAA 4UWOB 5IQKA 2NXAA 4AX0B 2P1EA 4WD6A 4Z6XA 5ACTA 5A5ZA 3LVZA 2YNUA 3TP9A 5K4NA 2CFZA 5AEBA 3PG4A 5LMCA 1YCGA 4NURA 3L6NA 2BC2A 3SD9A 5EV6A 1M2XA 3H3EA 4J5FA 5LCAA 3KL7A 3I14A 2BFZA 4RAWA 1HLKA 2GFKA 2QDSA 2DKFA 4KEPA 2YZ3A 5EW0A 2NZEA 3VQZA 1A7TA 5A0VA 4PVTA 2WYMC 4V0HA 4RAMA 4RBSA 5AYAA 4RL0A 1ZNBA 4EFZA 2E7YA 2P18A 3FCZA 5ACVA 3T3OA 3BC2A 2I7TA 4AXHA 2YCBA 2BG8B 3IOFA 4GYUA 2WYMA 2WYLA 3A4YA 3WXCA 4B87A 5HH5A 3IE2A 5ACUA 3PY6A 3IE0A 4RM5A 2Q0IA 1JJEA 3BK1A 5HIOA 1Y44A 4Z60A 2ZO4A 4U4LA 5ACSA 4NQ4A 2I7VA 5AHOA 5K4MA 4ZO3A 4Z5YA 5K4KA 5A23A 4HL1A 2WRSA 4LE6A 3BV6A 4C1FA 1JJTA 2QDTA 1YCHA 2A7MA 2BMIA 2P97A 1SMLA 2QJSA 3MD7A 3AJ3A 1KO3A 2BG8A 4F6ZA 5LCFA 5LLDA 4EYFA 3ZWFA 4D02A 2CFUA 1XTOA 2CBNA 3ZNBA 2GCUA 4TZFA 1JT1A 2FHXA 2ZNBA 2I7XA 3G1PA 1YCFA 1X8GA 4TYFA 5HIQA 5FQCA 2BFZB 1KO2A 4J5HA 5A0TA 5AJLA 3X2XA 2BFLA 2UYXA 4YSKA 5EV8A 2ZZIA 2GMNA 4C1DA 4Z67A 5ACRA 3IEMA 5A87A 5KIKA 3X2ZA 2NYPA 3SW3A 3I0VA 2P4ZA 5EH9A 2FU7A 1BC2A 2M5CA 1WUPA 5ACWA 4H0DA 2FM6A 2YNVA 4ZO2A 3I13A 1VMEA 1DXKA 4C1EA 1BMCA 1ZTCA 2CG2A 2FU9A 2OHHA 2ZWRA 4EXYA 4C1GA 5DPXA 5FQBA 5EHTA 5HISA 5ACPA 5KILA 1L9YA 2YNTB 3SBLA 2OHIA 4EYLA 1KR3A 3VPEA 2FU6A 5K0WA 3ESHA 3IE1A 2Y87A 2FK6A 1QH5A 4DIKA 4BZ3A 2YNWA 4TYTA 3I15A 2HB9A 5EVDA 1XM8A 4XUKA 4UAMA 1QH3A 4AWYB 3F9OA 4C1CA 3JXPA 5EVKA 3T3NA 2BIBA 4PDXA 3BK2A 3QH8A 2BTNA 4HL2A 2H6AA 3RKJA 4FSBA 2BR6A 4JO0A 4FEKA 3RPCA 5LSCA 1X8IA 2AIOA
chains in the Genus database with same CATH topology
3P2UA 4YSBA 1WRAA 4KEQA 5B15A 3IOGA 4TZBA 2YNTA 3AF5A 5AHRA 4AX1B 4D1UA 2DOOA 4UBQA 2BG2A 4AWZA 5HH6A 2QEDA 2Y8BA 3FAIA 3ADRA 4BP0A 3SFPA 4RL2A 4NQ5A 2WHGA 4YSLA 2BGAA 3KNSA 1MQOA 4Z7RA 4ZNBA 4D1TA 1DD6A 1A8TA 4P62A 2NZFA 3PY5A 4CHLA 4UA4A 1X8HA 5LM6A 1ZKPA 5ACQA 3AF6A 2FU8A 4F6HA 5AXOA 4NQ6A 2BG6A 5AXRA 3IDZA 3KNRA 1WW1A 3DHBA 1VGNA 3IEKA 4TZ9A 3DHAA 2QINA 3DHCA 4PVOA 2AZ4A 1K07A 4TZEA 4EYBA 4GYQA 2YNVB 2FHXB 2BFKA 3S0ZA 5EVBA 4O98A 2XF4A 5B1UA 4EY2A 3SRXA 4AD9A 3ZR9A 2Q0JA 4UWRB 3X2YA 4C09A 5ACXA 2M5DA 4XWWA 2OHJA 4D1WA 1VJNA 1P9EA 3R2UA 3T9MA 3X30A 1WUOA 5HIPA 4GCWA 3I11A 4UWPB 2GKLA 4NQ2A 2GFJA 4Z5ZA 4UWSB 4ZEJA 4FR7A 2VW8A 2Q9UA 3ZQ4A 5B3RA 2R2DA 5LE1A 4EXSA 1E5DA 2XR1A 3RKKA 2Q42A 3Q6VA 4XWTA 4HKYA 3SPUA 5HH4A 4DILA 3IELA 4C1HA 2Y8AA 1BVTA 1DDKA 5LS3A 4D1VA 2BG7A 5LCHA 5EWAA 3DH8A 5FQAA 4UWOB 5IQKA 2NXAA 4AX0B 2P1EA 4WD6A 4Z6XA 5ACTA 5A5ZA 3LVZA 2YNUA 3TP9A 5K4NA 5AEBA 3PG4A 5LMCA 1YCGA 3L6NA 2BC2A 3SD9A 5EV6A 1M2XA 3H3EA 4J5FA 5LCAA 3KL7A 3I14A 2BFZA 4RAWA 1HLKA 2GFKA 2QDSA 2DKFA 4KEPA 2YZ3A 5EW0A 2NZEA 3VQZA 1A7TA 5A0VA 4PVTA 2WYMC 4V0HA 4RAMA 4RBSA 5AYAA 4RL0A 1ZNBA 4EFZA 2E7YA 2P18A 3FCZA 5ACVA 3T3OA 3BC2A 2I7TA 2YCBA 2BG8B 3IOFA 4GYUA 2WYMA 2WYLA 3A4YA 3WXCA 4B87A 5HH5A 3IE2A 5ACUA 3PY6A 3IE0A 4RM5A 2Q0IA 1JJEA 3BK1A 5HIOA 1Y44A 4Z60A 2ZO4A 4U4LA 5ACSA 4NQ4A 2I7VA 5AHOA 5K4MA 4ZO3A 4Z5YA 5K4KA 4HL1A 2WRSA 4LE6A 3BV6A 4C1FA 1JJTA 2QDTA 1YCHA 2A7MA 2BMIA 2P97A 1SMLA 2QJSA 3MD7A 3AJ3A 1KO3A 2BG8A 4F6ZA 5LCFA 5LLDA 4EYFA 3ZWFA 4D02A 1XTOA 2CBNA 3ZNBA 2GCUA 4TZFA 1JT1A 2FHXA 2ZNBA 2I7XA 3G1PA 1YCFA 1X8GA 4TYFA 5HIQA 5FQCA 2BFZB 1KO2A 4J5HA 5A0TA 3X2XA 2BFLA 2UYXA 4YSKA 5EV8A 2ZZIA 2GMNA 4C1DA 4Z67A 5ACRA 3IEMA 5A87A 5KIKA 3X2ZA 2NYPA 3SW3A 3I0VA 2P4ZA 5EH9A 2FU7A 1BC2A 2M5CA 1WUPA 5ACWA 4H0DA 2FM6A 2YNVA 4ZO2A 3I13A 1VMEA 1DXKA 4C1EA 1BMCA 1ZTCA 2FU9A 2OHHA 2ZWRA 4EXYA 4C1GA 5DPXA 5FQBA 5EHTA 5HISA 5ACPA 5KILA 1L9YA 2YNTB 3SBLA 2OHIA 4EYLA 1KR3A 3VPEA 2FU6A 5K0WA 3ESHA 3IE1A 2Y87A 2FK6A 1QH5A 4DIKA 4BZ3A 2YNWA 4TYTA 3I15A 2HB9A 5EVDA 1XM8A 4XUKA 4UAMA 1QH3A 4AWYB 3F9OA 4C1CA 3JXPA 5EVKA 3T3NA 2BIBA 3BK2A 3QH8A 2BTNA 4HL2A 2H6AA 3RKJA 4FSBA 2BR6A 4JO0A 4FEKA 3RPCA 5LSCA 1X8IA 2AIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P2U A;  4YSB A;  1WRA A;  4KEQ A;  5B15 A;  3IOG A;  4TZB A;  2YNT A;  3AF5 A;  5AHR A;  4AX1 B;  4D1U A;  2DOO A;  4UBQ A;  2BG2 A;  4AWZ A;  5HH6 A;  2QED A;  2Y8B A;  3FAI A;  3ADR A;  4BP0 A;  3SFP A;  4RL2 A;  4NQ5 A;  2WHG A;  4YSL A;  2BGA A;  3KNS A;  1MQO A;  4Z7R A;  4ZNB A;  4D1T A;  1DD6 A;  1A8T A;  4P62 A;  2NZF A;  3PY5 A;  4CHL A;  4UA4 A;  1X8H A;  5LM6 A;  1ZKP A;  5ACQ A;  3AF6 A;  2FU8 A;  4F6H A;  5AXO A;  4NQ6 A;  2BG6 A;  5AXR A;  3IDZ A;  3KNR A;  1WW1 A;  3DHB A;  1VGN A;  3IEK A;  4TZ9 A;  3DHA A;  2QIN A;  3DHC A;  4PVO A;  2AZ4 A;  1K07 A;  4TZE A;  4EYB A;  4GYQ A;  2YNV B;  2FHX B;  2BFK A;  3S0Z A;  5EVB A;  4O98 A;  2XF4 A;  5B1U A;  4EY2 A;  3SRX A;  4AD9 A;  3ZR9 A;  2Q0J A;  4UWR B;  3X2Y A;  4C09 A;  5ACX A;  2M5D A;  4XWW A;  2OHJ A;  4D1W A;  1VJN A;  1P9E A;  3R2U A;  3T9M A;  3X30 A;  1WUO A;  5HIP A;  4GCW A;  3I11 A;  4UWP B;  2GKL A;  4NQ2 A;  2GFJ A;  4Z5Z A;  4UWS B;  4ZEJ A;  4FR7 A;  2VW8 A;  2Q9U A;  3ZQ4 A;  5B3R A;  2R2D A;  5LE1 A;  4EXS A;  1E5D A;  2XR1 A;  3RKK A;  2Q42 A;  3Q6V A;  4XWT A;  4HKY A;  3SPU A;  5HH4 A;  4DIL A;  3IEL A;  4C1H A;  2Y8A A;  1BVT A;  1DDK A;  5LS3 A;  4D1V A;  2BG7 A;  5LCH A;  5EWA A;  3DH8 A;  5FQA A;  4UWO B;  5IQK A;  2NXA A;  4AX0 B;  2P1E A;  4WD6 A;  4Z6X A;  5ACT A;  5A5Z A;  3LVZ A;  2YNU A;  3TP9 A;  5K4N A;  5AEB A;  3PG4 A;  5LMC A;  1YCG A;  3L6N A;  2BC2 A;  3SD9 A;  5EV6 A;  1M2X A;  3H3E A;  4J5F A;  5LCA A;  3KL7 A;  3I14 A;  2BFZ A;  4RAW A;  1HLK A;  2GFK A;  2QDS A;  2DKF A;  4KEP A;  2YZ3 A;  5EW0 A;  2NZE A;  3VQZ A;  1A7T A;  5A0V A;  4PVT A;  2WYM C;  4V0H A;  4RAM A;  4RBS A;  5AYA A;  4RL0 A;  1ZNB A;  4EFZ A;  2E7Y A;  2P18 A;  3FCZ A;  5ACV A;  3T3O A;  3BC2 A;  2I7T A;  2YCB A;  2BG8 B;  3IOF A;  4GYU A;  2WYM A;  2WYL A;  3A4Y A;  3WXC A;  4B87 A;  5HH5 A;  3IE2 A;  5ACU A;  3PY6 A;  3IE0 A;  4RM5 A;  2Q0I A;  1JJE A;  3BK1 A;  5HIO A;  1Y44 A;  4Z60 A;  2ZO4 A;  4U4L A;  5ACS A;  4NQ4 A;  2I7V A;  5AHO A;  5K4M A;  4ZO3 A;  4Z5Y A;  5K4K A;  4HL1 A;  2WRS A;  4LE6 A;  3BV6 A;  4C1F A;  1JJT A;  2QDT A;  1YCH A;  2A7M A;  2BMI A;  2P97 A;  1SML A;  2QJS A;  3MD7 A;  3AJ3 A;  1KO3 A;  2BG8 A;  4F6Z A;  5LCF A;  5LLD A;  4EYF A;  3ZWF A;  4D02 A;  1XTO A;  2CBN A;  3ZNB A;  2GCU A;  4TZF A;  1JT1 A;  2FHX A;  2ZNB A;  2I7X A;  3G1P A;  1YCF A;  1X8G A;  4TYF A;  5HIQ A;  5FQC A;  2BFZ B;  1KO2 A;  4J5H A;  5A0T A;  3X2X A;  2BFL A;  2UYX A;  4YSK A;  5EV8 A;  2ZZI A;  2GMN A;  4C1D A;  4Z67 A;  5ACR A;  3IEM A;  5A87 A;  5KIK A;  3X2Z A;  2NYP A;  3SW3 A;  3I0V A;  2P4Z A;  5EH9 A;  2FU7 A;  1BC2 A;  2M5C A;  1WUP A;  5ACW A;  4H0D A;  2FM6 A;  2YNV A;  4ZO2 A;  3I13 A;  1VME A;  1DXK A;  4C1E A;  1BMC A;  1ZTC A;  2FU9 A;  2OHH A;  2ZWR A;  4EXY A;  4C1G A;  5DPX A;  5FQB A;  5EHT A;  5HIS A;  5ACP A;  5KIL A;  1L9Y A;  2YNT B;  3SBL A;  2OHI A;  4EYL A;  1KR3 A;  3VPE A;  2FU6 A;  5K0W A;  3ESH A;  3IE1 A;  2Y87 A;  2FK6 A;  1QH5 A;  4DIK A;  4BZ3 A;  2YNW A;  4TYT A;  3I15 A;  2HB9 A;  5EVD A;  1XM8 A;  4XUK A;  4UAM A;  1QH3 A;  4AWY B;  3F9O A;  4C1C A;  3JXP A;  5EVK A;  3T3N A;  2BIB A;  3BK2 A;  3QH8 A;  2BTN A;  4HL2 A;  2H6A A;  3RKJ A;  4FSB A;  2BR6 A;  4JO0 A;  4FEK A;  3RPC A;  5LSC A;  1X8I A;  2AIO A; 
#chains in the Genus database with same CATH topology
 3P2U A;  4YSB A;  1WRA A;  4KEQ A;  5B15 A;  3IOG A;  4TZB A;  2YNT A;  3AF5 A;  5AHR A;  4AX1 B;  4D1U A;  2DOO A;  4UBQ A;  2BG2 A;  4AWZ A;  5HH6 A;  2QED A;  2Y8B A;  3FAI A;  3ADR A;  4BP0 A;  3SFP A;  4RL2 A;  4NQ5 A;  2WHG A;  4YSL A;  2BGA A;  3KNS A;  1MQO A;  4Z7R A;  4ZNB A;  2CG3 A;  4D1T A;  1DD6 A;  1A8T A;  4P62 A;  2NZF A;  3PY5 A;  4CHL A;  4UA4 A;  1X8H A;  5LM6 A;  1ZKP A;  5ACQ A;  3AF6 A;  2FU8 A;  4F6H A;  5AXO A;  4NQ6 A;  2BG6 A;  5AXR A;  3IDZ A;  3KNR A;  1WW1 A;  3DHB A;  1VGN A;  3IEK A;  4TZ9 A;  3DHA A;  2QIN A;  3DHC A;  4PVO A;  2AZ4 A;  1K07 A;  4TZE A;  4EYB A;  4GYQ A;  2YNV B;  2FHX B;  2BFK A;  3S0Z A;  5EVB A;  4O98 A;  2XF4 A;  5B1U A;  5AIJ A;  4EY2 A;  3SRX A;  4AD9 A;  3ZR9 A;  2Q0J A;  4UWR B;  3X2Y A;  4C09 A;  5ACX A;  2M5D A;  4XWW A;  4AV7 A;  2OHJ A;  4D1W A;  1VJN A;  1P9E A;  3R2U A;  3T9M A;  3X30 A;  1WUO A;  5HIP A;  4GCW A;  3I11 A;  4UWP B;  2GKL A;  4NQ2 A;  2GFJ A;  4Z5Z A;  4UWS B;  4ZEJ A;  4FR7 A;  2VW8 A;  2Q9U A;  3ZQ4 A;  5B3R A;  2R2D A;  5LE1 A;  4EXS A;  1E5D A;  2XR1 A;  3RKK A;  2Q42 A;  3Q6V A;  4XWT A;  4HKY A;  3SPU A;  5HH4 A;  4DIL A;  3IEL A;  2YHE A;  4C1H A;  2Y8A A;  1BVT A;  1DDK A;  5LS3 A;  4D1V A;  2BG7 A;  5LCH A;  5EWA A;  3DH8 A;  5FQA A;  4UWO B;  5IQK A;  2NXA A;  4AX0 B;  2P1E A;  4WD6 A;  4Z6X A;  5ACT A;  5A5Z A;  3LVZ A;  2YNU A;  3TP9 A;  5K4N A;  2CFZ A;  5AEB A;  3PG4 A;  5LMC A;  1YCG A;  4NUR A;  3L6N A;  2BC2 A;  3SD9 A;  5EV6 A;  1M2X A;  3H3E A;  4J5F A;  5LCA A;  3KL7 A;  3I14 A;  2BFZ A;  4RAW A;  1HLK A;  2GFK A;  2QDS A;  2DKF A;  4KEP A;  2YZ3 A;  5EW0 A;  2NZE A;  3VQZ A;  1A7T A;  5A0V A;  4PVT A;  2WYM C;  4V0H A;  4RAM A;  4RBS A;  5AYA A;  4RL0 A;  1ZNB A;  4EFZ A;  2E7Y A;  2P18 A;  3FCZ A;  5ACV A;  3T3O A;  3BC2 A;  2I7T A;  4AXH A;  2YCB A;  2BG8 B;  3IOF A;  4GYU A;  2WYM A;  2WYL A;  3A4Y A;  3WXC A;  4B87 A;  5HH5 A;  3IE2 A;  5ACU A;  3PY6 A;  3IE0 A;  4RM5 A;  2Q0I A;  1JJE A;  3BK1 A;  5HIO A;  1Y44 A;  4Z60 A;  2ZO4 A;  4U4L A;  5ACS A;  4NQ4 A;  2I7V A;  5AHO A;  5K4M A;  4ZO3 A;  4Z5Y A;  5K4K A;  5A23 A;  4HL1 A;  2WRS A;  4LE6 A;  3BV6 A;  4C1F A;  1JJT A;  2QDT A;  1YCH A;  2A7M A;  2BMI A;  2P97 A;  1SML A;  2QJS A;  3MD7 A;  3AJ3 A;  1KO3 A;  2BG8 A;  4F6Z A;  5LCF A;  5LLD A;  4EYF A;  3ZWF A;  4D02 A;  2CFU A;  1XTO A;  2CBN A;  3ZNB A;  2GCU A;  4TZF A;  1JT1 A;  2FHX A;  2ZNB A;  2I7X A;  3G1P A;  1YCF A;  1X8G A;  4TYF A;  5HIQ A;  5FQC A;  2BFZ B;  1KO2 A;  4J5H A;  5A0T A;  5AJL A;  3X2X A;  2BFL A;  2UYX A;  4YSK A;  5EV8 A;  2ZZI A;  2GMN A;  4C1D A;  4Z67 A;  5ACR A;  3IEM A;  5A87 A;  5KIK A;  3X2Z A;  2NYP A;  3SW3 A;  3I0V A;  2P4Z A;  5EH9 A;  2FU7 A;  1BC2 A;  2M5C A;  1WUP A;  5ACW A;  4H0D A;  2FM6 A;  2YNV A;  4ZO2 A;  3I13 A;  1VME A;  1DXK A;  4C1E A;  1BMC A;  1ZTC A;  2CG2 A;  2FU9 A;  2OHH A;  2ZWR A;  4EXY A;  4C1G A;  5DPX A;  5FQB A;  5EHT A;  5HIS A;  5ACP A;  5KIL A;  1L9Y A;  2YNT B;  3SBL A;  2OHI A;  4EYL A;  1KR3 A;  3VPE A;  2FU6 A;  5K0W A;  3ESH A;  3IE1 A;  2Y87 A;  2FK6 A;  1QH5 A;  4DIK A;  4BZ3 A;  2YNW A;  4TYT A;  3I15 A;  2HB9 A;  5EVD A;  1XM8 A;  4XUK A;  4UAM A;  1QH3 A;  4AWY B;  3F9O A;  4C1C A;  3JXP A;  5EVK A;  3T3N A;  2BIB A;  4PDX A;  3BK2 A;  3QH8 A;  2BTN A;  4HL2 A;  2H6A A;  3RKJ A;  4FSB A;  2BR6 A;  4JO0 A;  4FEK A;  3RPC A;  5LSC A;  1X8I A;  2AIO A; 
#chains in the Genus database with same CATH homology
 3P2U A;  4YSB A;  1WRA A;  4KEQ A;  5B15 A;  3IOG A;  4TZB A;  2YNT A;  3AF5 A;  5AHR A;  4AX1 B;  4D1U A;  2DOO A;  4UBQ A;  2BG2 A;  4AWZ A;  5HH6 A;  2QED A;  2Y8B A;  3FAI A;  3ADR A;  4BP0 A;  3SFP A;  4RL2 A;  4NQ5 A;  2WHG A;  4YSL A;  2BGA A;  3KNS A;  1MQO A;  4Z7R A;  4ZNB A;  4D1T A;  1DD6 A;  1A8T A;  4P62 A;  2NZF A;  3PY5 A;  4CHL A;  4UA4 A;  1X8H A;  5LM6 A;  1ZKP A;  5ACQ A;  3AF6 A;  2FU8 A;  4F6H A;  5AXO A;  4NQ6 A;  2BG6 A;  5AXR A;  3IDZ A;  3KNR A;  1WW1 A;  3DHB A;  1VGN A;  3IEK A;  4TZ9 A;  3DHA A;  2QIN A;  3DHC A;  4PVO A;  2AZ4 A;  1K07 A;  4TZE A;  4EYB A;  4GYQ A;  2YNV B;  2FHX B;  2BFK A;  3S0Z A;  5EVB A;  4O98 A;  2XF4 A;  5B1U A;  4EY2 A;  3SRX A;  4AD9 A;  3ZR9 A;  2Q0J A;  4UWR B;  3X2Y A;  4C09 A;  5ACX A;  2M5D A;  4XWW A;  2OHJ A;  4D1W A;  1VJN A;  1P9E A;  3R2U A;  3T9M A;  3X30 A;  1WUO A;  5HIP A;  4GCW A;  3I11 A;  4UWP B;  2GKL A;  4NQ2 A;  2GFJ A;  4Z5Z A;  4UWS B;  4ZEJ A;  4FR7 A;  2VW8 A;  2Q9U A;  3ZQ4 A;  5B3R A;  2R2D A;  5LE1 A;  4EXS A;  1E5D A;  2XR1 A;  3RKK A;  2Q42 A;  3Q6V A;  4XWT A;  4HKY A;  3SPU A;  5HH4 A;  4DIL A;  3IEL A;  4C1H A;  2Y8A A;  1BVT A;  1DDK A;  5LS3 A;  4D1V A;  2BG7 A;  5LCH A;  5EWA A;  3DH8 A;  5FQA A;  4UWO B;  5IQK A;  2NXA A;  4AX0 B;  2P1E A;  4WD6 A;  4Z6X A;  5ACT A;  5A5Z A;  3LVZ A;  2YNU A;  3TP9 A;  5K4N A;  5AEB A;  3PG4 A;  5LMC A;  1YCG A;  3L6N A;  2BC2 A;  3SD9 A;  5EV6 A;  1M2X A;  3H3E A;  4J5F A;  5LCA A;  3KL7 A;  3I14 A;  2BFZ A;  4RAW A;  1HLK A;  2GFK A;  2QDS A;  2DKF A;  4KEP A;  2YZ3 A;  5EW0 A;  2NZE A;  3VQZ A;  1A7T A;  5A0V A;  4PVT A;  2WYM C;  4V0H A;  4RAM A;  4RBS A;  5AYA A;  4RL0 A;  1ZNB A;  4EFZ A;  2E7Y A;  2P18 A;  3FCZ A;  5ACV A;  3T3O A;  3BC2 A;  2I7T A;  2YCB A;  2BG8 B;  3IOF A;  4GYU A;  2WYM A;  2WYL A;  3A4Y A;  3WXC A;  4B87 A;  5HH5 A;  3IE2 A;  5ACU A;  3PY6 A;  3IE0 A;  4RM5 A;  2Q0I A;  1JJE A;  3BK1 A;  5HIO A;  1Y44 A;  4Z60 A;  2ZO4 A;  4U4L A;  5ACS A;  4NQ4 A;  2I7V A;  5AHO A;  5K4M A;  4ZO3 A;  4Z5Y A;  5K4K A;  4HL1 A;  2WRS A;  4LE6 A;  3BV6 A;  4C1F A;  1JJT A;  2QDT A;  1YCH A;  2A7M A;  2BMI A;  2P97 A;  1SML A;  2QJS A;  3MD7 A;  3AJ3 A;  1KO3 A;  2BG8 A;  4F6Z A;  5LCF A;  5LLD A;  4EYF A;  3ZWF A;  4D02 A;  1XTO A;  2CBN A;  3ZNB A;  2GCU A;  4TZF A;  1JT1 A;  2FHX A;  2ZNB A;  2I7X A;  3G1P A;  1YCF A;  1X8G A;  4TYF A;  5HIQ A;  5FQC A;  2BFZ B;  1KO2 A;  4J5H A;  5A0T A;  3X2X A;  2BFL A;  2UYX A;  4YSK A;  5EV8 A;  2ZZI A;  2GMN A;  4C1D A;  4Z67 A;  5ACR A;  3IEM A;  5A87 A;  5KIK A;  3X2Z A;  2NYP A;  3SW3 A;  3I0V A;  2P4Z A;  5EH9 A;  2FU7 A;  1BC2 A;  2M5C A;  1WUP A;  5ACW A;  4H0D A;  2FM6 A;  2YNV A;  4ZO2 A;  3I13 A;  1VME A;  1DXK A;  4C1E A;  1BMC A;  1ZTC A;  2FU9 A;  2OHH A;  2ZWR A;  4EXY A;  4C1G A;  5DPX A;  5FQB A;  5EHT A;  5HIS A;  5ACP A;  5KIL A;  1L9Y A;  2YNT B;  3SBL A;  2OHI A;  4EYL A;  1KR3 A;  3VPE A;  2FU6 A;  5K0W A;  3ESH A;  3IE1 A;  2Y87 A;  2FK6 A;  1QH5 A;  4DIK A;  4BZ3 A;  2YNW A;  4TYT A;  3I15 A;  2HB9 A;  5EVD A;  1XM8 A;  4XUK A;  4UAM A;  1QH3 A;  4AWY B;  3F9O A;  4C1C A;  3JXP A;  5EVK A;  3T3N A;  2BIB A;  3BK2 A;  3QH8 A;  2BTN A;  4HL2 A;  2H6A A;  3RKJ A;  4FSB A;  2BR6 A;  4JO0 A;  4FEK A;  3RPC A;  5LSC A;  1X8I A;  2AIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...