3MD7A

Crystal structure of a beta-lactamase-like protein bound to gmp from brucella melitensis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase-like
publication title BrabA.11339.a: anomalous diffraction and ligand binding guide towards the elucidation of the function of a `putative beta-lactamase-like protein from Brucella melitensis.
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
molecule tags Hydrolase
total genus 83
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3md7A00
5EV6A 4EY2A 1ZTCA 2WHGA 1Y44A 5B1UA 4Z67A 4EYBA 1A7TA 4TZFA 4UBQA 3ADRA 5EVDA 5LSCA 4O98A 3IOFA 3A4YA 1QH3A 2VW8A 2Q9UA 4J5FA 2BFLA 4DIKA 1QH5A 2YNVB 3JXPA 2FM6A 5IQKA 4PVOA 3FCZA 1BMCA 2BC2A 2WRSA 4D1TA 4UWSB 2OHIA 4RBSA 2P1EA 3KNRA 5LE1A 2NZEA 1XM8A 5EHTA 1X8IA 2YCBA 3SPUA 4Z7RA 2YNVA 4H0DA 1BC2A 2QEDA 3R2UA 5EH9A 3ZWFA 4D1UA 2P4ZA 3S0ZA 4DILA 1L9YA 4C1FA 5ACVA 1YCHA 1YCFA 1M2XA 2I7TA 5AXRA 4F6ZA 5KIKA 1ZKPA 1VGNA 2FK6A 3PG4A 3VPEA 1X8HA 3P2UA 2DKFA 1BVTA 3AF6A 1E5DA 2CBNA 2GFJA 3SBLA 5AHOA 4U4LA 4WD6A 3DHBA 5A0TA 2YNWA 5FQAA 3L6NA 1KO2A 4TYTA 2AZ4A 2BG2A 3DHCA 4NQ6A 4NQ2A 5LCAA 4UWRB 4ZNBA 1DXKA 4AX1B 1WW1A 4C1GA 4J5HA 2P97A 3BK2A 3DH8A 4FSBA 4EFZA 2Y8AA 2GKLA 4XUKA 4GCWA 1WRAA 3SRXA 2BFZA 2A7MA 4AWYB 5ACRA 5AXOA 2YZ3A 2BG7A 4Z60A 2OHHA 2BTNA 5EVKA 2ZNBA 5K4NA 4HKYA 4CHLA 5K0WA 4V0HA 4KEPA 4RL2A 4RAMA 5LS3A 2DOOA 4LE6A 4XWTA 4ZO2A 2M5CA 2M5DA 3T3OA 4BP0A 5A0VA 3F9OA 3T9MA 5DPXA 3SD9A 5ACQA 2P18A 5B15A 4TYFA 2Y8BA 5LCHA 2QJSA 4PVTA 4YSKA 5AEBA 2YNTA 5HH5A 4EXYA 2NYPA 4FEKA 5FQBA 2QINA 1WUOA 1XTOA 4D1VA 5ACTA 3I14A 4C1CA 5EWAA 4FR7A 3IEKA 4GYUA 5HH6A 4Z5YA 3RPCA 2NXAA 3RKKA 3ZR9A 2BFZB 5LM6A 1HLKA 4YSBA 5HIQA 3X2XA 5HISA 3IE2A 1A8TA 1VMEA 2QDSA 1MQOA 3H3EA 4XWWA 4C09A 4C1EA 5ACXA 1JJTA 2BR6A 1K07A 4Z5ZA 5LLDA 5K4KA 5HH4A 2HB9A 3IDZA 2AIOA 2BG8A 2FU9A 2WYLA 5A87A 4YSLA 3Q6VA 3PY6A 3TP9A 1WUPA 2BIBA 3WXCA 3MD7A 4TZBA 1KO3A 2OHJA 1JJEA 3I15A 4BZ3A 2YNTB 5ACUA 1P9EA 2E7YA 3X2YA 4UA4A 5AYAA 4EXSA 5FQCA 3ESHA 2BFKA 5B3RA 5K4MA 3FAIA 5HIOA 2FU8A 5LMCA 2FHXB 1X8GA 2Q42A 3BK1A 3BV6A 4EYFA 5EVBA 3I11A 3IELA 4HL2A 2ZWRA 3AF5A 5ACSA 1YCGA 2Q0JA 4P62A 2BG6A 2GFKA 3DHAA 1SMLA 2H6AA 4C1HA 4TZ9A 3ZNBA 4Z6XA 2Q0IA 5KILA 3VQZA 3LVZA 2FHXA 3BC2A 2FU6A 4EYLA 3T3NA 1DDKA 4UWPB 4D1WA 2XR1A 4UAMA 4RM5A 5EV8A 3SFPA 4ZO3A 2I7VA 4TZEA 3SW3A 2BG8B 3KNSA 3RKJA 3QH8A 3I13A 5AHRA 5HIPA 5A5ZA 5ACWA 5EW0A 2WYMA 3I0VA 2BGAA 4AX0B 4NQ4A 1ZNBA 2BMIA 5LCFA 1KR3A 2FU7A 3IEMA 4RAWA 2XF4A 3G1PA 3KL7A 4UWOB 2ZO4A 4NQ5A 2GMNA 4GYQA 3X2ZA 3IE0A 4F6HA 4HL1A 3IOGA 4ZEJA 2GCUA 4RL0A 4KEQA 4JO0A 2NZFA 2R2DA 1JT1A 2I7XA 3ZQ4A 1VJNA 3X30A 2Y87A 3AJ3A 2UYXA 2WYMC 2QDTA 3PY5A 1DD6A 5ACPA 4AD9A 4AWZA 3IE1A 2ZZIA 2YNUA 4D02A 4C1DA 4B87A
chains in the Genus database with same CATH superfamily
5EV6A 4EY2A 1ZTCA 2WHGA 1Y44A 5B1UA 4Z67A 4EYBA 1A7TA 4TZFA 4UBQA 3ADRA 5EVDA 5LSCA 4O98A 3IOFA 3A4YA 1QH3A 2VW8A 2Q9UA 4J5FA 2BFLA 4DIKA 1QH5A 2YNVB 3JXPA 2FM6A 5IQKA 4PVOA 3FCZA 1BMCA 2BC2A 2WRSA 4D1TA 4UWSB 2OHIA 4RBSA 2P1EA 3KNRA 5LE1A 2NZEA 1XM8A 5EHTA 1X8IA 2CFUA 2CG3A 2YCBA 3SPUA 4Z7RA 2YNVA 4H0DA 1BC2A 2QEDA 3R2UA 5EH9A 3ZWFA 4D1UA 2P4ZA 3S0ZA 4DILA 1L9YA 4C1FA 5ACVA 1YCHA 1YCFA 1M2XA 2I7TA 5AXRA 4F6ZA 5KIKA 1ZKPA 1VGNA 2FK6A 3PG4A 3VPEA 1X8HA 3P2UA 2DKFA 1BVTA 3AF6A 1E5DA 2CBNA 2GFJA 3SBLA 5AHOA 4U4LA 4WD6A 3DHBA 5A0TA 2YNWA 5FQAA 3L6NA 1KO2A 4TYTA 2AZ4A 2BG2A 3DHCA 4NQ6A 4NQ2A 5LCAA 4UWRB 4ZNBA 1DXKA 4AX1B 1WW1A 4C1GA 4J5HA 2P97A 3BK2A 3DH8A 4FSBA 4EFZA 2Y8AA 2GKLA 4XUKA 4GCWA 1WRAA 3SRXA 2BFZA 2A7MA 4AWYB 5ACRA 5AXOA 2YZ3A 2BG7A 4Z60A 2OHHA 2BTNA 5EVKA 2ZNBA 5K4NA 4HKYA 4CHLA 5K0WA 4V0HA 2CFZA 4KEPA 4RL2A 4RAMA 5LS3A 2DOOA 4LE6A 4XWTA 4ZO2A 2M5CA 2M5DA 3T3OA 4BP0A 5A0VA 3F9OA 3T9MA 5DPXA 3SD9A 5ACQA 2P18A 5B15A 4TYFA 2Y8BA 5LCHA 2QJSA 4PVTA 4YSKA 5AIJA 5AEBA 2YNTA 5HH5A 4EXYA 2NYPA 4FEKA 5FQBA 2QINA 1WUOA 1XTOA 4D1VA 5ACTA 3I14A 4C1CA 5EWAA 4FR7A 3IEKA 4GYUA 4AXHA 5HH6A 4Z5YA 3RPCA 2NXAA 3RKKA 3ZR9A 2BFZB 5LM6A 1HLKA 4YSBA 5HIQA 3X2XA 5HISA 3IE2A 1A8TA 1VMEA 2QDSA 1MQOA 3H3EA 4XWWA 4C09A 4C1EA 5ACXA 1JJTA 2BR6A 1K07A 4Z5ZA 5LLDA 5K4KA 5HH4A 4AV7A 2HB9A 3IDZA 2AIOA 2BG8A 2FU9A 2WYLA 5A87A 4YSLA 3Q6VA 3PY6A 3TP9A 1WUPA 2BIBA 3WXCA 3MD7A 4TZBA 1KO3A 2OHJA 1JJEA 3I15A 4BZ3A 2YNTB 4PDXA 5ACUA 1P9EA 2E7YA 3X2YA 4UA4A 5AYAA 4EXSA 5FQCA 3ESHA 2YHEA 2BFKA 5B3RA 5K4MA 3FAIA 5HIOA 2FU8A 5LMCA 2FHXB 1X8GA 2Q42A 3BK1A 3BV6A 4EYFA 5EVBA 3I11A 3IELA 4HL2A 2ZWRA 3AF5A 5ACSA 1YCGA 2Q0JA 4P62A 2BG6A 2GFKA 3DHAA 1SMLA 2H6AA 4C1HA 4TZ9A 3ZNBA 4Z6XA 2Q0IA 5KILA 3VQZA 3LVZA 2FHXA 3BC2A 2FU6A 4EYLA 3T3NA 1DDKA 4UWPB 4D1WA 2XR1A 4UAMA 4RM5A 5EV8A 3SFPA 4ZO3A 2I7VA 4TZEA 3SW3A 2BG8B 3KNSA 3RKJA 3QH8A 3I13A 5AHRA 5HIPA 5A5ZA 5ACWA 5EW0A 2WYMA 3I0VA 2BGAA 4AX0B 4NQ4A 1ZNBA 2BMIA 5LCFA 1KR3A 2FU7A 3IEMA 4RAWA 2XF4A 3G1PA 3KL7A 4UWOB 2ZO4A 4NQ5A 2GMNA 4GYQA 3X2ZA 3IE0A 4F6HA 4HL1A 3IOGA 4ZEJA 2GCUA 4RL0A 4KEQA 4JO0A 2NZFA 2R2DA 1JT1A 2I7XA 4NURA 3ZQ4A 1VJNA 3X30A 2Y87A 3AJ3A 2UYXA 2WYMC 2QDTA 3PY5A 1DD6A 5ACPA 4AD9A 5A23A 4AWZA 2CG2A 3IE1A 2ZZIA 2YNUA 4D02A 4C1DA 4B87A 5AJLA
chains in the Genus database with same CATH topology
5EV6A 4EY2A 1ZTCA 2WHGA 1Y44A 5B1UA 4Z67A 4EYBA 1A7TA 4TZFA 4UBQA 3ADRA 5EVDA 5LSCA 4O98A 3IOFA 3A4YA 1QH3A 2VW8A 2Q9UA 4J5FA 2BFLA 4DIKA 1QH5A 2YNVB 3JXPA 2FM6A 5IQKA 4PVOA 3FCZA 1BMCA 2BC2A 2WRSA 4D1TA 4UWSB 2OHIA 4RBSA 2P1EA 3KNRA 5LE1A 2NZEA 1XM8A 5EHTA 1X8IA 2YCBA 3SPUA 4Z7RA 2YNVA 4H0DA 1BC2A 2QEDA 3R2UA 5EH9A 3ZWFA 4D1UA 2P4ZA 3S0ZA 4DILA 1L9YA 4C1FA 5ACVA 1YCHA 1YCFA 1M2XA 2I7TA 5AXRA 4F6ZA 5KIKA 1ZKPA 1VGNA 2FK6A 3PG4A 3VPEA 1X8HA 3P2UA 2DKFA 1BVTA 3AF6A 1E5DA 2CBNA 2GFJA 3SBLA 5AHOA 4U4LA 4WD6A 3DHBA 5A0TA 2YNWA 5FQAA 3L6NA 1KO2A 4TYTA 2AZ4A 2BG2A 3DHCA 4NQ6A 4NQ2A 5LCAA 4UWRB 4ZNBA 1DXKA 4AX1B 1WW1A 4C1GA 4J5HA 2P97A 3BK2A 3DH8A 4FSBA 4EFZA 2Y8AA 2GKLA 4XUKA 4GCWA 1WRAA 3SRXA 2BFZA 2A7MA 4AWYB 5ACRA 5AXOA 2YZ3A 2BG7A 4Z60A 2OHHA 2BTNA 5EVKA 2ZNBA 5K4NA 4HKYA 4CHLA 5K0WA 4V0HA 4KEPA 4RL2A 4RAMA 5LS3A 2DOOA 4LE6A 4XWTA 4ZO2A 2M5CA 2M5DA 3T3OA 4BP0A 5A0VA 3F9OA 3T9MA 5DPXA 3SD9A 5ACQA 2P18A 5B15A 4TYFA 2Y8BA 5LCHA 2QJSA 4PVTA 4YSKA 5AEBA 2YNTA 5HH5A 4EXYA 2NYPA 4FEKA 5FQBA 2QINA 1WUOA 1XTOA 4D1VA 5ACTA 3I14A 4C1CA 5EWAA 4FR7A 3IEKA 4GYUA 5HH6A 4Z5YA 3RPCA 2NXAA 3RKKA 3ZR9A 2BFZB 5LM6A 1HLKA 4YSBA 5HIQA 3X2XA 5HISA 3IE2A 1A8TA 1VMEA 2QDSA 1MQOA 3H3EA 4XWWA 4C09A 4C1EA 5ACXA 1JJTA 2BR6A 1K07A 4Z5ZA 5LLDA 5K4KA 5HH4A 2HB9A 3IDZA 2AIOA 2BG8A 2FU9A 2WYLA 5A87A 4YSLA 3Q6VA 3PY6A 3TP9A 1WUPA 2BIBA 3WXCA 3MD7A 4TZBA 1KO3A 2OHJA 1JJEA 3I15A 4BZ3A 2YNTB 5ACUA 1P9EA 2E7YA 3X2YA 4UA4A 5AYAA 4EXSA 5FQCA 3ESHA 2BFKA 5B3RA 5K4MA 3FAIA 5HIOA 2FU8A 5LMCA 2FHXB 1X8GA 2Q42A 3BK1A 3BV6A 4EYFA 5EVBA 3I11A 3IELA 4HL2A 2ZWRA 3AF5A 5ACSA 1YCGA 2Q0JA 4P62A 2BG6A 2GFKA 3DHAA 1SMLA 2H6AA 4C1HA 4TZ9A 3ZNBA 4Z6XA 2Q0IA 5KILA 3VQZA 3LVZA 2FHXA 3BC2A 2FU6A 4EYLA 3T3NA 1DDKA 4UWPB 4D1WA 2XR1A 4UAMA 4RM5A 5EV8A 3SFPA 4ZO3A 2I7VA 4TZEA 3SW3A 2BG8B 3KNSA 3RKJA 3QH8A 3I13A 5AHRA 5HIPA 5A5ZA 5ACWA 5EW0A 2WYMA 3I0VA 2BGAA 4AX0B 4NQ4A 1ZNBA 2BMIA 5LCFA 1KR3A 2FU7A 3IEMA 4RAWA 2XF4A 3G1PA 3KL7A 4UWOB 2ZO4A 4NQ5A 2GMNA 4GYQA 3X2ZA 3IE0A 4F6HA 4HL1A 3IOGA 4ZEJA 2GCUA 4RL0A 4KEQA 4JO0A 2NZFA 2R2DA 1JT1A 2I7XA 3ZQ4A 1VJNA 3X30A 2Y87A 3AJ3A 2UYXA 2WYMC 2QDTA 3PY5A 1DD6A 5ACPA 4AD9A 4AWZA 3IE1A 2ZZIA 2YNUA 4D02A 4C1DA 4B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EV6 A;  4EY2 A;  1ZTC A;  2WHG A;  1Y44 A;  5B1U A;  4Z67 A;  4EYB A;  1A7T A;  4TZF A;  4UBQ A;  3ADR A;  5EVD A;  5LSC A;  4O98 A;  3IOF A;  3A4Y A;  1QH3 A;  2VW8 A;  2Q9U A;  4J5F A;  2BFL A;  4DIK A;  1QH5 A;  2YNV B;  3JXP A;  2FM6 A;  5IQK A;  4PVO A;  3FCZ A;  1BMC A;  2BC2 A;  2WRS A;  4D1T A;  4UWS B;  2OHI A;  4RBS A;  2P1E A;  3KNR A;  5LE1 A;  2NZE A;  1XM8 A;  5EHT A;  1X8I A;  2YCB A;  3SPU A;  4Z7R A;  2YNV A;  4H0D A;  1BC2 A;  2QED A;  3R2U A;  5EH9 A;  3ZWF A;  4D1U A;  2P4Z A;  3S0Z A;  4DIL A;  1L9Y A;  4C1F A;  5ACV A;  1YCH A;  1YCF A;  1M2X A;  2I7T A;  5AXR A;  4F6Z A;  5KIK A;  1ZKP A;  1VGN A;  2FK6 A;  3PG4 A;  3VPE A;  1X8H A;  3P2U A;  2DKF A;  1BVT A;  3AF6 A;  1E5D A;  2CBN A;  2GFJ A;  3SBL A;  5AHO A;  4U4L A;  4WD6 A;  3DHB A;  5A0T A;  2YNW A;  5FQA A;  3L6N A;  1KO2 A;  4TYT A;  2AZ4 A;  2BG2 A;  3DHC A;  4NQ6 A;  4NQ2 A;  5LCA A;  4UWR B;  4ZNB A;  1DXK A;  4AX1 B;  1WW1 A;  4C1G A;  4J5H A;  2P97 A;  3BK2 A;  3DH8 A;  4FSB A;  4EFZ A;  2Y8A A;  2GKL A;  4XUK A;  4GCW A;  1WRA A;  3SRX A;  2BFZ A;  2A7M A;  4AWY B;  5ACR A;  5AXO A;  2YZ3 A;  2BG7 A;  4Z60 A;  2OHH A;  2BTN A;  5EVK A;  2ZNB A;  5K4N A;  4HKY A;  4CHL A;  5K0W A;  4V0H A;  4KEP A;  4RL2 A;  4RAM A;  5LS3 A;  2DOO A;  4LE6 A;  4XWT A;  4ZO2 A;  2M5C A;  2M5D A;  3T3O A;  4BP0 A;  5A0V A;  3F9O A;  3T9M A;  5DPX A;  3SD9 A;  5ACQ A;  2P18 A;  5B15 A;  4TYF A;  2Y8B A;  5LCH A;  2QJS A;  4PVT A;  4YSK A;  5AEB A;  2YNT A;  5HH5 A;  4EXY A;  2NYP A;  4FEK A;  5FQB A;  2QIN A;  1WUO A;  1XTO A;  4D1V A;  5ACT A;  3I14 A;  4C1C A;  5EWA A;  4FR7 A;  3IEK A;  4GYU A;  5HH6 A;  4Z5Y A;  3RPC A;  2NXA A;  3RKK A;  3ZR9 A;  2BFZ B;  5LM6 A;  1HLK A;  4YSB A;  5HIQ A;  3X2X A;  5HIS A;  3IE2 A;  1A8T A;  1VME A;  2QDS A;  1MQO A;  3H3E A;  4XWW A;  4C09 A;  4C1E A;  5ACX A;  1JJT A;  2BR6 A;  1K07 A;  4Z5Z A;  5LLD A;  5K4K A;  5HH4 A;  2HB9 A;  3IDZ A;  2AIO A;  2BG8 A;  2FU9 A;  2WYL A;  5A87 A;  4YSL A;  3Q6V A;  3PY6 A;  3TP9 A;  1WUP A;  2BIB A;  3WXC A;  3MD7 A;  4TZB A;  1KO3 A;  2OHJ A;  1JJE A;  3I15 A;  4BZ3 A;  2YNT B;  5ACU A;  1P9E A;  2E7Y A;  3X2Y A;  4UA4 A;  5AYA A;  4EXS A;  5FQC A;  3ESH A;  2BFK A;  5B3R A;  5K4M A;  3FAI A;  5HIO A;  2FU8 A;  5LMC A;  2FHX B;  1X8G A;  2Q42 A;  3BK1 A;  3BV6 A;  4EYF A;  5EVB A;  3I11 A;  3IEL A;  4HL2 A;  2ZWR A;  3AF5 A;  5ACS A;  1YCG A;  2Q0J A;  4P62 A;  2BG6 A;  2GFK A;  3DHA A;  1SML A;  2H6A A;  4C1H A;  4TZ9 A;  3ZNB A;  4Z6X A;  2Q0I A;  5KIL A;  3VQZ A;  3LVZ A;  2FHX A;  3BC2 A;  2FU6 A;  4EYL A;  3T3N A;  1DDK A;  4UWP B;  4D1W A;  2XR1 A;  4UAM A;  4RM5 A;  5EV8 A;  3SFP A;  4ZO3 A;  2I7V A;  4TZE A;  3SW3 A;  2BG8 B;  3KNS A;  3RKJ A;  3QH8 A;  3I13 A;  5AHR A;  5HIP A;  5A5Z A;  5ACW A;  5EW0 A;  2WYM A;  3I0V A;  2BGA A;  4AX0 B;  4NQ4 A;  1ZNB A;  2BMI A;  5LCF A;  1KR3 A;  2FU7 A;  3IEM A;  4RAW A;  2XF4 A;  3G1P A;  3KL7 A;  4UWO B;  2ZO4 A;  4NQ5 A;  2GMN A;  4GYQ A;  3X2Z A;  3IE0 A;  4F6H A;  4HL1 A;  3IOG A;  4ZEJ A;  2GCU A;  4RL0 A;  4KEQ A;  4JO0 A;  2NZF A;  2R2D A;  1JT1 A;  2I7X A;  3ZQ4 A;  1VJN A;  3X30 A;  2Y87 A;  3AJ3 A;  2UYX A;  2WYM C;  2QDT A;  3PY5 A;  1DD6 A;  5ACP A;  4AD9 A;  4AWZ A;  3IE1 A;  2ZZI A;  2YNU A;  4D02 A;  4C1D A;  4B87 A; 
#chains in the Genus database with same CATH topology
 5EV6 A;  4EY2 A;  1ZTC A;  2WHG A;  1Y44 A;  5B1U A;  4Z67 A;  4EYB A;  1A7T A;  4TZF A;  4UBQ A;  3ADR A;  5EVD A;  5LSC A;  4O98 A;  3IOF A;  3A4Y A;  1QH3 A;  2VW8 A;  2Q9U A;  4J5F A;  2BFL A;  4DIK A;  1QH5 A;  2YNV B;  3JXP A;  2FM6 A;  5IQK A;  4PVO A;  3FCZ A;  1BMC A;  2BC2 A;  2WRS A;  4D1T A;  4UWS B;  2OHI A;  4RBS A;  2P1E A;  3KNR A;  5LE1 A;  2NZE A;  1XM8 A;  5EHT A;  1X8I A;  2CFU A;  2CG3 A;  2YCB A;  3SPU A;  4Z7R A;  2YNV A;  4H0D A;  1BC2 A;  2QED A;  3R2U A;  5EH9 A;  3ZWF A;  4D1U A;  2P4Z A;  3S0Z A;  4DIL A;  1L9Y A;  4C1F A;  5ACV A;  1YCH A;  1YCF A;  1M2X A;  2I7T A;  5AXR A;  4F6Z A;  5KIK A;  1ZKP A;  1VGN A;  2FK6 A;  3PG4 A;  3VPE A;  1X8H A;  3P2U A;  2DKF A;  1BVT A;  3AF6 A;  1E5D A;  2CBN A;  2GFJ A;  3SBL A;  5AHO A;  4U4L A;  4WD6 A;  3DHB A;  5A0T A;  2YNW A;  5FQA A;  3L6N A;  1KO2 A;  4TYT A;  2AZ4 A;  2BG2 A;  3DHC A;  4NQ6 A;  4NQ2 A;  5LCA A;  4UWR B;  4ZNB A;  1DXK A;  4AX1 B;  1WW1 A;  4C1G A;  4J5H A;  2P97 A;  3BK2 A;  3DH8 A;  4FSB A;  4EFZ A;  2Y8A A;  2GKL A;  4XUK A;  4GCW A;  1WRA A;  3SRX A;  2BFZ A;  2A7M A;  4AWY B;  5ACR A;  5AXO A;  2YZ3 A;  2BG7 A;  4Z60 A;  2OHH A;  2BTN A;  5EVK A;  2ZNB A;  5K4N A;  4HKY A;  4CHL A;  5K0W A;  4V0H A;  2CFZ A;  4KEP A;  4RL2 A;  4RAM A;  5LS3 A;  2DOO A;  4LE6 A;  4XWT A;  4ZO2 A;  2M5C A;  2M5D A;  3T3O A;  4BP0 A;  5A0V A;  3F9O A;  3T9M A;  5DPX A;  3SD9 A;  5ACQ A;  2P18 A;  5B15 A;  4TYF A;  2Y8B A;  5LCH A;  2QJS A;  4PVT A;  4YSK A;  5AIJ A;  5AEB A;  2YNT A;  5HH5 A;  4EXY A;  2NYP A;  4FEK A;  5FQB A;  2QIN A;  1WUO A;  1XTO A;  4D1V A;  5ACT A;  3I14 A;  4C1C A;  5EWA A;  4FR7 A;  3IEK A;  4GYU A;  4AXH A;  5HH6 A;  4Z5Y A;  3RPC A;  2NXA A;  3RKK A;  3ZR9 A;  2BFZ B;  5LM6 A;  1HLK A;  4YSB A;  5HIQ A;  3X2X A;  5HIS A;  3IE2 A;  1A8T A;  1VME A;  2QDS A;  1MQO A;  3H3E A;  4XWW A;  4C09 A;  4C1E A;  5ACX A;  1JJT A;  2BR6 A;  1K07 A;  4Z5Z A;  5LLD A;  5K4K A;  5HH4 A;  4AV7 A;  2HB9 A;  3IDZ A;  2AIO A;  2BG8 A;  2FU9 A;  2WYL A;  5A87 A;  4YSL A;  3Q6V A;  3PY6 A;  3TP9 A;  1WUP A;  2BIB A;  3WXC A;  3MD7 A;  4TZB A;  1KO3 A;  2OHJ A;  1JJE A;  3I15 A;  4BZ3 A;  2YNT B;  4PDX A;  5ACU A;  1P9E A;  2E7Y A;  3X2Y A;  4UA4 A;  5AYA A;  4EXS A;  5FQC A;  3ESH A;  2YHE A;  2BFK A;  5B3R A;  5K4M A;  3FAI A;  5HIO A;  2FU8 A;  5LMC A;  2FHX B;  1X8G A;  2Q42 A;  3BK1 A;  3BV6 A;  4EYF A;  5EVB A;  3I11 A;  3IEL A;  4HL2 A;  2ZWR A;  3AF5 A;  5ACS A;  1YCG A;  2Q0J A;  4P62 A;  2BG6 A;  2GFK A;  3DHA A;  1SML A;  2H6A A;  4C1H A;  4TZ9 A;  3ZNB A;  4Z6X A;  2Q0I A;  5KIL A;  3VQZ A;  3LVZ A;  2FHX A;  3BC2 A;  2FU6 A;  4EYL A;  3T3N A;  1DDK A;  4UWP B;  4D1W A;  2XR1 A;  4UAM A;  4RM5 A;  5EV8 A;  3SFP A;  4ZO3 A;  2I7V A;  4TZE A;  3SW3 A;  2BG8 B;  3KNS A;  3RKJ A;  3QH8 A;  3I13 A;  5AHR A;  5HIP A;  5A5Z A;  5ACW A;  5EW0 A;  2WYM A;  3I0V A;  2BGA A;  4AX0 B;  4NQ4 A;  1ZNB A;  2BMI A;  5LCF A;  1KR3 A;  2FU7 A;  3IEM A;  4RAW A;  2XF4 A;  3G1P A;  3KL7 A;  4UWO B;  2ZO4 A;  4NQ5 A;  2GMN A;  4GYQ A;  3X2Z A;  3IE0 A;  4F6H A;  4HL1 A;  3IOG A;  4ZEJ A;  2GCU A;  4RL0 A;  4KEQ A;  4JO0 A;  2NZF A;  2R2D A;  1JT1 A;  2I7X A;  4NUR A;  3ZQ4 A;  1VJN A;  3X30 A;  2Y87 A;  3AJ3 A;  2UYX A;  2WYM C;  2QDT A;  3PY5 A;  1DD6 A;  5ACP A;  4AD9 A;  5A23 A;  4AWZ A;  2CG2 A;  3IE1 A;  2ZZI A;  2YNU A;  4D02 A;  4C1D A;  4B87 A;  5AJL A; 
#chains in the Genus database with same CATH homology
 5EV6 A;  4EY2 A;  1ZTC A;  2WHG A;  1Y44 A;  5B1U A;  4Z67 A;  4EYB A;  1A7T A;  4TZF A;  4UBQ A;  3ADR A;  5EVD A;  5LSC A;  4O98 A;  3IOF A;  3A4Y A;  1QH3 A;  2VW8 A;  2Q9U A;  4J5F A;  2BFL A;  4DIK A;  1QH5 A;  2YNV B;  3JXP A;  2FM6 A;  5IQK A;  4PVO A;  3FCZ A;  1BMC A;  2BC2 A;  2WRS A;  4D1T A;  4UWS B;  2OHI A;  4RBS A;  2P1E A;  3KNR A;  5LE1 A;  2NZE A;  1XM8 A;  5EHT A;  1X8I A;  2YCB A;  3SPU A;  4Z7R A;  2YNV A;  4H0D A;  1BC2 A;  2QED A;  3R2U A;  5EH9 A;  3ZWF A;  4D1U A;  2P4Z A;  3S0Z A;  4DIL A;  1L9Y A;  4C1F A;  5ACV A;  1YCH A;  1YCF A;  1M2X A;  2I7T A;  5AXR A;  4F6Z A;  5KIK A;  1ZKP A;  1VGN A;  2FK6 A;  3PG4 A;  3VPE A;  1X8H A;  3P2U A;  2DKF A;  1BVT A;  3AF6 A;  1E5D A;  2CBN A;  2GFJ A;  3SBL A;  5AHO A;  4U4L A;  4WD6 A;  3DHB A;  5A0T A;  2YNW A;  5FQA A;  3L6N A;  1KO2 A;  4TYT A;  2AZ4 A;  2BG2 A;  3DHC A;  4NQ6 A;  4NQ2 A;  5LCA A;  4UWR B;  4ZNB A;  1DXK A;  4AX1 B;  1WW1 A;  4C1G A;  4J5H A;  2P97 A;  3BK2 A;  3DH8 A;  4FSB A;  4EFZ A;  2Y8A A;  2GKL A;  4XUK A;  4GCW A;  1WRA A;  3SRX A;  2BFZ A;  2A7M A;  4AWY B;  5ACR A;  5AXO A;  2YZ3 A;  2BG7 A;  4Z60 A;  2OHH A;  2BTN A;  5EVK A;  2ZNB A;  5K4N A;  4HKY A;  4CHL A;  5K0W A;  4V0H A;  4KEP A;  4RL2 A;  4RAM A;  5LS3 A;  2DOO A;  4LE6 A;  4XWT A;  4ZO2 A;  2M5C A;  2M5D A;  3T3O A;  4BP0 A;  5A0V A;  3F9O A;  3T9M A;  5DPX A;  3SD9 A;  5ACQ A;  2P18 A;  5B15 A;  4TYF A;  2Y8B A;  5LCH A;  2QJS A;  4PVT A;  4YSK A;  5AEB A;  2YNT A;  5HH5 A;  4EXY A;  2NYP A;  4FEK A;  5FQB A;  2QIN A;  1WUO A;  1XTO A;  4D1V A;  5ACT A;  3I14 A;  4C1C A;  5EWA A;  4FR7 A;  3IEK A;  4GYU A;  5HH6 A;  4Z5Y A;  3RPC A;  2NXA A;  3RKK A;  3ZR9 A;  2BFZ B;  5LM6 A;  1HLK A;  4YSB A;  5HIQ A;  3X2X A;  5HIS A;  3IE2 A;  1A8T A;  1VME A;  2QDS A;  1MQO A;  3H3E A;  4XWW A;  4C09 A;  4C1E A;  5ACX A;  1JJT A;  2BR6 A;  1K07 A;  4Z5Z A;  5LLD A;  5K4K A;  5HH4 A;  2HB9 A;  3IDZ A;  2AIO A;  2BG8 A;  2FU9 A;  2WYL A;  5A87 A;  4YSL A;  3Q6V A;  3PY6 A;  3TP9 A;  1WUP A;  2BIB A;  3WXC A;  3MD7 A;  4TZB A;  1KO3 A;  2OHJ A;  1JJE A;  3I15 A;  4BZ3 A;  2YNT B;  5ACU A;  1P9E A;  2E7Y A;  3X2Y A;  4UA4 A;  5AYA A;  4EXS A;  5FQC A;  3ESH A;  2BFK A;  5B3R A;  5K4M A;  3FAI A;  5HIO A;  2FU8 A;  5LMC A;  2FHX B;  1X8G A;  2Q42 A;  3BK1 A;  3BV6 A;  4EYF A;  5EVB A;  3I11 A;  3IEL A;  4HL2 A;  2ZWR A;  3AF5 A;  5ACS A;  1YCG A;  2Q0J A;  4P62 A;  2BG6 A;  2GFK A;  3DHA A;  1SML A;  2H6A A;  4C1H A;  4TZ9 A;  3ZNB A;  4Z6X A;  2Q0I A;  5KIL A;  3VQZ A;  3LVZ A;  2FHX A;  3BC2 A;  2FU6 A;  4EYL A;  3T3N A;  1DDK A;  4UWP B;  4D1W A;  2XR1 A;  4UAM A;  4RM5 A;  5EV8 A;  3SFP A;  4ZO3 A;  2I7V A;  4TZE A;  3SW3 A;  2BG8 B;  3KNS A;  3RKJ A;  3QH8 A;  3I13 A;  5AHR A;  5HIP A;  5A5Z A;  5ACW A;  5EW0 A;  2WYM A;  3I0V A;  2BGA A;  4AX0 B;  4NQ4 A;  1ZNB A;  2BMI A;  5LCF A;  1KR3 A;  2FU7 A;  3IEM A;  4RAW A;  2XF4 A;  3G1P A;  3KL7 A;  4UWO B;  2ZO4 A;  4NQ5 A;  2GMN A;  4GYQ A;  3X2Z A;  3IE0 A;  4F6H A;  4HL1 A;  3IOG A;  4ZEJ A;  2GCU A;  4RL0 A;  4KEQ A;  4JO0 A;  2NZF A;  2R2D A;  1JT1 A;  2I7X A;  3ZQ4 A;  1VJN A;  3X30 A;  2Y87 A;  3AJ3 A;  2UYX A;  2WYM C;  2QDT A;  3PY5 A;  1DD6 A;  5ACP A;  4AD9 A;  4AWZ A;  3IE1 A;  2ZZI A;  2YNU A;  4D02 A;  4C1D A;  4B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...