3MD7A

Crystal structure of a beta-lactamase-like protein bound to gmp from brucella melitensis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
b'SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase-like
publication title BrabA.11339.a: anomalous diffraction and ligand binding guide towards the elucidation of the function of a `putative beta-lactamase-like protein from Brucella melitensis.
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
molecule tags Hydrolase
total genus 83
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3md7A00
3PG4A 1XM8A 2A7MA 3IE0A 5FQBA 2YNWA 2NYPA 2BG2A 5B1UA 4JO0A 5AXRA 4EXYA 1JJEA 4V0HA 3JXPA 5HH4A 5LS3A 1ZKPA 5A87A 3SD9A 2YNTA 2YCBA 5ACUA 2FHXA 4AX1B 5LCAA 4UWPB 1BVTA 5ACRA 3IOFA 3ZWFA 3X2YA 2I7XA 1YCHA 3DHAA 4RBSA 5EV8A 5KIKA 2GFKA 4WD6A 5LLDA 3IEKA 4UA4A 1VGNA 3QH8A 1K07A 4TZFA 4H0DA 4D1VA 3I13A 2FU7A 4RL2A 3X30A 4AD9A 4C09A 2QEDA 4Z7RA 5HIPA 4Z6XA 2M5DA 5ACQA 5FQAA 2WHGA 4NQ2A 2Q0JA 2R2DA 2FU9A 3G1PA 4O98A 4D1UA 3ADRA 2P18A 2QJSA 2ZO4A 4Z60A 5HISA 3IELA 2P1EA 2Q0IA 3LVZA 3F9OA 4TZEA 3KNRA 5LE1A 3WXCA 4KEQA 4YSKA 2GMNA 4FR7A 1XTOA 4EY2A 3H3EA 4AWYB 4EXSA 4TZBA 5ACPA 2WYLA 4Z5ZA 2AIOA 2GFJA 2QDTA 2NZEA 3AF6A 3PY5A 1QH5A 2BIBA 2XR1A 2BG8B 1WUOA 4P62A 1X8IA 4YSLA 2Y8BA 5A5ZA 4GCWA 4AX0B 2CBNA 4EYLA 4TYTA 2BR6A 3I15A 2YNVB 3RKJA 1VJNA 3I0VA 4RAWA 3IE1A 5ACVA 5A0VA 4UBQA 4ZO2A 2BG6A 4NQ4A 4D1TA 4RL0A 5B3RA 3AF5A 2I7TA 4D02A 4GYQA 2Y8AA 4YSBA 4BZ3A 4J5HA 4ZNBA 3Q6VA 3RPCA 4AWZA 1KR3A 4LE6A 2WYMA 3BK2A 5ACWA 2FU6A 1ZNBA 3P2UA 1SMLA 2BTNA 1BC2A 2BG8A 4Z67A 5EVBA 2M5CA 2Q42A 3SPUA 1VMEA 4GYUA 4PVTA 2OHJA 5HIOA 1M2XA 1BMCA 5K4NA 2XF4A 4C1EA 1A8TA 4C1DA 1QH3A 4Z5YA 1YCGA 2YNVA 4UAMA 5AHRA 5HIQA 2BG7A 4J5FA 3L6NA 2VW8A 1X8GA 1P9EA 2BC2A 1L9YA 2E7YA 5AEBA 4C1GA 4HKYA 5LM6A 4C1FA 2YZ3A 5K0WA 5AXOA 4EFZA 2P97A 2Q9UA 4TZ9A 2AZ4A 4DIKA 1WRAA 4UWOB 5K4KA 3SFPA 3DHBA 2FK6A 3X2XA 4RM5A 5LCFA 3ZR9A 5EV6A 2QINA 4TYFA 4UWSB 4ZEJA 4XWWA 2H6AA 1YCFA 3A4YA 5B15A 1DD6A 3AJ3A 4XUKA 2OHHA 4NQ5A 5DPXA 5EVKA 4KEPA 4EYBA 3RKKA 5LSCA 3KNSA 1KO3A 3DH8A 1KO2A 1JJTA 3PY6A 3ZQ4A 5FQCA 3T9MA 3IDZA 5EVDA 3ZNBA 1X8HA 2BMIA 3T3NA 1Y44A 4U4LA 4UWRB 4B87A 4HL1A 3TP9A 2UYXA 2YNUA 2NZFA 5EH9A 3S0ZA 3T3OA 3VQZA 4FEKA 3VPEA 3SRXA 3BV6A 5LMCA 1JT1A 1DXKA 5HH6A 5ACSA 5EW0A 4EYFA 2NXAA 2FM6A 2BFKA 5ACTA 3IOGA 2QDSA 2DOOA 4HL2A 3SBLA 3IEMA 2GKLA 4C1HA 4ZO3A 2GCUA 4RAMA 3FAIA 1ZTCA 2WRSA 5IQKA 1WW1A 2HB9A 2ZZIA 4F6HA 2BFZB 3X2ZA 3BC2A 2FU8A 3I11A 5HH5A 1HLKA 1E5DA 4C1CA 4PVOA 2P4ZA 2WYMC 2OHIA 3I14A 2BGAA 4NQ6A 4D1WA 5ACXA 2BFLA 5EWAA 2I7VA 1A7TA 2ZWRA 5AYAA 1MQOA 3R2UA 2DKFA 4FSBA 2YNTB 4BP0A 1WUPA 2FHXB 4CHLA 3BK1A 4F6ZA 5LCHA 4DILA 2Y87A 3IE2A 5K4MA 2ZNBA 3KL7A 3SW3A 4XWTA 3FCZA 5KILA 5EHTA 2BFZA 3DHCA 5AHOA 1DDKA 3MD7A 3ESHA 5A0TA
chains in the Genus database with same CATH superfamily
3PG4A 1XM8A 2A7MA 3IE0A 5FQBA 2YNWA 2NYPA 2BG2A 5B1UA 4JO0A 5AXRA 4EXYA 1JJEA 4V0HA 3JXPA 5HH4A 5LS3A 1ZKPA 5A87A 3SD9A 2YNTA 2YCBA 5ACUA 2FHXA 4AX1B 5LCAA 4UWPB 1BVTA 5ACRA 3IOFA 3ZWFA 3X2YA 2I7XA 1YCHA 3DHAA 4RBSA 5EV8A 5KIKA 2GFKA 4WD6A 5LLDA 4NURA 3IEKA 4UA4A 1VGNA 3QH8A 1K07A 4TZFA 4H0DA 4D1VA 3I13A 2FU7A 4RL2A 3X30A 4AD9A 4C09A 2QEDA 4Z7RA 5HIPA 4Z6XA 2M5DA 5ACQA 5FQAA 2WHGA 4NQ2A 2Q0JA 2R2DA 2FU9A 3G1PA 4O98A 4D1UA 3ADRA 2P18A 2QJSA 2ZO4A 4Z60A 5HISA 3IELA 2CG2A 2P1EA 2Q0IA 3LVZA 3F9OA 4TZEA 3KNRA 5LE1A 3WXCA 4KEQA 4YSKA 2GMNA 4FR7A 1XTOA 4EY2A 3H3EA 4AWYB 4EXSA 4TZBA 5ACPA 2WYLA 4Z5ZA 2AIOA 2GFJA 2QDTA 2NZEA 3AF6A 3PY5A 1QH5A 2BIBA 2XR1A 4AV7A 2BG8B 1WUOA 4P62A 1X8IA 4YSLA 2Y8BA 5A5ZA 4GCWA 4AX0B 2CBNA 4EYLA 4TYTA 2BR6A 3I15A 2YNVB 3RKJA 1VJNA 3I0VA 4RAWA 3IE1A 5ACVA 5A0VA 4UBQA 4ZO2A 2BG6A 4NQ4A 4D1TA 4RL0A 5B3RA 3AF5A 2I7TA 4D02A 4GYQA 2Y8AA 4YSBA 4BZ3A 4J5HA 4ZNBA 3Q6VA 3RPCA 4AWZA 1KR3A 4LE6A 2WYMA 3BK2A 5ACWA 2FU6A 1ZNBA 4AXHA 3P2UA 1SMLA 2BTNA 1BC2A 2BG8A 4Z67A 5EVBA 2M5CA 2Q42A 3SPUA 1VMEA 4GYUA 4PVTA 2OHJA 5HIOA 1M2XA 1BMCA 5K4NA 2XF4A 4C1EA 1A8TA 4C1DA 1QH3A 4Z5YA 1YCGA 2YNVA 4UAMA 5AHRA 5HIQA 2BG7A 4J5FA 3L6NA 2VW8A 5AJLA 1X8GA 1P9EA 2BC2A 1L9YA 2E7YA 2YHEA 5AEBA 4C1GA 4HKYA 5LM6A 4C1FA 2YZ3A 5K0WA 5AXOA 4EFZA 2P97A 2Q9UA 4TZ9A 2AZ4A 4DIKA 1WRAA 4UWOB 5K4KA 3SFPA 3DHBA 2FK6A 3X2XA 4RM5A 5LCFA 3ZR9A 5EV6A 2QINA 4TYFA 4UWSB 4ZEJA 4XWWA 2H6AA 1YCFA 3A4YA 5B15A 1DD6A 3AJ3A 4XUKA 2OHHA 4NQ5A 5DPXA 5EVKA 4KEPA 4EYBA 3RKKA 5LSCA 4PDXA 3KNSA 1KO3A 3DH8A 1KO2A 2CFUA 1JJTA 3PY6A 3ZQ4A 5FQCA 3T9MA 3IDZA 5EVDA 3ZNBA 1X8HA 2BMIA 3T3NA 1Y44A 4U4LA 4UWRB 4B87A 5A23A 4HL1A 3TP9A 2UYXA 2YNUA 2NZFA 5EH9A 3S0ZA 3T3OA 3VQZA 4FEKA 3VPEA 3SRXA 3BV6A 2CFZA 5LMCA 1JT1A 1DXKA 5HH6A 5ACSA 5EW0A 4EYFA 2NXAA 2FM6A 2BFKA 5ACTA 3IOGA 2QDSA 2DOOA 4HL2A 3SBLA 3IEMA 2GKLA 4C1HA 4ZO3A 2GCUA 4RAMA 3FAIA 1ZTCA 2WRSA 5IQKA 1WW1A 2HB9A 2ZZIA 4F6HA 2BFZB 3X2ZA 3BC2A 2CG3A 2FU8A 3I11A 5HH5A 5AIJA 1HLKA 1E5DA 4C1CA 4PVOA 2P4ZA 2WYMC 2OHIA 3I14A 2BGAA 4NQ6A 4D1WA 5ACXA 2BFLA 5EWAA 2I7VA 1A7TA 2ZWRA 5AYAA 1MQOA 3R2UA 2DKFA 4FSBA 2YNTB 4BP0A 1WUPA 2FHXB 4CHLA 3BK1A 4F6ZA 5LCHA 4DILA 2Y87A 3IE2A 5K4MA 2ZNBA 3KL7A 3SW3A 4XWTA 3FCZA 5KILA 5EHTA 2BFZA 3DHCA 5AHOA 1DDKA 3MD7A 3ESHA 5A0TA
chains in the Genus database with same CATH topology
3PG4A 1XM8A 2A7MA 3IE0A 5FQBA 2YNWA 2NYPA 2BG2A 5B1UA 4JO0A 5AXRA 4EXYA 1JJEA 4V0HA 3JXPA 5HH4A 5LS3A 1ZKPA 5A87A 3SD9A 2YNTA 2YCBA 5ACUA 2FHXA 4AX1B 5LCAA 4UWPB 1BVTA 5ACRA 3IOFA 3ZWFA 3X2YA 2I7XA 1YCHA 3DHAA 4RBSA 5EV8A 5KIKA 2GFKA 4WD6A 5LLDA 3IEKA 4UA4A 1VGNA 3QH8A 1K07A 4TZFA 4H0DA 4D1VA 3I13A 2FU7A 4RL2A 3X30A 4AD9A 4C09A 2QEDA 4Z7RA 5HIPA 4Z6XA 2M5DA 5ACQA 5FQAA 2WHGA 4NQ2A 2Q0JA 2R2DA 2FU9A 3G1PA 4O98A 4D1UA 3ADRA 2P18A 2QJSA 2ZO4A 4Z60A 5HISA 3IELA 2P1EA 2Q0IA 3LVZA 3F9OA 4TZEA 3KNRA 5LE1A 3WXCA 4KEQA 4YSKA 2GMNA 4FR7A 1XTOA 4EY2A 3H3EA 4AWYB 4EXSA 4TZBA 5ACPA 2WYLA 4Z5ZA 2AIOA 2GFJA 2QDTA 2NZEA 3AF6A 3PY5A 1QH5A 2BIBA 2XR1A 2BG8B 1WUOA 4P62A 1X8IA 4YSLA 2Y8BA 5A5ZA 4GCWA 4AX0B 2CBNA 4EYLA 4TYTA 2BR6A 3I15A 2YNVB 3RKJA 1VJNA 3I0VA 4RAWA 3IE1A 5ACVA 5A0VA 4UBQA 4ZO2A 2BG6A 4NQ4A 4D1TA 4RL0A 5B3RA 3AF5A 2I7TA 4D02A 4GYQA 2Y8AA 4YSBA 4BZ3A 4J5HA 4ZNBA 3Q6VA 3RPCA 4AWZA 1KR3A 4LE6A 2WYMA 3BK2A 5ACWA 2FU6A 1ZNBA 3P2UA 1SMLA 2BTNA 1BC2A 2BG8A 4Z67A 5EVBA 2M5CA 2Q42A 3SPUA 1VMEA 4GYUA 4PVTA 2OHJA 5HIOA 1M2XA 1BMCA 5K4NA 2XF4A 4C1EA 1A8TA 4C1DA 1QH3A 4Z5YA 1YCGA 2YNVA 4UAMA 5AHRA 5HIQA 2BG7A 4J5FA 3L6NA 2VW8A 1X8GA 1P9EA 2BC2A 1L9YA 2E7YA 5AEBA 4C1GA 4HKYA 5LM6A 4C1FA 2YZ3A 5K0WA 5AXOA 4EFZA 2P97A 2Q9UA 4TZ9A 2AZ4A 4DIKA 1WRAA 4UWOB 5K4KA 3SFPA 3DHBA 2FK6A 3X2XA 4RM5A 5LCFA 3ZR9A 5EV6A 2QINA 4TYFA 4UWSB 4ZEJA 4XWWA 2H6AA 1YCFA 3A4YA 5B15A 1DD6A 3AJ3A 4XUKA 2OHHA 4NQ5A 5DPXA 5EVKA 4KEPA 4EYBA 3RKKA 5LSCA 3KNSA 1KO3A 3DH8A 1KO2A 1JJTA 3PY6A 3ZQ4A 5FQCA 3T9MA 3IDZA 5EVDA 3ZNBA 1X8HA 2BMIA 3T3NA 1Y44A 4U4LA 4UWRB 4B87A 4HL1A 3TP9A 2UYXA 2YNUA 2NZFA 5EH9A 3S0ZA 3T3OA 3VQZA 4FEKA 3VPEA 3SRXA 3BV6A 5LMCA 1JT1A 1DXKA 5HH6A 5ACSA 5EW0A 4EYFA 2NXAA 2FM6A 2BFKA 5ACTA 3IOGA 2QDSA 2DOOA 4HL2A 3SBLA 3IEMA 2GKLA 4C1HA 4ZO3A 2GCUA 4RAMA 3FAIA 1ZTCA 2WRSA 5IQKA 1WW1A 2HB9A 2ZZIA 4F6HA 2BFZB 3X2ZA 3BC2A 2FU8A 3I11A 5HH5A 1HLKA 1E5DA 4C1CA 4PVOA 2P4ZA 2WYMC 2OHIA 3I14A 2BGAA 4NQ6A 4D1WA 5ACXA 2BFLA 5EWAA 2I7VA 1A7TA 2ZWRA 5AYAA 1MQOA 3R2UA 2DKFA 4FSBA 2YNTB 4BP0A 1WUPA 2FHXB 4CHLA 3BK1A 4F6ZA 5LCHA 4DILA 2Y87A 3IE2A 5K4MA 2ZNBA 3KL7A 3SW3A 4XWTA 3FCZA 5KILA 5EHTA 2BFZA 3DHCA 5AHOA 1DDKA 3MD7A 3ESHA 5A0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PG4 A;  1XM8 A;  2A7M A;  3IE0 A;  5FQB A;  2YNW A;  2NYP A;  2BG2 A;  5B1U A;  4JO0 A;  5AXR A;  4EXY A;  1JJE A;  4V0H A;  3JXP A;  5HH4 A;  5LS3 A;  1ZKP A;  5A87 A;  3SD9 A;  2YNT A;  2YCB A;  5ACU A;  2FHX A;  4AX1 B;  5LCA A;  4UWP B;  1BVT A;  5ACR A;  3IOF A;  3ZWF A;  3X2Y A;  2I7X A;  1YCH A;  3DHA A;  4RBS A;  5EV8 A;  5KIK A;  2GFK A;  4WD6 A;  5LLD A;  3IEK A;  4UA4 A;  1VGN A;  3QH8 A;  1K07 A;  4TZF A;  4H0D A;  4D1V A;  3I13 A;  2FU7 A;  4RL2 A;  3X30 A;  4AD9 A;  4C09 A;  2QED A;  4Z7R A;  5HIP A;  4Z6X A;  2M5D A;  5ACQ A;  5FQA A;  2WHG A;  4NQ2 A;  2Q0J A;  2R2D A;  2FU9 A;  3G1P A;  4O98 A;  4D1U A;  3ADR A;  2P18 A;  2QJS A;  2ZO4 A;  4Z60 A;  5HIS A;  3IEL A;  2P1E A;  2Q0I A;  3LVZ A;  3F9O A;  4TZE A;  3KNR A;  5LE1 A;  3WXC A;  4KEQ A;  4YSK A;  2GMN A;  4FR7 A;  1XTO A;  4EY2 A;  3H3E A;  4AWY B;  4EXS A;  4TZB A;  5ACP A;  2WYL A;  4Z5Z A;  2AIO A;  2GFJ A;  2QDT A;  2NZE A;  3AF6 A;  3PY5 A;  1QH5 A;  2BIB A;  2XR1 A;  2BG8 B;  1WUO A;  4P62 A;  1X8I A;  4YSL A;  2Y8B A;  5A5Z A;  4GCW A;  4AX0 B;  2CBN A;  4EYL A;  4TYT A;  2BR6 A;  3I15 A;  2YNV B;  3RKJ A;  1VJN A;  3I0V A;  4RAW A;  3IE1 A;  5ACV A;  5A0V A;  4UBQ A;  4ZO2 A;  2BG6 A;  4NQ4 A;  4D1T A;  4RL0 A;  5B3R A;  3AF5 A;  2I7T A;  4D02 A;  4GYQ A;  2Y8A A;  4YSB A;  4BZ3 A;  4J5H A;  4ZNB A;  3Q6V A;  3RPC A;  4AWZ A;  1KR3 A;  4LE6 A;  2WYM A;  3BK2 A;  5ACW A;  2FU6 A;  1ZNB A;  3P2U A;  1SML A;  2BTN A;  1BC2 A;  2BG8 A;  4Z67 A;  5EVB A;  2M5C A;  2Q42 A;  3SPU A;  1VME A;  4GYU A;  4PVT A;  2OHJ A;  5HIO A;  1M2X A;  1BMC A;  5K4N A;  2XF4 A;  4C1E A;  1A8T A;  4C1D A;  1QH3 A;  4Z5Y A;  1YCG A;  2YNV A;  4UAM A;  5AHR A;  5HIQ A;  2BG7 A;  4J5F A;  3L6N A;  2VW8 A;  1X8G A;  1P9E A;  2BC2 A;  1L9Y A;  2E7Y A;  5AEB A;  4C1G A;  4HKY A;  5LM6 A;  4C1F A;  2YZ3 A;  5K0W A;  5AXO A;  4EFZ A;  2P97 A;  2Q9U A;  4TZ9 A;  2AZ4 A;  4DIK A;  1WRA A;  4UWO B;  5K4K A;  3SFP A;  3DHB A;  2FK6 A;  3X2X A;  4RM5 A;  5LCF A;  3ZR9 A;  5EV6 A;  2QIN A;  4TYF A;  4UWS B;  4ZEJ A;  4XWW A;  2H6A A;  1YCF A;  3A4Y A;  5B15 A;  1DD6 A;  3AJ3 A;  4XUK A;  2OHH A;  4NQ5 A;  5DPX A;  5EVK A;  4KEP A;  4EYB A;  3RKK A;  5LSC A;  3KNS A;  1KO3 A;  3DH8 A;  1KO2 A;  1JJT A;  3PY6 A;  3ZQ4 A;  5FQC A;  3T9M A;  3IDZ A;  5EVD A;  3ZNB A;  1X8H A;  2BMI A;  3T3N A;  1Y44 A;  4U4L A;  4UWR B;  4B87 A;  4HL1 A;  3TP9 A;  2UYX A;  2YNU A;  2NZF A;  5EH9 A;  3S0Z A;  3T3O A;  3VQZ A;  4FEK A;  3VPE A;  3SRX A;  3BV6 A;  5LMC A;  1JT1 A;  1DXK A;  5HH6 A;  5ACS A;  5EW0 A;  4EYF A;  2NXA A;  2FM6 A;  2BFK A;  5ACT A;  3IOG A;  2QDS A;  2DOO A;  4HL2 A;  3SBL A;  3IEM A;  2GKL A;  4C1H A;  4ZO3 A;  2GCU A;  4RAM A;  3FAI A;  1ZTC A;  2WRS A;  5IQK A;  1WW1 A;  2HB9 A;  2ZZI A;  4F6H A;  2BFZ B;  3X2Z A;  3BC2 A;  2FU8 A;  3I11 A;  5HH5 A;  1HLK A;  1E5D A;  4C1C A;  4PVO A;  2P4Z A;  2WYM C;  2OHI A;  3I14 A;  2BGA A;  4NQ6 A;  4D1W A;  5ACX A;  2BFL A;  5EWA A;  2I7V A;  1A7T A;  2ZWR A;  5AYA A;  1MQO A;  3R2U A;  2DKF A;  4FSB A;  2YNT B;  4BP0 A;  1WUP A;  2FHX B;  4CHL A;  3BK1 A;  4F6Z A;  5LCH A;  4DIL A;  2Y87 A;  3IE2 A;  5K4M A;  2ZNB A;  3KL7 A;  3SW3 A;  4XWT A;  3FCZ A;  5KIL A;  5EHT A;  2BFZ A;  3DHC A;  5AHO A;  1DDK A;  3MD7 A;  3ESH A;  5A0T A; 
#chains in the Genus database with same CATH topology
 3PG4 A;  1XM8 A;  2A7M A;  3IE0 A;  5FQB A;  2YNW A;  2NYP A;  2BG2 A;  5B1U A;  4JO0 A;  5AXR A;  4EXY A;  1JJE A;  4V0H A;  3JXP A;  5HH4 A;  5LS3 A;  1ZKP A;  5A87 A;  3SD9 A;  2YNT A;  2YCB A;  5ACU A;  2FHX A;  4AX1 B;  5LCA A;  4UWP B;  1BVT A;  5ACR A;  3IOF A;  3ZWF A;  3X2Y A;  2I7X A;  1YCH A;  3DHA A;  4RBS A;  5EV8 A;  5KIK A;  2GFK A;  4WD6 A;  5LLD A;  4NUR A;  3IEK A;  4UA4 A;  1VGN A;  3QH8 A;  1K07 A;  4TZF A;  4H0D A;  4D1V A;  3I13 A;  2FU7 A;  4RL2 A;  3X30 A;  4AD9 A;  4C09 A;  2QED A;  4Z7R A;  5HIP A;  4Z6X A;  2M5D A;  5ACQ A;  5FQA A;  2WHG A;  4NQ2 A;  2Q0J A;  2R2D A;  2FU9 A;  3G1P A;  4O98 A;  4D1U A;  3ADR A;  2P18 A;  2QJS A;  2ZO4 A;  4Z60 A;  5HIS A;  3IEL A;  2CG2 A;  2P1E A;  2Q0I A;  3LVZ A;  3F9O A;  4TZE A;  3KNR A;  5LE1 A;  3WXC A;  4KEQ A;  4YSK A;  2GMN A;  4FR7 A;  1XTO A;  4EY2 A;  3H3E A;  4AWY B;  4EXS A;  4TZB A;  5ACP A;  2WYL A;  4Z5Z A;  2AIO A;  2GFJ A;  2QDT A;  2NZE A;  3AF6 A;  3PY5 A;  1QH5 A;  2BIB A;  2XR1 A;  4AV7 A;  2BG8 B;  1WUO A;  4P62 A;  1X8I A;  4YSL A;  2Y8B A;  5A5Z A;  4GCW A;  4AX0 B;  2CBN A;  4EYL A;  4TYT A;  2BR6 A;  3I15 A;  2YNV B;  3RKJ A;  1VJN A;  3I0V A;  4RAW A;  3IE1 A;  5ACV A;  5A0V A;  4UBQ A;  4ZO2 A;  2BG6 A;  4NQ4 A;  4D1T A;  4RL0 A;  5B3R A;  3AF5 A;  2I7T A;  4D02 A;  4GYQ A;  2Y8A A;  4YSB A;  4BZ3 A;  4J5H A;  4ZNB A;  3Q6V A;  3RPC A;  4AWZ A;  1KR3 A;  4LE6 A;  2WYM A;  3BK2 A;  5ACW A;  2FU6 A;  1ZNB A;  4AXH A;  3P2U A;  1SML A;  2BTN A;  1BC2 A;  2BG8 A;  4Z67 A;  5EVB A;  2M5C A;  2Q42 A;  3SPU A;  1VME A;  4GYU A;  4PVT A;  2OHJ A;  5HIO A;  1M2X A;  1BMC A;  5K4N A;  2XF4 A;  4C1E A;  1A8T A;  4C1D A;  1QH3 A;  4Z5Y A;  1YCG A;  2YNV A;  4UAM A;  5AHR A;  5HIQ A;  2BG7 A;  4J5F A;  3L6N A;  2VW8 A;  5AJL A;  1X8G A;  1P9E A;  2BC2 A;  1L9Y A;  2E7Y A;  2YHE A;  5AEB A;  4C1G A;  4HKY A;  5LM6 A;  4C1F A;  2YZ3 A;  5K0W A;  5AXO A;  4EFZ A;  2P97 A;  2Q9U A;  4TZ9 A;  2AZ4 A;  4DIK A;  1WRA A;  4UWO B;  5K4K A;  3SFP A;  3DHB A;  2FK6 A;  3X2X A;  4RM5 A;  5LCF A;  3ZR9 A;  5EV6 A;  2QIN A;  4TYF A;  4UWS B;  4ZEJ A;  4XWW A;  2H6A A;  1YCF A;  3A4Y A;  5B15 A;  1DD6 A;  3AJ3 A;  4XUK A;  2OHH A;  4NQ5 A;  5DPX A;  5EVK A;  4KEP A;  4EYB A;  3RKK A;  5LSC A;  4PDX A;  3KNS A;  1KO3 A;  3DH8 A;  1KO2 A;  2CFU A;  1JJT A;  3PY6 A;  3ZQ4 A;  5FQC A;  3T9M A;  3IDZ A;  5EVD A;  3ZNB A;  1X8H A;  2BMI A;  3T3N A;  1Y44 A;  4U4L A;  4UWR B;  4B87 A;  5A23 A;  4HL1 A;  3TP9 A;  2UYX A;  2YNU A;  2NZF A;  5EH9 A;  3S0Z A;  3T3O A;  3VQZ A;  4FEK A;  3VPE A;  3SRX A;  3BV6 A;  2CFZ A;  5LMC A;  1JT1 A;  1DXK A;  5HH6 A;  5ACS A;  5EW0 A;  4EYF A;  2NXA A;  2FM6 A;  2BFK A;  5ACT A;  3IOG A;  2QDS A;  2DOO A;  4HL2 A;  3SBL A;  3IEM A;  2GKL A;  4C1H A;  4ZO3 A;  2GCU A;  4RAM A;  3FAI A;  1ZTC A;  2WRS A;  5IQK A;  1WW1 A;  2HB9 A;  2ZZI A;  4F6H A;  2BFZ B;  3X2Z A;  3BC2 A;  2CG3 A;  2FU8 A;  3I11 A;  5HH5 A;  5AIJ A;  1HLK A;  1E5D A;  4C1C A;  4PVO A;  2P4Z A;  2WYM C;  2OHI A;  3I14 A;  2BGA A;  4NQ6 A;  4D1W A;  5ACX A;  2BFL A;  5EWA A;  2I7V A;  1A7T A;  2ZWR A;  5AYA A;  1MQO A;  3R2U A;  2DKF A;  4FSB A;  2YNT B;  4BP0 A;  1WUP A;  2FHX B;  4CHL A;  3BK1 A;  4F6Z A;  5LCH A;  4DIL A;  2Y87 A;  3IE2 A;  5K4M A;  2ZNB A;  3KL7 A;  3SW3 A;  4XWT A;  3FCZ A;  5KIL A;  5EHT A;  2BFZ A;  3DHC A;  5AHO A;  1DDK A;  3MD7 A;  3ESH A;  5A0T A; 
#chains in the Genus database with same CATH homology
 3PG4 A;  1XM8 A;  2A7M A;  3IE0 A;  5FQB A;  2YNW A;  2NYP A;  2BG2 A;  5B1U A;  4JO0 A;  5AXR A;  4EXY A;  1JJE A;  4V0H A;  3JXP A;  5HH4 A;  5LS3 A;  1ZKP A;  5A87 A;  3SD9 A;  2YNT A;  2YCB A;  5ACU A;  2FHX A;  4AX1 B;  5LCA A;  4UWP B;  1BVT A;  5ACR A;  3IOF A;  3ZWF A;  3X2Y A;  2I7X A;  1YCH A;  3DHA A;  4RBS A;  5EV8 A;  5KIK A;  2GFK A;  4WD6 A;  5LLD A;  3IEK A;  4UA4 A;  1VGN A;  3QH8 A;  1K07 A;  4TZF A;  4H0D A;  4D1V A;  3I13 A;  2FU7 A;  4RL2 A;  3X30 A;  4AD9 A;  4C09 A;  2QED A;  4Z7R A;  5HIP A;  4Z6X A;  2M5D A;  5ACQ A;  5FQA A;  2WHG A;  4NQ2 A;  2Q0J A;  2R2D A;  2FU9 A;  3G1P A;  4O98 A;  4D1U A;  3ADR A;  2P18 A;  2QJS A;  2ZO4 A;  4Z60 A;  5HIS A;  3IEL A;  2P1E A;  2Q0I A;  3LVZ A;  3F9O A;  4TZE A;  3KNR A;  5LE1 A;  3WXC A;  4KEQ A;  4YSK A;  2GMN A;  4FR7 A;  1XTO A;  4EY2 A;  3H3E A;  4AWY B;  4EXS A;  4TZB A;  5ACP A;  2WYL A;  4Z5Z A;  2AIO A;  2GFJ A;  2QDT A;  2NZE A;  3AF6 A;  3PY5 A;  1QH5 A;  2BIB A;  2XR1 A;  2BG8 B;  1WUO A;  4P62 A;  1X8I A;  4YSL A;  2Y8B A;  5A5Z A;  4GCW A;  4AX0 B;  2CBN A;  4EYL A;  4TYT A;  2BR6 A;  3I15 A;  2YNV B;  3RKJ A;  1VJN A;  3I0V A;  4RAW A;  3IE1 A;  5ACV A;  5A0V A;  4UBQ A;  4ZO2 A;  2BG6 A;  4NQ4 A;  4D1T A;  4RL0 A;  5B3R A;  3AF5 A;  2I7T A;  4D02 A;  4GYQ A;  2Y8A A;  4YSB A;  4BZ3 A;  4J5H A;  4ZNB A;  3Q6V A;  3RPC A;  4AWZ A;  1KR3 A;  4LE6 A;  2WYM A;  3BK2 A;  5ACW A;  2FU6 A;  1ZNB A;  3P2U A;  1SML A;  2BTN A;  1BC2 A;  2BG8 A;  4Z67 A;  5EVB A;  2M5C A;  2Q42 A;  3SPU A;  1VME A;  4GYU A;  4PVT A;  2OHJ A;  5HIO A;  1M2X A;  1BMC A;  5K4N A;  2XF4 A;  4C1E A;  1A8T A;  4C1D A;  1QH3 A;  4Z5Y A;  1YCG A;  2YNV A;  4UAM A;  5AHR A;  5HIQ A;  2BG7 A;  4J5F A;  3L6N A;  2VW8 A;  1X8G A;  1P9E A;  2BC2 A;  1L9Y A;  2E7Y A;  5AEB A;  4C1G A;  4HKY A;  5LM6 A;  4C1F A;  2YZ3 A;  5K0W A;  5AXO A;  4EFZ A;  2P97 A;  2Q9U A;  4TZ9 A;  2AZ4 A;  4DIK A;  1WRA A;  4UWO B;  5K4K A;  3SFP A;  3DHB A;  2FK6 A;  3X2X A;  4RM5 A;  5LCF A;  3ZR9 A;  5EV6 A;  2QIN A;  4TYF A;  4UWS B;  4ZEJ A;  4XWW A;  2H6A A;  1YCF A;  3A4Y A;  5B15 A;  1DD6 A;  3AJ3 A;  4XUK A;  2OHH A;  4NQ5 A;  5DPX A;  5EVK A;  4KEP A;  4EYB A;  3RKK A;  5LSC A;  3KNS A;  1KO3 A;  3DH8 A;  1KO2 A;  1JJT A;  3PY6 A;  3ZQ4 A;  5FQC A;  3T9M A;  3IDZ A;  5EVD A;  3ZNB A;  1X8H A;  2BMI A;  3T3N A;  1Y44 A;  4U4L A;  4UWR B;  4B87 A;  4HL1 A;  3TP9 A;  2UYX A;  2YNU A;  2NZF A;  5EH9 A;  3S0Z A;  3T3O A;  3VQZ A;  4FEK A;  3VPE A;  3SRX A;  3BV6 A;  5LMC A;  1JT1 A;  1DXK A;  5HH6 A;  5ACS A;  5EW0 A;  4EYF A;  2NXA A;  2FM6 A;  2BFK A;  5ACT A;  3IOG A;  2QDS A;  2DOO A;  4HL2 A;  3SBL A;  3IEM A;  2GKL A;  4C1H A;  4ZO3 A;  2GCU A;  4RAM A;  3FAI A;  1ZTC A;  2WRS A;  5IQK A;  1WW1 A;  2HB9 A;  2ZZI A;  4F6H A;  2BFZ B;  3X2Z A;  3BC2 A;  2FU8 A;  3I11 A;  5HH5 A;  1HLK A;  1E5D A;  4C1C A;  4PVO A;  2P4Z A;  2WYM C;  2OHI A;  3I14 A;  2BGA A;  4NQ6 A;  4D1W A;  5ACX A;  2BFL A;  5EWA A;  2I7V A;  1A7T A;  2ZWR A;  5AYA A;  1MQO A;  3R2U A;  2DKF A;  4FSB A;  2YNT B;  4BP0 A;  1WUP A;  2FHX B;  4CHL A;  3BK1 A;  4F6Z A;  5LCH A;  4DIL A;  2Y87 A;  3IE2 A;  5K4M A;  2ZNB A;  3KL7 A;  3SW3 A;  4XWT A;  3FCZ A;  5KIL A;  5EHT A;  2BFZ A;  3DHC A;  5AHO A;  1DDK A;  3MD7 A;  3ESH A;  5A0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...