3MD7A

Crystal structure of a beta-lactamase-like protein bound to gmp from brucella melitensis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase-like
publication title BrabA.11339.a: anomalous diffraction and ligand binding guide towards the elucidation of the function of a `putative beta-lactamase-like protein from Brucella melitensis.
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
total genus 83
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3md7A00
1XM8A 4D1WA 4EYFA 2BG2A 5FQCA 4GYUA 5IQKA 4Z60A 3IEKA 5LCFA 3DHCA 1E5DA 3X30A 2YNWA 4RAMA 5HH5A 2NXAA 3MD7A 2VW8A 5ACUA 2GMNA 3X2ZA 3IEMA 2WRSA 4V0HA 5K4KA 1X8GA 5LMCA 3I15A 3ZR9A 3T3OA 5A0TA 3L6NA 2QJSA 2GKLA 2FU8A 5HH6A 3RKKA 4B87A 1YCHA 2BG8B 2QDSA 4RM5A 4RL2A 4NQ6A 3PG4A 3X2YA 4P62A 5EVKA 4D02A 5ACRA 4NQ5A 4RL0A 4TYTA 2DKFA 3PY6A 4PVTA 4KEQA 5LM6A 5AXRA 2I7VA 2BTNA 3BK2A 4EY2A 2QEDA 4XWWA 4AX1B 5A87A 1XTOA 3G1PA 3AF5A 3IOFA 1ZTCA 3P2UA 3SW3A 3IOGA 2BC2A 4BZ3A 2BG8A 3ZQ4A 2FU6A 3DHAA 5LSCA 2AIOA 4C1HA 1DXKA 5EVBA 4HL1A 3ZNBA 3AJ3A 5ACSA 4C1FA 4AWYB 2Y8BA 1VMEA 3LVZA 2FU7A 2YNUA 5DPXA 3VPEA 4CHLA 4BP0A 4ZO2A 5EW0A 5AHRA 5LLDA 1ZKPA 1VJNA 4GCWA 3DHBA 1JJEA 2OHIA 4J5HA 5AYAA 2YNVB 2P18A 5EWAA 4GYQA 5EVDA 2BFLA 4NQ4A 1K07A 4TYFA 4UWSB 5EH9A 4D1VA 2FM6A 2GFJA 3FAIA 2XR1A 3IDZA 3H3EA 4F6ZA 2GFKA 5EHTA 5K4NA 5ACTA 4YSLA 2FHXA 2BMIA 2M5CA 5ACXA 3BK1A 4ZEJA 4YSBA 2Q0JA 5LCHA 3IE1A 2BFKA 5HH4A 4C1EA 3IELA 3KNSA 3RKJA 4TZ9A 4TZBA 4C09A 1P9EA 2YNVA 3I11A 3TP9A 3SPUA 4UAMA 3I14A 3ZWFA 4DIKA 2YNTB 1SMLA 2AZ4A 2UYXA 4EYLA 1A7TA 3FCZA 4TZFA 2P97A 4Z7RA 1KO2A 4D1UA 5KILA 4FSBA 1X8IA 5EV6A 3I0VA 2NYPA 4RBSA 4WD6A 2I7TA 2ZNBA 2R2DA 4AX0B 2A7MA 5HISA 2OHHA 2CBNA 4XWTA 3DH8A 2P4ZA 3QH8A 3BV6A 5A5ZA 5ACWA 2Y8AA 3ESHA 1YCFA 2YNTA 4UBQA 1Y44A 2WYMC 4EYBA 2ZZIA 4UA4A 4RAWA 1DD6A 5FQAA 2DOOA 3T3NA 2FHXB 3KL7A 3IE0A 4HKYA 5KIKA 4NQ2A 2GCUA 4UWOB 1MQOA 1HLKA 5AHOA 2BG6A 3SD9A 4C1CA 4C1DA 2HB9A 5B3RA 4LE6A 1ZNBA 4C1GA 2FK6A 4J5FA 3AF6A 3SBLA 4FEKA 4D1TA 5EV8A 2E7YA 5LE1A 5A0VA 3IE2A 5HIPA 2NZFA 4JO0A 5AXOA 5B1UA 1WW1A 5B15A 3ADRA 4EXYA 1A8TA 4H0DA 2XF4A 2I7XA 2P1EA 2BG7A 2BFZB 2WYLA 3KNRA 2QINA 2ZWRA 2QDTA 3PY5A 1X8HA 3F9OA 4F6HA 1WRAA 2Q0IA 1WUOA 4UWPB 1JT1A 4O98A 4PVOA 1M2XA 4KEPA 3I13A 4TZEA 1YCGA 4Z67A 5ACVA 4EXSA 3R2UA 2NZEA 3RPCA 3A4YA 2WYMA 1DDKA 1KO3A 4EFZA 4U4LA 3S0ZA 3Q6VA 3T9MA 2BFZA 4ZNBA 2Y87A 2H6AA 1QH3A 2FU9A 1KR3A 2Q9UA 3SRXA 5HIQA 3WXCA 1WUPA 2BIBA 2ZO4A 5K0WA 4AD9A 1BC2A 2M5DA 1QH5A 2YZ3A 5ACQA 5FQBA 2Q42A 5LS3A 2WHGA 1JJTA 3SFPA 2BGAA 4UWRB 1L9YA 5ACPA 3BC2A 3JXPA 2YCBA 1BVTA 5LCAA 1VGNA 4Z6XA 4DILA 4ZO3A 4AWZA 1BMCA 2OHJA 3X2XA 5K4MA 4XUKA 4YSKA 3VQZA 2BR6A 4HL2A 4Z5YA 4Z5ZA 4FR7A 5HIOA 5AEBA
chains in the Genus database with same CATH superfamily
1XM8A 4D1WA 4EYFA 2BG2A 5FQCA 4GYUA 5IQKA 4Z60A 3IEKA 5LCFA 3DHCA 1E5DA 3X30A 2YNWA 4RAMA 5HH5A 2NXAA 3MD7A 2VW8A 5ACUA 2GMNA 3X2ZA 3IEMA 2WRSA 4V0HA 5K4KA 1X8GA 5LMCA 2YHEA 3I15A 3ZR9A 3T3OA 5A0TA 3L6NA 2QJSA 2GKLA 2FU8A 5HH6A 3RKKA 2CFZA 4B87A 1YCHA 2BG8B 2QDSA 4RM5A 4RL2A 4NQ6A 3PG4A 3X2YA 4P62A 5EVKA 4D02A 5ACRA 4NQ5A 4RL0A 4TYTA 2DKFA 3PY6A 4PVTA 4KEQA 5LM6A 5AXRA 2I7VA 2BTNA 3BK2A 4PDXA 4EY2A 2QEDA 4XWWA 4AX1B 5A87A 1XTOA 3G1PA 3AF5A 3IOFA 1ZTCA 3P2UA 3SW3A 3IOGA 2BC2A 4BZ3A 2BG8A 3ZQ4A 2FU6A 3DHAA 5LSCA 2AIOA 4C1HA 1DXKA 5EVBA 4HL1A 3ZNBA 2CG3A 3AJ3A 5ACSA 4C1FA 4AWYB 2Y8BA 1VMEA 3LVZA 2FU7A 2YNUA 5DPXA 3VPEA 4CHLA 4BP0A 4ZO2A 5EW0A 5AHRA 5LLDA 1ZKPA 1VJNA 4GCWA 3DHBA 1JJEA 2OHIA 4J5HA 5AYAA 2YNVB 2P18A 5EWAA 4GYQA 5EVDA 2BFLA 4NQ4A 1K07A 4TYFA 4UWSB 5EH9A 4D1VA 2FM6A 2GFJA 3FAIA 2XR1A 3IDZA 3H3EA 4F6ZA 2GFKA 5EHTA 5K4NA 5ACTA 4YSLA 2FHXA 2BMIA 2M5CA 5ACXA 3BK1A 4ZEJA 4YSBA 2Q0JA 5LCHA 3IE1A 2BFKA 5HH4A 4C1EA 3IELA 3KNSA 3RKJA 4TZ9A 4TZBA 4C09A 1P9EA 2YNVA 3I11A 3TP9A 3SPUA 4UAMA 3I14A 3ZWFA 5A23A 4DIKA 2YNTB 1SMLA 2AZ4A 2UYXA 4EYLA 1A7TA 3FCZA 4TZFA 2P97A 4Z7RA 1KO2A 4D1UA 5KILA 4FSBA 1X8IA 5EV6A 3I0VA 2NYPA 4RBSA 4WD6A 2I7TA 2ZNBA 2R2DA 4AX0B 2A7MA 5HISA 2OHHA 2CBNA 4XWTA 4AXHA 3DH8A 2P4ZA 3QH8A 3BV6A 5A5ZA 5ACWA 2Y8AA 3ESHA 1YCFA 2CFUA 2YNTA 4UBQA 1Y44A 2WYMC 4EYBA 2ZZIA 5AJLA 4UA4A 4RAWA 1DD6A 5FQAA 2DOOA 3T3NA 2FHXB 3KL7A 3IE0A 4HKYA 5KIKA 2CG2A 4NURA 4NQ2A 2GCUA 5AIJA 4UWOB 1MQOA 1HLKA 5AHOA 2BG6A 3SD9A 4C1CA 4C1DA 2HB9A 5B3RA 4LE6A 1ZNBA 4C1GA 2FK6A 4J5FA 3AF6A 3SBLA 4FEKA 4D1TA 5EV8A 2E7YA 5LE1A 5A0VA 3IE2A 5HIPA 2NZFA 4JO0A 5AXOA 5B1UA 1WW1A 5B15A 3ADRA 4EXYA 1A8TA 4H0DA 2XF4A 2I7XA 2P1EA 2BG7A 2BFZB 2WYLA 3KNRA 2QINA 2ZWRA 2QDTA 3PY5A 1X8HA 3F9OA 4F6HA 1WRAA 4AV7A 2Q0IA 1WUOA 4UWPB 1JT1A 4O98A 4PVOA 1M2XA 4KEPA 3I13A 4TZEA 1YCGA 4Z67A 5ACVA 4EXSA 3R2UA 2NZEA 3RPCA 3A4YA 2WYMA 1DDKA 1KO3A 4EFZA 4U4LA 3S0ZA 3Q6VA 3T9MA 2BFZA 4ZNBA 2Y87A 2H6AA 1QH3A 2FU9A 1KR3A 2Q9UA 3SRXA 5HIQA 3WXCA 1WUPA 2BIBA 2ZO4A 5K0WA 4AD9A 1BC2A 2M5DA 1QH5A 2YZ3A 5ACQA 5FQBA 2Q42A 5LS3A 2WHGA 1JJTA 3SFPA 2BGAA 4UWRB 1L9YA 5ACPA 3BC2A 3JXPA 2YCBA 1BVTA 5LCAA 1VGNA 4Z6XA 4DILA 4ZO3A 4AWZA 1BMCA 2OHJA 3X2XA 5K4MA 4XUKA 4YSKA 3VQZA 2BR6A 4HL2A 4Z5YA 4Z5ZA 4FR7A 5HIOA 5AEBA
chains in the Genus database with same CATH topology
1XM8A 4D1WA 4EYFA 2BG2A 5FQCA 4GYUA 5IQKA 4Z60A 3IEKA 5LCFA 3DHCA 1E5DA 3X30A 2YNWA 4RAMA 5HH5A 2NXAA 3MD7A 2VW8A 5ACUA 2GMNA 3X2ZA 3IEMA 2WRSA 4V0HA 5K4KA 1X8GA 5LMCA 3I15A 3ZR9A 3T3OA 5A0TA 3L6NA 2QJSA 2GKLA 2FU8A 5HH6A 3RKKA 4B87A 1YCHA 2BG8B 2QDSA 4RM5A 4RL2A 4NQ6A 3PG4A 3X2YA 4P62A 5EVKA 4D02A 5ACRA 4NQ5A 4RL0A 4TYTA 2DKFA 3PY6A 4PVTA 4KEQA 5LM6A 5AXRA 2I7VA 2BTNA 3BK2A 4EY2A 2QEDA 4XWWA 4AX1B 5A87A 1XTOA 3G1PA 3AF5A 3IOFA 1ZTCA 3P2UA 3SW3A 3IOGA 2BC2A 4BZ3A 2BG8A 3ZQ4A 2FU6A 3DHAA 5LSCA 2AIOA 4C1HA 1DXKA 5EVBA 4HL1A 3ZNBA 3AJ3A 5ACSA 4C1FA 4AWYB 2Y8BA 1VMEA 3LVZA 2FU7A 2YNUA 5DPXA 3VPEA 4CHLA 4BP0A 4ZO2A 5EW0A 5AHRA 5LLDA 1ZKPA 1VJNA 4GCWA 3DHBA 1JJEA 2OHIA 4J5HA 5AYAA 2YNVB 2P18A 5EWAA 4GYQA 5EVDA 2BFLA 4NQ4A 1K07A 4TYFA 4UWSB 5EH9A 4D1VA 2FM6A 2GFJA 3FAIA 2XR1A 3IDZA 3H3EA 4F6ZA 2GFKA 5EHTA 5K4NA 5ACTA 4YSLA 2FHXA 2BMIA 2M5CA 5ACXA 3BK1A 4ZEJA 4YSBA 2Q0JA 5LCHA 3IE1A 2BFKA 5HH4A 4C1EA 3IELA 3KNSA 3RKJA 4TZ9A 4TZBA 4C09A 1P9EA 2YNVA 3I11A 3TP9A 3SPUA 4UAMA 3I14A 3ZWFA 4DIKA 2YNTB 1SMLA 2AZ4A 2UYXA 4EYLA 1A7TA 3FCZA 4TZFA 2P97A 4Z7RA 1KO2A 4D1UA 5KILA 4FSBA 1X8IA 5EV6A 3I0VA 2NYPA 4RBSA 4WD6A 2I7TA 2ZNBA 2R2DA 4AX0B 2A7MA 5HISA 2OHHA 2CBNA 4XWTA 3DH8A 2P4ZA 3QH8A 3BV6A 5A5ZA 5ACWA 2Y8AA 3ESHA 1YCFA 2YNTA 4UBQA 1Y44A 2WYMC 4EYBA 2ZZIA 4UA4A 4RAWA 1DD6A 5FQAA 2DOOA 3T3NA 2FHXB 3KL7A 3IE0A 4HKYA 5KIKA 4NQ2A 2GCUA 4UWOB 1MQOA 1HLKA 5AHOA 2BG6A 3SD9A 4C1CA 4C1DA 2HB9A 5B3RA 4LE6A 1ZNBA 4C1GA 2FK6A 4J5FA 3AF6A 3SBLA 4FEKA 4D1TA 5EV8A 2E7YA 5LE1A 5A0VA 3IE2A 5HIPA 2NZFA 4JO0A 5AXOA 5B1UA 1WW1A 5B15A 3ADRA 4EXYA 1A8TA 4H0DA 2XF4A 2I7XA 2P1EA 2BG7A 2BFZB 2WYLA 3KNRA 2QINA 2ZWRA 2QDTA 3PY5A 1X8HA 3F9OA 4F6HA 1WRAA 2Q0IA 1WUOA 4UWPB 1JT1A 4O98A 4PVOA 1M2XA 4KEPA 3I13A 4TZEA 1YCGA 4Z67A 5ACVA 4EXSA 3R2UA 2NZEA 3RPCA 3A4YA 2WYMA 1DDKA 1KO3A 4EFZA 4U4LA 3S0ZA 3Q6VA 3T9MA 2BFZA 4ZNBA 2Y87A 2H6AA 1QH3A 2FU9A 1KR3A 2Q9UA 3SRXA 5HIQA 3WXCA 1WUPA 2BIBA 2ZO4A 5K0WA 4AD9A 1BC2A 2M5DA 1QH5A 2YZ3A 5ACQA 5FQBA 2Q42A 5LS3A 2WHGA 1JJTA 3SFPA 2BGAA 4UWRB 1L9YA 5ACPA 3BC2A 3JXPA 2YCBA 1BVTA 5LCAA 1VGNA 4Z6XA 4DILA 4ZO3A 4AWZA 1BMCA 2OHJA 3X2XA 5K4MA 4XUKA 4YSKA 3VQZA 2BR6A 4HL2A 4Z5YA 4Z5ZA 4FR7A 5HIOA 5AEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XM8 A;  4D1W A;  4EYF A;  2BG2 A;  5FQC A;  4GYU A;  5IQK A;  4Z60 A;  3IEK A;  5LCF A;  3DHC A;  1E5D A;  3X30 A;  2YNW A;  4RAM A;  5HH5 A;  2NXA A;  3MD7 A;  2VW8 A;  5ACU A;  2GMN A;  3X2Z A;  3IEM A;  2WRS A;  4V0H A;  5K4K A;  1X8G A;  5LMC A;  3I15 A;  3ZR9 A;  3T3O A;  5A0T A;  3L6N A;  2QJS A;  2GKL A;  2FU8 A;  5HH6 A;  3RKK A;  4B87 A;  1YCH A;  2BG8 B;  2QDS A;  4RM5 A;  4RL2 A;  4NQ6 A;  3PG4 A;  3X2Y A;  4P62 A;  5EVK A;  4D02 A;  5ACR A;  4NQ5 A;  4RL0 A;  4TYT A;  2DKF A;  3PY6 A;  4PVT A;  4KEQ A;  5LM6 A;  5AXR A;  2I7V A;  2BTN A;  3BK2 A;  4EY2 A;  2QED A;  4XWW A;  4AX1 B;  5A87 A;  1XTO A;  3G1P A;  3AF5 A;  3IOF A;  1ZTC A;  3P2U A;  3SW3 A;  3IOG A;  2BC2 A;  4BZ3 A;  2BG8 A;  3ZQ4 A;  2FU6 A;  3DHA A;  5LSC A;  2AIO A;  4C1H A;  1DXK A;  5EVB A;  4HL1 A;  3ZNB A;  3AJ3 A;  5ACS A;  4C1F A;  4AWY B;  2Y8B A;  1VME A;  3LVZ A;  2FU7 A;  2YNU A;  5DPX A;  3VPE A;  4CHL A;  4BP0 A;  4ZO2 A;  5EW0 A;  5AHR A;  5LLD A;  1ZKP A;  1VJN A;  4GCW A;  3DHB A;  1JJE A;  2OHI A;  4J5H A;  5AYA A;  2YNV B;  2P18 A;  5EWA A;  4GYQ A;  5EVD A;  2BFL A;  4NQ4 A;  1K07 A;  4TYF A;  4UWS B;  5EH9 A;  4D1V A;  2FM6 A;  2GFJ A;  3FAI A;  2XR1 A;  3IDZ A;  3H3E A;  4F6Z A;  2GFK A;  5EHT A;  5K4N A;  5ACT A;  4YSL A;  2FHX A;  2BMI A;  2M5C A;  5ACX A;  3BK1 A;  4ZEJ A;  4YSB A;  2Q0J A;  5LCH A;  3IE1 A;  2BFK A;  5HH4 A;  4C1E A;  3IEL A;  3KNS A;  3RKJ A;  4TZ9 A;  4TZB A;  4C09 A;  1P9E A;  2YNV A;  3I11 A;  3TP9 A;  3SPU A;  4UAM A;  3I14 A;  3ZWF A;  4DIK A;  2YNT B;  1SML A;  2AZ4 A;  2UYX A;  4EYL A;  1A7T A;  3FCZ A;  4TZF A;  2P97 A;  4Z7R A;  1KO2 A;  4D1U A;  5KIL A;  4FSB A;  1X8I A;  5EV6 A;  3I0V A;  2NYP A;  4RBS A;  4WD6 A;  2I7T A;  2ZNB A;  2R2D A;  4AX0 B;  2A7M A;  5HIS A;  2OHH A;  2CBN A;  4XWT A;  3DH8 A;  2P4Z A;  3QH8 A;  3BV6 A;  5A5Z A;  5ACW A;  2Y8A A;  3ESH A;  1YCF A;  2YNT A;  4UBQ A;  1Y44 A;  2WYM C;  4EYB A;  2ZZI A;  4UA4 A;  4RAW A;  1DD6 A;  5FQA A;  2DOO A;  3T3N A;  2FHX B;  3KL7 A;  3IE0 A;  4HKY A;  5KIK A;  4NQ2 A;  2GCU A;  4UWO B;  1MQO A;  1HLK A;  5AHO A;  2BG6 A;  3SD9 A;  4C1C A;  4C1D A;  2HB9 A;  5B3R A;  4LE6 A;  1ZNB A;  4C1G A;  2FK6 A;  4J5F A;  3AF6 A;  3SBL A;  4FEK A;  4D1T A;  5EV8 A;  2E7Y A;  5LE1 A;  5A0V A;  3IE2 A;  5HIP A;  2NZF A;  4JO0 A;  5AXO A;  5B1U A;  1WW1 A;  5B15 A;  3ADR A;  4EXY A;  1A8T A;  4H0D A;  2XF4 A;  2I7X A;  2P1E A;  2BG7 A;  2BFZ B;  2WYL A;  3KNR A;  2QIN A;  2ZWR A;  2QDT A;  3PY5 A;  1X8H A;  3F9O A;  4F6H A;  1WRA A;  2Q0I A;  1WUO A;  4UWP B;  1JT1 A;  4O98 A;  4PVO A;  1M2X A;  4KEP A;  3I13 A;  4TZE A;  1YCG A;  4Z67 A;  5ACV A;  4EXS A;  3R2U A;  2NZE A;  3RPC A;  3A4Y A;  2WYM A;  1DDK A;  1KO3 A;  4EFZ A;  4U4L A;  3S0Z A;  3Q6V A;  3T9M A;  2BFZ A;  4ZNB A;  2Y87 A;  2H6A A;  1QH3 A;  2FU9 A;  1KR3 A;  2Q9U A;  3SRX A;  5HIQ A;  3WXC A;  1WUP A;  2BIB A;  2ZO4 A;  5K0W A;  4AD9 A;  1BC2 A;  2M5D A;  1QH5 A;  2YZ3 A;  5ACQ A;  5FQB A;  2Q42 A;  5LS3 A;  2WHG A;  1JJT A;  3SFP A;  2BGA A;  4UWR B;  1L9Y A;  5ACP A;  3BC2 A;  3JXP A;  2YCB A;  1BVT A;  5LCA A;  1VGN A;  4Z6X A;  4DIL A;  4ZO3 A;  4AWZ A;  1BMC A;  2OHJ A;  3X2X A;  5K4M A;  4XUK A;  4YSK A;  3VQZ A;  2BR6 A;  4HL2 A;  4Z5Y A;  4Z5Z A;  4FR7 A;  5HIO A;  5AEB A; 
#chains in the Genus database with same CATH topology
 1XM8 A;  4D1W A;  4EYF A;  2BG2 A;  5FQC A;  4GYU A;  5IQK A;  4Z60 A;  3IEK A;  5LCF A;  3DHC A;  1E5D A;  3X30 A;  2YNW A;  4RAM A;  5HH5 A;  2NXA A;  3MD7 A;  2VW8 A;  5ACU A;  2GMN A;  3X2Z A;  3IEM A;  2WRS A;  4V0H A;  5K4K A;  1X8G A;  5LMC A;  2YHE A;  3I15 A;  3ZR9 A;  3T3O A;  5A0T A;  3L6N A;  2QJS A;  2GKL A;  2FU8 A;  5HH6 A;  3RKK A;  2CFZ A;  4B87 A;  1YCH A;  2BG8 B;  2QDS A;  4RM5 A;  4RL2 A;  4NQ6 A;  3PG4 A;  3X2Y A;  4P62 A;  5EVK A;  4D02 A;  5ACR A;  4NQ5 A;  4RL0 A;  4TYT A;  2DKF A;  3PY6 A;  4PVT A;  4KEQ A;  5LM6 A;  5AXR A;  2I7V A;  2BTN A;  3BK2 A;  4PDX A;  4EY2 A;  2QED A;  4XWW A;  4AX1 B;  5A87 A;  1XTO A;  3G1P A;  3AF5 A;  3IOF A;  1ZTC A;  3P2U A;  3SW3 A;  3IOG A;  2BC2 A;  4BZ3 A;  2BG8 A;  3ZQ4 A;  2FU6 A;  3DHA A;  5LSC A;  2AIO A;  4C1H A;  1DXK A;  5EVB A;  4HL1 A;  3ZNB A;  2CG3 A;  3AJ3 A;  5ACS A;  4C1F A;  4AWY B;  2Y8B A;  1VME A;  3LVZ A;  2FU7 A;  2YNU A;  5DPX A;  3VPE A;  4CHL A;  4BP0 A;  4ZO2 A;  5EW0 A;  5AHR A;  5LLD A;  1ZKP A;  1VJN A;  4GCW A;  3DHB A;  1JJE A;  2OHI A;  4J5H A;  5AYA A;  2YNV B;  2P18 A;  5EWA A;  4GYQ A;  5EVD A;  2BFL A;  4NQ4 A;  1K07 A;  4TYF A;  4UWS B;  5EH9 A;  4D1V A;  2FM6 A;  2GFJ A;  3FAI A;  2XR1 A;  3IDZ A;  3H3E A;  4F6Z A;  2GFK A;  5EHT A;  5K4N A;  5ACT A;  4YSL A;  2FHX A;  2BMI A;  2M5C A;  5ACX A;  3BK1 A;  4ZEJ A;  4YSB A;  2Q0J A;  5LCH A;  3IE1 A;  2BFK A;  5HH4 A;  4C1E A;  3IEL A;  3KNS A;  3RKJ A;  4TZ9 A;  4TZB A;  4C09 A;  1P9E A;  2YNV A;  3I11 A;  3TP9 A;  3SPU A;  4UAM A;  3I14 A;  3ZWF A;  5A23 A;  4DIK A;  2YNT B;  1SML A;  2AZ4 A;  2UYX A;  4EYL A;  1A7T A;  3FCZ A;  4TZF A;  2P97 A;  4Z7R A;  1KO2 A;  4D1U A;  5KIL A;  4FSB A;  1X8I A;  5EV6 A;  3I0V A;  2NYP A;  4RBS A;  4WD6 A;  2I7T A;  2ZNB A;  2R2D A;  4AX0 B;  2A7M A;  5HIS A;  2OHH A;  2CBN A;  4XWT A;  4AXH A;  3DH8 A;  2P4Z A;  3QH8 A;  3BV6 A;  5A5Z A;  5ACW A;  2Y8A A;  3ESH A;  1YCF A;  2CFU A;  2YNT A;  4UBQ A;  1Y44 A;  2WYM C;  4EYB A;  2ZZI A;  5AJL A;  4UA4 A;  4RAW A;  1DD6 A;  5FQA A;  2DOO A;  3T3N A;  2FHX B;  3KL7 A;  3IE0 A;  4HKY A;  5KIK A;  2CG2 A;  4NUR A;  4NQ2 A;  2GCU A;  5AIJ A;  4UWO B;  1MQO A;  1HLK A;  5AHO A;  2BG6 A;  3SD9 A;  4C1C A;  4C1D A;  2HB9 A;  5B3R A;  4LE6 A;  1ZNB A;  4C1G A;  2FK6 A;  4J5F A;  3AF6 A;  3SBL A;  4FEK A;  4D1T A;  5EV8 A;  2E7Y A;  5LE1 A;  5A0V A;  3IE2 A;  5HIP A;  2NZF A;  4JO0 A;  5AXO A;  5B1U A;  1WW1 A;  5B15 A;  3ADR A;  4EXY A;  1A8T A;  4H0D A;  2XF4 A;  2I7X A;  2P1E A;  2BG7 A;  2BFZ B;  2WYL A;  3KNR A;  2QIN A;  2ZWR A;  2QDT A;  3PY5 A;  1X8H A;  3F9O A;  4F6H A;  1WRA A;  4AV7 A;  2Q0I A;  1WUO A;  4UWP B;  1JT1 A;  4O98 A;  4PVO A;  1M2X A;  4KEP A;  3I13 A;  4TZE A;  1YCG A;  4Z67 A;  5ACV A;  4EXS A;  3R2U A;  2NZE A;  3RPC A;  3A4Y A;  2WYM A;  1DDK A;  1KO3 A;  4EFZ A;  4U4L A;  3S0Z A;  3Q6V A;  3T9M A;  2BFZ A;  4ZNB A;  2Y87 A;  2H6A A;  1QH3 A;  2FU9 A;  1KR3 A;  2Q9U A;  3SRX A;  5HIQ A;  3WXC A;  1WUP A;  2BIB A;  2ZO4 A;  5K0W A;  4AD9 A;  1BC2 A;  2M5D A;  1QH5 A;  2YZ3 A;  5ACQ A;  5FQB A;  2Q42 A;  5LS3 A;  2WHG A;  1JJT A;  3SFP A;  2BGA A;  4UWR B;  1L9Y A;  5ACP A;  3BC2 A;  3JXP A;  2YCB A;  1BVT A;  5LCA A;  1VGN A;  4Z6X A;  4DIL A;  4ZO3 A;  4AWZ A;  1BMC A;  2OHJ A;  3X2X A;  5K4M A;  4XUK A;  4YSK A;  3VQZ A;  2BR6 A;  4HL2 A;  4Z5Y A;  4Z5Z A;  4FR7 A;  5HIO A;  5AEB A; 
#chains in the Genus database with same CATH homology
 1XM8 A;  4D1W A;  4EYF A;  2BG2 A;  5FQC A;  4GYU A;  5IQK A;  4Z60 A;  3IEK A;  5LCF A;  3DHC A;  1E5D A;  3X30 A;  2YNW A;  4RAM A;  5HH5 A;  2NXA A;  3MD7 A;  2VW8 A;  5ACU A;  2GMN A;  3X2Z A;  3IEM A;  2WRS A;  4V0H A;  5K4K A;  1X8G A;  5LMC A;  3I15 A;  3ZR9 A;  3T3O A;  5A0T A;  3L6N A;  2QJS A;  2GKL A;  2FU8 A;  5HH6 A;  3RKK A;  4B87 A;  1YCH A;  2BG8 B;  2QDS A;  4RM5 A;  4RL2 A;  4NQ6 A;  3PG4 A;  3X2Y A;  4P62 A;  5EVK A;  4D02 A;  5ACR A;  4NQ5 A;  4RL0 A;  4TYT A;  2DKF A;  3PY6 A;  4PVT A;  4KEQ A;  5LM6 A;  5AXR A;  2I7V A;  2BTN A;  3BK2 A;  4EY2 A;  2QED A;  4XWW A;  4AX1 B;  5A87 A;  1XTO A;  3G1P A;  3AF5 A;  3IOF A;  1ZTC A;  3P2U A;  3SW3 A;  3IOG A;  2BC2 A;  4BZ3 A;  2BG8 A;  3ZQ4 A;  2FU6 A;  3DHA A;  5LSC A;  2AIO A;  4C1H A;  1DXK A;  5EVB A;  4HL1 A;  3ZNB A;  3AJ3 A;  5ACS A;  4C1F A;  4AWY B;  2Y8B A;  1VME A;  3LVZ A;  2FU7 A;  2YNU A;  5DPX A;  3VPE A;  4CHL A;  4BP0 A;  4ZO2 A;  5EW0 A;  5AHR A;  5LLD A;  1ZKP A;  1VJN A;  4GCW A;  3DHB A;  1JJE A;  2OHI A;  4J5H A;  5AYA A;  2YNV B;  2P18 A;  5EWA A;  4GYQ A;  5EVD A;  2BFL A;  4NQ4 A;  1K07 A;  4TYF A;  4UWS B;  5EH9 A;  4D1V A;  2FM6 A;  2GFJ A;  3FAI A;  2XR1 A;  3IDZ A;  3H3E A;  4F6Z A;  2GFK A;  5EHT A;  5K4N A;  5ACT A;  4YSL A;  2FHX A;  2BMI A;  2M5C A;  5ACX A;  3BK1 A;  4ZEJ A;  4YSB A;  2Q0J A;  5LCH A;  3IE1 A;  2BFK A;  5HH4 A;  4C1E A;  3IEL A;  3KNS A;  3RKJ A;  4TZ9 A;  4TZB A;  4C09 A;  1P9E A;  2YNV A;  3I11 A;  3TP9 A;  3SPU A;  4UAM A;  3I14 A;  3ZWF A;  4DIK A;  2YNT B;  1SML A;  2AZ4 A;  2UYX A;  4EYL A;  1A7T A;  3FCZ A;  4TZF A;  2P97 A;  4Z7R A;  1KO2 A;  4D1U A;  5KIL A;  4FSB A;  1X8I A;  5EV6 A;  3I0V A;  2NYP A;  4RBS A;  4WD6 A;  2I7T A;  2ZNB A;  2R2D A;  4AX0 B;  2A7M A;  5HIS A;  2OHH A;  2CBN A;  4XWT A;  3DH8 A;  2P4Z A;  3QH8 A;  3BV6 A;  5A5Z A;  5ACW A;  2Y8A A;  3ESH A;  1YCF A;  2YNT A;  4UBQ A;  1Y44 A;  2WYM C;  4EYB A;  2ZZI A;  4UA4 A;  4RAW A;  1DD6 A;  5FQA A;  2DOO A;  3T3N A;  2FHX B;  3KL7 A;  3IE0 A;  4HKY A;  5KIK A;  4NQ2 A;  2GCU A;  4UWO B;  1MQO A;  1HLK A;  5AHO A;  2BG6 A;  3SD9 A;  4C1C A;  4C1D A;  2HB9 A;  5B3R A;  4LE6 A;  1ZNB A;  4C1G A;  2FK6 A;  4J5F A;  3AF6 A;  3SBL A;  4FEK A;  4D1T A;  5EV8 A;  2E7Y A;  5LE1 A;  5A0V A;  3IE2 A;  5HIP A;  2NZF A;  4JO0 A;  5AXO A;  5B1U A;  1WW1 A;  5B15 A;  3ADR A;  4EXY A;  1A8T A;  4H0D A;  2XF4 A;  2I7X A;  2P1E A;  2BG7 A;  2BFZ B;  2WYL A;  3KNR A;  2QIN A;  2ZWR A;  2QDT A;  3PY5 A;  1X8H A;  3F9O A;  4F6H A;  1WRA A;  2Q0I A;  1WUO A;  4UWP B;  1JT1 A;  4O98 A;  4PVO A;  1M2X A;  4KEP A;  3I13 A;  4TZE A;  1YCG A;  4Z67 A;  5ACV A;  4EXS A;  3R2U A;  2NZE A;  3RPC A;  3A4Y A;  2WYM A;  1DDK A;  1KO3 A;  4EFZ A;  4U4L A;  3S0Z A;  3Q6V A;  3T9M A;  2BFZ A;  4ZNB A;  2Y87 A;  2H6A A;  1QH3 A;  2FU9 A;  1KR3 A;  2Q9U A;  3SRX A;  5HIQ A;  3WXC A;  1WUP A;  2BIB A;  2ZO4 A;  5K0W A;  4AD9 A;  1BC2 A;  2M5D A;  1QH5 A;  2YZ3 A;  5ACQ A;  5FQB A;  2Q42 A;  5LS3 A;  2WHG A;  1JJT A;  3SFP A;  2BGA A;  4UWR B;  1L9Y A;  5ACP A;  3BC2 A;  3JXP A;  2YCB A;  1BVT A;  5LCA A;  1VGN A;  4Z6X A;  4DIL A;  4ZO3 A;  4AWZ A;  1BMC A;  2OHJ A;  3X2X A;  5K4M A;  4XUK A;  4YSK A;  3VQZ A;  2BR6 A;  4HL2 A;  4Z5Y A;  4Z5Z A;  4FR7 A;  5HIO A;  5AEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...