5K0WA

Crystal structure of the metallo-beta-lactamase gob-18 from elizabethkingia meningoseptica
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
SAQVVKEPENMPKEWNQAYEPFRIAGNLYYVGTYDLASYLIVTDKGNILINTGTAESFPIIKANIQKLGFNYKDIKILLLTQAHYDHTGALQDFKTETAAKFYVDKADVDVLRTGGKSDYEMGKYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHPGHTKGSCSFIFETKDEKRKYRVLIANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHASQFDLHEKRKEGDPYNPQLFMDKQSYFQNLNDLEKSYLNKIKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class B carbapenemase GOB-18
publication title Crystal Structure of the Metallo-beta-Lactamase GOB in the Periplasmic Dizinc Form Reveals an Unusual Metal Site.
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5k0wA00
5KIKA 5B1UA 2I7TA 4D1TA 2QDSA 4JO0A 3BC2A 4AWYB 3KL7A 1BMCA 5LCFA 2YNWA 3IELA 4V0HA 2WYMC 5K4NA 2YNTA 2BG8B 3QH8A 4DIKA 3SRXA 3KNSA 5EVKA 3AJ3A 3TP9A 5LMCA 4LE6A 3ZR9A 1YCFA 5HIQA 2P4ZA 3DHBA 3VPEA 5LCAA 1YCGA 5EH9A 3JXPA 1E5DA 2I7VA 2YNTB 4UWSB 4C1EA 2A7MA 4P62A 2HB9A 5EWAA 2H6AA 3P2UA 5LCHA 4EXSA 2BG7A 2NYPA 2NZEA 3ADRA 4PVOA 4C1FA 1XTOA 5A87A 4B87A 2ZNBA 5AXOA 3I13A 3SFPA 1DDKA 3DHCA 2YZ3A 1ZTCA 1VGNA 2BMIA 3AF5A 4RBSA 3IE1A 2BIBA 4GCWA 4DILA 4UWPB 3RKKA 1JT1A 3I14A 4J5HA 3I15A 5FQAA 3IE0A 3BK1A 3L6NA 5ACQA 4EYBA 1YCHA 4KEQA 2YCBA 1JJTA 5AHOA 2QDTA 4XWWA 5HH5A 5EW0A 4Z7RA 1XM8A 2ZZIA 3H3EA 4EYFA 2BG2A 2UYXA 4HL2A 5ACRA 5LS3A 3SBLA 3T3NA 2BG6A 4J5FA 4YSLA 4UA4A 4XWTA 2P97A 5HISA 2AZ4A 2AIOA 4C1CA 4WD6A 3X2ZA 4YSKA 2BFLA 5A0VA 2BG8A 3AF6A 5K0WA 5ACUA 5AHRA 2YNUA 5KILA 4D1WA 1A8TA 3KNRA 3ZNBA 5EVBA 1X8IA 1A7TA 4TZFA 5ACWA 2WRSA 2FU7A 3SPUA 4H0DA 1X8HA 5B3RA 2GFKA 5FQBA 4AD9A 5A0TA 4UBQA 5HIPA 3I0VA 4D1UA 1DXKA 2I7XA 4RM5A 1KR3A 1MQOA 5ACVA 1VMEA 2BFZB 4C09A 5IQKA 4F6ZA 2FHXA 1X8GA 4C1HA 1HLKA 4NQ6A 3IEKA 1QH5A 2WYLA 2Q0JA 2NXAA 3R2UA 5HH6A 4PVTA 4NQ4A 4ZO2A 3T9MA 4XUKA 5AEBA 3PG4A 2FHXB 2GMNA 2QINA 4BP0A 3F9OA 4EY2A 1ZNBA 4TZEA 4AWZA 2QEDA 3SW3A 1WUPA 3A4YA 4Z5YA 4AX0B 4FEKA 4Z5ZA 3RKJA 5ACPA 2BTNA 2FU6A 3BV6A 2M5DA 4GYQA 2Y8BA 3FAIA 1JJEA 2BGAA 2CBNA 3SD9A 3VQZA 2BFKA 3IEMA 4GYUA 4HL1A 3IOGA 4TZBA 1SMLA 4UWOB 4U4LA 2GCUA 3IOFA 2ZWRA 4YSBA 5A5ZA 1DD6A 2ZO4A 5LE1A 3PY6A 2DOOA 3LVZA 5HH4A 3X2YA 3ZWFA 4KEPA 5B15A 2NZFA 2DKFA 4BZ3A 4NQ2A 1WW1A 4TYTA 2FK6A 4NQ5A 3I11A 5EHTA 5K4MA 4RAMA 2P18A 3RPCA 2BFZA 5LLDA 5EVDA 3S0ZA 4ZO3A 1K07A 1L9YA 2M5CA 4RAWA 2Q9UA 3ESHA 3DH8A 4ZEJA 2FU9A 2FU8A 5EV8A 2OHIA 2WYMA 4ZNBA 4Z60A 2XR1A 2Q0IA 3T3OA 4FR7A 2Y8AA 4C1GA 1ZKPA 5EV6A 4RL2A 1VJNA 5K4KA 1BVTA 1WRAA 3X30A 5ACXA 4Z6XA 4EFZA 3PY5A 3IE2A 1KO3A 4Z67A 3WXCA 1KO2A 4RL0A 4TYFA 4O98A 5AXRA 2P1EA 3BK2A 4UAMA 2QJSA 3FCZA 4FSBA 4F6HA 4TZ9A 4UWRB 4AX1B 2BC2A 4HKYA 5FQCA 1M2XA 1Y44A 2BR6A 1QH3A 1BC2A 4C1DA 4D1VA 5LSCA 3X2XA 2YNVA 5DPXA 5ACTA 3DHAA 3ZQ4A 2Q42A 2OHHA 3Q6VA 2OHJA 1P9EA 2E7YA 2GKLA 5ACSA 3IDZA 2R2DA 2Y87A 2XF4A 2VW8A 4EXYA 5AYAA 2FM6A 4CHLA 3G1PA 5LM6A 2YNVB 2WHGA 3MD7A 2GFJA 4EYLA 5HIOA 1WUOA 4D02A
chains in the Genus database with same CATH superfamily
5KIKA 5B1UA 2I7TA 4D1TA 2QDSA 4JO0A 3BC2A 4AWYB 3KL7A 1BMCA 5LCFA 2YNWA 3IELA 4V0HA 2WYMC 5K4NA 2YNTA 2BG8B 3QH8A 4DIKA 3SRXA 3KNSA 5EVKA 3AJ3A 3TP9A 5LMCA 4LE6A 3ZR9A 1YCFA 5HIQA 2P4ZA 3DHBA 3VPEA 5LCAA 1YCGA 5EH9A 3JXPA 1E5DA 2I7VA 2YNTB 4UWSB 4C1EA 2A7MA 4P62A 2HB9A 5EWAA 2H6AA 3P2UA 5LCHA 4EXSA 2BG7A 2NYPA 2NZEA 3ADRA 4PVOA 4C1FA 1XTOA 5A87A 4B87A 2ZNBA 5AXOA 3I13A 3SFPA 1DDKA 3DHCA 2YZ3A 1ZTCA 1VGNA 2BMIA 3AF5A 4RBSA 3IE1A 2BIBA 4GCWA 4DILA 4UWPB 3RKKA 1JT1A 2YHEA 3I14A 4J5HA 3I15A 5FQAA 3IE0A 3BK1A 3L6NA 5ACQA 4EYBA 1YCHA 4KEQA 2YCBA 1JJTA 5AHOA 2QDTA 4XWWA 5HH5A 5EW0A 4Z7RA 1XM8A 2ZZIA 3H3EA 4EYFA 2BG2A 2UYXA 4HL2A 5ACRA 5LS3A 3SBLA 3T3NA 2BG6A 4J5FA 4YSLA 4UA4A 4XWTA 2P97A 5HISA 2AZ4A 2AIOA 4C1CA 4WD6A 3X2ZA 4YSKA 2BFLA 5A0VA 2BG8A 3AF6A 5K0WA 5ACUA 5AHRA 2YNUA 5KILA 4D1WA 1A8TA 3KNRA 3ZNBA 5EVBA 1X8IA 1A7TA 4TZFA 5ACWA 2WRSA 2FU7A 2CFZA 3SPUA 4H0DA 1X8HA 5B3RA 4AXHA 2GFKA 2CG2A 5FQBA 4AD9A 5A0TA 4UBQA 5HIPA 3I0VA 4D1UA 1DXKA 2I7XA 4RM5A 1KR3A 1MQOA 5ACVA 1VMEA 2BFZB 4C09A 5IQKA 4F6ZA 2FHXA 1X8GA 4C1HA 2CG3A 1HLKA 4NQ6A 3IEKA 1QH5A 2WYLA 2Q0JA 2NXAA 3R2UA 5HH6A 4PVTA 4NQ4A 4ZO2A 3T9MA 4XUKA 5AJLA 5AEBA 3PG4A 5AIJA 2FHXB 2GMNA 2QINA 4BP0A 3F9OA 4EY2A 1ZNBA 4TZEA 4AWZA 2QEDA 3SW3A 1WUPA 3A4YA 4Z5YA 4AX0B 4FEKA 4Z5ZA 3RKJA 5ACPA 2BTNA 2FU6A 3BV6A 2M5DA 4GYQA 4PDXA 2Y8BA 3FAIA 1JJEA 2BGAA 2CBNA 3SD9A 3VQZA 2BFKA 3IEMA 4GYUA 4HL1A 3IOGA 4TZBA 1SMLA 4UWOB 4U4LA 2GCUA 3IOFA 2ZWRA 4YSBA 5A5ZA 1DD6A 2ZO4A 5LE1A 3PY6A 2DOOA 3LVZA 5HH4A 3X2YA 3ZWFA 4KEPA 5B15A 4NURA 2NZFA 2DKFA 4BZ3A 4NQ2A 1WW1A 4TYTA 2FK6A 4NQ5A 3I11A 5EHTA 5K4MA 4RAMA 2P18A 3RPCA 2BFZA 5LLDA 5EVDA 3S0ZA 4ZO3A 1K07A 1L9YA 2M5CA 4RAWA 2Q9UA 3ESHA 3DH8A 4ZEJA 2FU9A 2FU8A 5EV8A 2OHIA 2WYMA 4ZNBA 4Z60A 2XR1A 2Q0IA 3T3OA 4FR7A 2Y8AA 4C1GA 1ZKPA 5EV6A 4RL2A 1VJNA 5K4KA 1BVTA 1WRAA 3X30A 5ACXA 4Z6XA 4EFZA 3PY5A 3IE2A 1KO3A 4Z67A 3WXCA 1KO2A 4RL0A 4TYFA 4O98A 5AXRA 2P1EA 3BK2A 4UAMA 2QJSA 3FCZA 4FSBA 4F6HA 4TZ9A 4UWRB 4AX1B 2BC2A 4HKYA 5FQCA 1M2XA 1Y44A 2BR6A 1QH3A 1BC2A 4C1DA 4D1VA 5LSCA 3X2XA 2YNVA 5DPXA 5ACTA 3DHAA 3ZQ4A 2Q42A 2OHHA 3Q6VA 2OHJA 1P9EA 2E7YA 2GKLA 5ACSA 3IDZA 2R2DA 2Y87A 2XF4A 2VW8A 4EXYA 5AYAA 4AV7A 2FM6A 4CHLA 3G1PA 5LM6A 2YNVB 2WHGA 3MD7A 2GFJA 4EYLA 5HIOA 5A23A 1WUOA 4D02A 2CFUA
chains in the Genus database with same CATH topology
5KIKA 5B1UA 2I7TA 4D1TA 2QDSA 4JO0A 3BC2A 4AWYB 3KL7A 1BMCA 5LCFA 2YNWA 3IELA 4V0HA 2WYMC 5K4NA 2YNTA 2BG8B 3QH8A 4DIKA 3SRXA 3KNSA 5EVKA 3AJ3A 3TP9A 5LMCA 4LE6A 3ZR9A 1YCFA 5HIQA 2P4ZA 3DHBA 3VPEA 5LCAA 1YCGA 5EH9A 3JXPA 1E5DA 2I7VA 2YNTB 4UWSB 4C1EA 2A7MA 4P62A 2HB9A 5EWAA 2H6AA 3P2UA 5LCHA 4EXSA 2BG7A 2NYPA 2NZEA 3ADRA 4PVOA 4C1FA 1XTOA 5A87A 4B87A 2ZNBA 5AXOA 3I13A 3SFPA 1DDKA 3DHCA 2YZ3A 1ZTCA 1VGNA 2BMIA 3AF5A 4RBSA 3IE1A 2BIBA 4GCWA 4DILA 4UWPB 3RKKA 1JT1A 3I14A 4J5HA 3I15A 5FQAA 3IE0A 3BK1A 3L6NA 5ACQA 4EYBA 1YCHA 4KEQA 2YCBA 1JJTA 5AHOA 2QDTA 4XWWA 5HH5A 5EW0A 4Z7RA 1XM8A 2ZZIA 3H3EA 4EYFA 2BG2A 2UYXA 4HL2A 5ACRA 5LS3A 3SBLA 3T3NA 2BG6A 4J5FA 4YSLA 4UA4A 4XWTA 2P97A 5HISA 2AZ4A 2AIOA 4C1CA 4WD6A 3X2ZA 4YSKA 2BFLA 5A0VA 2BG8A 3AF6A 5K0WA 5ACUA 5AHRA 2YNUA 5KILA 4D1WA 1A8TA 3KNRA 3ZNBA 5EVBA 1X8IA 1A7TA 4TZFA 5ACWA 2WRSA 2FU7A 3SPUA 4H0DA 1X8HA 5B3RA 2GFKA 5FQBA 4AD9A 5A0TA 4UBQA 5HIPA 3I0VA 4D1UA 1DXKA 2I7XA 4RM5A 1KR3A 1MQOA 5ACVA 1VMEA 2BFZB 4C09A 5IQKA 4F6ZA 2FHXA 1X8GA 4C1HA 1HLKA 4NQ6A 3IEKA 1QH5A 2WYLA 2Q0JA 2NXAA 3R2UA 5HH6A 4PVTA 4NQ4A 4ZO2A 3T9MA 4XUKA 5AEBA 3PG4A 2FHXB 2GMNA 2QINA 4BP0A 3F9OA 4EY2A 1ZNBA 4TZEA 4AWZA 2QEDA 3SW3A 1WUPA 3A4YA 4Z5YA 4AX0B 4FEKA 4Z5ZA 3RKJA 5ACPA 2BTNA 2FU6A 3BV6A 2M5DA 4GYQA 2Y8BA 3FAIA 1JJEA 2BGAA 2CBNA 3SD9A 3VQZA 2BFKA 3IEMA 4GYUA 4HL1A 3IOGA 4TZBA 1SMLA 4UWOB 4U4LA 2GCUA 3IOFA 2ZWRA 4YSBA 5A5ZA 1DD6A 2ZO4A 5LE1A 3PY6A 2DOOA 3LVZA 5HH4A 3X2YA 3ZWFA 4KEPA 5B15A 2NZFA 2DKFA 4BZ3A 4NQ2A 1WW1A 4TYTA 2FK6A 4NQ5A 3I11A 5EHTA 5K4MA 4RAMA 2P18A 3RPCA 2BFZA 5LLDA 5EVDA 3S0ZA 4ZO3A 1K07A 1L9YA 2M5CA 4RAWA 2Q9UA 3ESHA 3DH8A 4ZEJA 2FU9A 2FU8A 5EV8A 2OHIA 2WYMA 4ZNBA 4Z60A 2XR1A 2Q0IA 3T3OA 4FR7A 2Y8AA 4C1GA 1ZKPA 5EV6A 4RL2A 1VJNA 5K4KA 1BVTA 1WRAA 3X30A 5ACXA 4Z6XA 4EFZA 3PY5A 3IE2A 1KO3A 4Z67A 3WXCA 1KO2A 4RL0A 4TYFA 4O98A 5AXRA 2P1EA 3BK2A 4UAMA 2QJSA 3FCZA 4FSBA 4F6HA 4TZ9A 4UWRB 4AX1B 2BC2A 4HKYA 5FQCA 1M2XA 1Y44A 2BR6A 1QH3A 1BC2A 4C1DA 4D1VA 5LSCA 3X2XA 2YNVA 5DPXA 5ACTA 3DHAA 3ZQ4A 2Q42A 2OHHA 3Q6VA 2OHJA 1P9EA 2E7YA 2GKLA 5ACSA 3IDZA 2R2DA 2Y87A 2XF4A 2VW8A 4EXYA 5AYAA 2FM6A 4CHLA 3G1PA 5LM6A 2YNVB 2WHGA 3MD7A 2GFJA 4EYLA 5HIOA 1WUOA 4D02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KIK A;  5B1U A;  2I7T A;  4D1T A;  2QDS A;  4JO0 A;  3BC2 A;  4AWY B;  3KL7 A;  1BMC A;  5LCF A;  2YNW A;  3IEL A;  4V0H A;  2WYM C;  5K4N A;  2YNT A;  2BG8 B;  3QH8 A;  4DIK A;  3SRX A;  3KNS A;  5EVK A;  3AJ3 A;  3TP9 A;  5LMC A;  4LE6 A;  3ZR9 A;  1YCF A;  5HIQ A;  2P4Z A;  3DHB A;  3VPE A;  5LCA A;  1YCG A;  5EH9 A;  3JXP A;  1E5D A;  2I7V A;  2YNT B;  4UWS B;  4C1E A;  2A7M A;  4P62 A;  2HB9 A;  5EWA A;  2H6A A;  3P2U A;  5LCH A;  4EXS A;  2BG7 A;  2NYP A;  2NZE A;  3ADR A;  4PVO A;  4C1F A;  1XTO A;  5A87 A;  4B87 A;  2ZNB A;  5AXO A;  3I13 A;  3SFP A;  1DDK A;  3DHC A;  2YZ3 A;  1ZTC A;  1VGN A;  2BMI A;  3AF5 A;  4RBS A;  3IE1 A;  2BIB A;  4GCW A;  4DIL A;  4UWP B;  3RKK A;  1JT1 A;  3I14 A;  4J5H A;  3I15 A;  5FQA A;  3IE0 A;  3BK1 A;  3L6N A;  5ACQ A;  4EYB A;  1YCH A;  4KEQ A;  2YCB A;  1JJT A;  5AHO A;  2QDT A;  4XWW A;  5HH5 A;  5EW0 A;  4Z7R A;  1XM8 A;  2ZZI A;  3H3E A;  4EYF A;  2BG2 A;  2UYX A;  4HL2 A;  5ACR A;  5LS3 A;  3SBL A;  3T3N A;  2BG6 A;  4J5F A;  4YSL A;  4UA4 A;  4XWT A;  2P97 A;  5HIS A;  2AZ4 A;  2AIO A;  4C1C A;  4WD6 A;  3X2Z A;  4YSK A;  2BFL A;  5A0V A;  2BG8 A;  3AF6 A;  5K0W A;  5ACU A;  5AHR A;  2YNU A;  5KIL A;  4D1W A;  1A8T A;  3KNR A;  3ZNB A;  5EVB A;  1X8I A;  1A7T A;  4TZF A;  5ACW A;  2WRS A;  2FU7 A;  3SPU A;  4H0D A;  1X8H A;  5B3R A;  2GFK A;  5FQB A;  4AD9 A;  5A0T A;  4UBQ A;  5HIP A;  3I0V A;  4D1U A;  1DXK A;  2I7X A;  4RM5 A;  1KR3 A;  1MQO A;  5ACV A;  1VME A;  2BFZ B;  4C09 A;  5IQK A;  4F6Z A;  2FHX A;  1X8G A;  4C1H A;  1HLK A;  4NQ6 A;  3IEK A;  1QH5 A;  2WYL A;  2Q0J A;  2NXA A;  3R2U A;  5HH6 A;  4PVT A;  4NQ4 A;  4ZO2 A;  3T9M A;  4XUK A;  5AEB A;  3PG4 A;  2FHX B;  2GMN A;  2QIN A;  4BP0 A;  3F9O A;  4EY2 A;  1ZNB A;  4TZE A;  4AWZ A;  2QED A;  3SW3 A;  1WUP A;  3A4Y A;  4Z5Y A;  4AX0 B;  4FEK A;  4Z5Z A;  3RKJ A;  5ACP A;  2BTN A;  2FU6 A;  3BV6 A;  2M5D A;  4GYQ A;  2Y8B A;  3FAI A;  1JJE A;  2BGA A;  2CBN A;  3SD9 A;  3VQZ A;  2BFK A;  3IEM A;  4GYU A;  4HL1 A;  3IOG A;  4TZB A;  1SML A;  4UWO B;  4U4L A;  2GCU A;  3IOF A;  2ZWR A;  4YSB A;  5A5Z A;  1DD6 A;  2ZO4 A;  5LE1 A;  3PY6 A;  2DOO A;  3LVZ A;  5HH4 A;  3X2Y A;  3ZWF A;  4KEP A;  5B15 A;  2NZF A;  2DKF A;  4BZ3 A;  4NQ2 A;  1WW1 A;  4TYT A;  2FK6 A;  4NQ5 A;  3I11 A;  5EHT A;  5K4M A;  4RAM A;  2P18 A;  3RPC A;  2BFZ A;  5LLD A;  5EVD A;  3S0Z A;  4ZO3 A;  1K07 A;  1L9Y A;  2M5C A;  4RAW A;  2Q9U A;  3ESH A;  3DH8 A;  4ZEJ A;  2FU9 A;  2FU8 A;  5EV8 A;  2OHI A;  2WYM A;  4ZNB A;  4Z60 A;  2XR1 A;  2Q0I A;  3T3O A;  4FR7 A;  2Y8A A;  4C1G A;  1ZKP A;  5EV6 A;  4RL2 A;  1VJN A;  5K4K A;  1BVT A;  1WRA A;  3X30 A;  5ACX A;  4Z6X A;  4EFZ A;  3PY5 A;  3IE2 A;  1KO3 A;  4Z67 A;  3WXC A;  1KO2 A;  4RL0 A;  4TYF A;  4O98 A;  5AXR A;  2P1E A;  3BK2 A;  4UAM A;  2QJS A;  3FCZ A;  4FSB A;  4F6H A;  4TZ9 A;  4UWR B;  4AX1 B;  2BC2 A;  4HKY A;  5FQC A;  1M2X A;  1Y44 A;  2BR6 A;  1QH3 A;  1BC2 A;  4C1D A;  4D1V A;  5LSC A;  3X2X A;  2YNV A;  5DPX A;  5ACT A;  3DHA A;  3ZQ4 A;  2Q42 A;  2OHH A;  3Q6V A;  2OHJ A;  1P9E A;  2E7Y A;  2GKL A;  5ACS A;  3IDZ A;  2R2D A;  2Y87 A;  2XF4 A;  2VW8 A;  4EXY A;  5AYA A;  2FM6 A;  4CHL A;  3G1P A;  5LM6 A;  2YNV B;  2WHG A;  3MD7 A;  2GFJ A;  4EYL A;  5HIO A;  1WUO A;  4D02 A; 
#chains in the Genus database with same CATH topology
 5KIK A;  5B1U A;  2I7T A;  4D1T A;  2QDS A;  4JO0 A;  3BC2 A;  4AWY B;  3KL7 A;  1BMC A;  5LCF A;  2YNW A;  3IEL A;  4V0H A;  2WYM C;  5K4N A;  2YNT A;  2BG8 B;  3QH8 A;  4DIK A;  3SRX A;  3KNS A;  5EVK A;  3AJ3 A;  3TP9 A;  5LMC A;  4LE6 A;  3ZR9 A;  1YCF A;  5HIQ A;  2P4Z A;  3DHB A;  3VPE A;  5LCA A;  1YCG A;  5EH9 A;  3JXP A;  1E5D A;  2I7V A;  2YNT B;  4UWS B;  4C1E A;  2A7M A;  4P62 A;  2HB9 A;  5EWA A;  2H6A A;  3P2U A;  5LCH A;  4EXS A;  2BG7 A;  2NYP A;  2NZE A;  3ADR A;  4PVO A;  4C1F A;  1XTO A;  5A87 A;  4B87 A;  2ZNB A;  5AXO A;  3I13 A;  3SFP A;  1DDK A;  3DHC A;  2YZ3 A;  1ZTC A;  1VGN A;  2BMI A;  3AF5 A;  4RBS A;  3IE1 A;  2BIB A;  4GCW A;  4DIL A;  4UWP B;  3RKK A;  1JT1 A;  2YHE A;  3I14 A;  4J5H A;  3I15 A;  5FQA A;  3IE0 A;  3BK1 A;  3L6N A;  5ACQ A;  4EYB A;  1YCH A;  4KEQ A;  2YCB A;  1JJT A;  5AHO A;  2QDT A;  4XWW A;  5HH5 A;  5EW0 A;  4Z7R A;  1XM8 A;  2ZZI A;  3H3E A;  4EYF A;  2BG2 A;  2UYX A;  4HL2 A;  5ACR A;  5LS3 A;  3SBL A;  3T3N A;  2BG6 A;  4J5F A;  4YSL A;  4UA4 A;  4XWT A;  2P97 A;  5HIS A;  2AZ4 A;  2AIO A;  4C1C A;  4WD6 A;  3X2Z A;  4YSK A;  2BFL A;  5A0V A;  2BG8 A;  3AF6 A;  5K0W A;  5ACU A;  5AHR A;  2YNU A;  5KIL A;  4D1W A;  1A8T A;  3KNR A;  3ZNB A;  5EVB A;  1X8I A;  1A7T A;  4TZF A;  5ACW A;  2WRS A;  2FU7 A;  2CFZ A;  3SPU A;  4H0D A;  1X8H A;  5B3R A;  4AXH A;  2GFK A;  2CG2 A;  5FQB A;  4AD9 A;  5A0T A;  4UBQ A;  5HIP A;  3I0V A;  4D1U A;  1DXK A;  2I7X A;  4RM5 A;  1KR3 A;  1MQO A;  5ACV A;  1VME A;  2BFZ B;  4C09 A;  5IQK A;  4F6Z A;  2FHX A;  1X8G A;  4C1H A;  2CG3 A;  1HLK A;  4NQ6 A;  3IEK A;  1QH5 A;  2WYL A;  2Q0J A;  2NXA A;  3R2U A;  5HH6 A;  4PVT A;  4NQ4 A;  4ZO2 A;  3T9M A;  4XUK A;  5AJL A;  5AEB A;  3PG4 A;  5AIJ A;  2FHX B;  2GMN A;  2QIN A;  4BP0 A;  3F9O A;  4EY2 A;  1ZNB A;  4TZE A;  4AWZ A;  2QED A;  3SW3 A;  1WUP A;  3A4Y A;  4Z5Y A;  4AX0 B;  4FEK A;  4Z5Z A;  3RKJ A;  5ACP A;  2BTN A;  2FU6 A;  3BV6 A;  2M5D A;  4GYQ A;  4PDX A;  2Y8B A;  3FAI A;  1JJE A;  2BGA A;  2CBN A;  3SD9 A;  3VQZ A;  2BFK A;  3IEM A;  4GYU A;  4HL1 A;  3IOG A;  4TZB A;  1SML A;  4UWO B;  4U4L A;  2GCU A;  3IOF A;  2ZWR A;  4YSB A;  5A5Z A;  1DD6 A;  2ZO4 A;  5LE1 A;  3PY6 A;  2DOO A;  3LVZ A;  5HH4 A;  3X2Y A;  3ZWF A;  4KEP A;  5B15 A;  4NUR A;  2NZF A;  2DKF A;  4BZ3 A;  4NQ2 A;  1WW1 A;  4TYT A;  2FK6 A;  4NQ5 A;  3I11 A;  5EHT A;  5K4M A;  4RAM A;  2P18 A;  3RPC A;  2BFZ A;  5LLD A;  5EVD A;  3S0Z A;  4ZO3 A;  1K07 A;  1L9Y A;  2M5C A;  4RAW A;  2Q9U A;  3ESH A;  3DH8 A;  4ZEJ A;  2FU9 A;  2FU8 A;  5EV8 A;  2OHI A;  2WYM A;  4ZNB A;  4Z60 A;  2XR1 A;  2Q0I A;  3T3O A;  4FR7 A;  2Y8A A;  4C1G A;  1ZKP A;  5EV6 A;  4RL2 A;  1VJN A;  5K4K A;  1BVT A;  1WRA A;  3X30 A;  5ACX A;  4Z6X A;  4EFZ A;  3PY5 A;  3IE2 A;  1KO3 A;  4Z67 A;  3WXC A;  1KO2 A;  4RL0 A;  4TYF A;  4O98 A;  5AXR A;  2P1E A;  3BK2 A;  4UAM A;  2QJS A;  3FCZ A;  4FSB A;  4F6H A;  4TZ9 A;  4UWR B;  4AX1 B;  2BC2 A;  4HKY A;  5FQC A;  1M2X A;  1Y44 A;  2BR6 A;  1QH3 A;  1BC2 A;  4C1D A;  4D1V A;  5LSC A;  3X2X A;  2YNV A;  5DPX A;  5ACT A;  3DHA A;  3ZQ4 A;  2Q42 A;  2OHH A;  3Q6V A;  2OHJ A;  1P9E A;  2E7Y A;  2GKL A;  5ACS A;  3IDZ A;  2R2D A;  2Y87 A;  2XF4 A;  2VW8 A;  4EXY A;  5AYA A;  4AV7 A;  2FM6 A;  4CHL A;  3G1P A;  5LM6 A;  2YNV B;  2WHG A;  3MD7 A;  2GFJ A;  4EYL A;  5HIO A;  5A23 A;  1WUO A;  4D02 A;  2CFU A; 
#chains in the Genus database with same CATH homology
 5KIK A;  5B1U A;  2I7T A;  4D1T A;  2QDS A;  4JO0 A;  3BC2 A;  4AWY B;  3KL7 A;  1BMC A;  5LCF A;  2YNW A;  3IEL A;  4V0H A;  2WYM C;  5K4N A;  2YNT A;  2BG8 B;  3QH8 A;  4DIK A;  3SRX A;  3KNS A;  5EVK A;  3AJ3 A;  3TP9 A;  5LMC A;  4LE6 A;  3ZR9 A;  1YCF A;  5HIQ A;  2P4Z A;  3DHB A;  3VPE A;  5LCA A;  1YCG A;  5EH9 A;  3JXP A;  1E5D A;  2I7V A;  2YNT B;  4UWS B;  4C1E A;  2A7M A;  4P62 A;  2HB9 A;  5EWA A;  2H6A A;  3P2U A;  5LCH A;  4EXS A;  2BG7 A;  2NYP A;  2NZE A;  3ADR A;  4PVO A;  4C1F A;  1XTO A;  5A87 A;  4B87 A;  2ZNB A;  5AXO A;  3I13 A;  3SFP A;  1DDK A;  3DHC A;  2YZ3 A;  1ZTC A;  1VGN A;  2BMI A;  3AF5 A;  4RBS A;  3IE1 A;  2BIB A;  4GCW A;  4DIL A;  4UWP B;  3RKK A;  1JT1 A;  3I14 A;  4J5H A;  3I15 A;  5FQA A;  3IE0 A;  3BK1 A;  3L6N A;  5ACQ A;  4EYB A;  1YCH A;  4KEQ A;  2YCB A;  1JJT A;  5AHO A;  2QDT A;  4XWW A;  5HH5 A;  5EW0 A;  4Z7R A;  1XM8 A;  2ZZI A;  3H3E A;  4EYF A;  2BG2 A;  2UYX A;  4HL2 A;  5ACR A;  5LS3 A;  3SBL A;  3T3N A;  2BG6 A;  4J5F A;  4YSL A;  4UA4 A;  4XWT A;  2P97 A;  5HIS A;  2AZ4 A;  2AIO A;  4C1C A;  4WD6 A;  3X2Z A;  4YSK A;  2BFL A;  5A0V A;  2BG8 A;  3AF6 A;  5K0W A;  5ACU A;  5AHR A;  2YNU A;  5KIL A;  4D1W A;  1A8T A;  3KNR A;  3ZNB A;  5EVB A;  1X8I A;  1A7T A;  4TZF A;  5ACW A;  2WRS A;  2FU7 A;  3SPU A;  4H0D A;  1X8H A;  5B3R A;  2GFK A;  5FQB A;  4AD9 A;  5A0T A;  4UBQ A;  5HIP A;  3I0V A;  4D1U A;  1DXK A;  2I7X A;  4RM5 A;  1KR3 A;  1MQO A;  5ACV A;  1VME A;  2BFZ B;  4C09 A;  5IQK A;  4F6Z A;  2FHX A;  1X8G A;  4C1H A;  1HLK A;  4NQ6 A;  3IEK A;  1QH5 A;  2WYL A;  2Q0J A;  2NXA A;  3R2U A;  5HH6 A;  4PVT A;  4NQ4 A;  4ZO2 A;  3T9M A;  4XUK A;  5AEB A;  3PG4 A;  2FHX B;  2GMN A;  2QIN A;  4BP0 A;  3F9O A;  4EY2 A;  1ZNB A;  4TZE A;  4AWZ A;  2QED A;  3SW3 A;  1WUP A;  3A4Y A;  4Z5Y A;  4AX0 B;  4FEK A;  4Z5Z A;  3RKJ A;  5ACP A;  2BTN A;  2FU6 A;  3BV6 A;  2M5D A;  4GYQ A;  2Y8B A;  3FAI A;  1JJE A;  2BGA A;  2CBN A;  3SD9 A;  3VQZ A;  2BFK A;  3IEM A;  4GYU A;  4HL1 A;  3IOG A;  4TZB A;  1SML A;  4UWO B;  4U4L A;  2GCU A;  3IOF A;  2ZWR A;  4YSB A;  5A5Z A;  1DD6 A;  2ZO4 A;  5LE1 A;  3PY6 A;  2DOO A;  3LVZ A;  5HH4 A;  3X2Y A;  3ZWF A;  4KEP A;  5B15 A;  2NZF A;  2DKF A;  4BZ3 A;  4NQ2 A;  1WW1 A;  4TYT A;  2FK6 A;  4NQ5 A;  3I11 A;  5EHT A;  5K4M A;  4RAM A;  2P18 A;  3RPC A;  2BFZ A;  5LLD A;  5EVD A;  3S0Z A;  4ZO3 A;  1K07 A;  1L9Y A;  2M5C A;  4RAW A;  2Q9U A;  3ESH A;  3DH8 A;  4ZEJ A;  2FU9 A;  2FU8 A;  5EV8 A;  2OHI A;  2WYM A;  4ZNB A;  4Z60 A;  2XR1 A;  2Q0I A;  3T3O A;  4FR7 A;  2Y8A A;  4C1G A;  1ZKP A;  5EV6 A;  4RL2 A;  1VJN A;  5K4K A;  1BVT A;  1WRA A;  3X30 A;  5ACX A;  4Z6X A;  4EFZ A;  3PY5 A;  3IE2 A;  1KO3 A;  4Z67 A;  3WXC A;  1KO2 A;  4RL0 A;  4TYF A;  4O98 A;  5AXR A;  2P1E A;  3BK2 A;  4UAM A;  2QJS A;  3FCZ A;  4FSB A;  4F6H A;  4TZ9 A;  4UWR B;  4AX1 B;  2BC2 A;  4HKY A;  5FQC A;  1M2X A;  1Y44 A;  2BR6 A;  1QH3 A;  1BC2 A;  4C1D A;  4D1V A;  5LSC A;  3X2X A;  2YNV A;  5DPX A;  5ACT A;  3DHA A;  3ZQ4 A;  2Q42 A;  2OHH A;  3Q6V A;  2OHJ A;  1P9E A;  2E7Y A;  2GKL A;  5ACS A;  3IDZ A;  2R2D A;  2Y87 A;  2XF4 A;  2VW8 A;  4EXY A;  5AYA A;  2FM6 A;  4CHL A;  3G1P A;  5LM6 A;  2YNV B;  2WHG A;  3MD7 A;  2GFJ A;  4EYL A;  5HIO A;  1WUO A;  4D02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...