3MD7A

Crystal structure of a beta-lactamase-like protein bound to gmp from brucella melitensis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BrabA.11339.a: anomalous diffraction and ligand binding guide towards the elucidation of the function of a `putative beta-lactamase-like protein from Brucella melitensis.
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
molecule tags Hydrolase
molecule keywords Beta-lactamase-like
total genus 83
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3md7A00
4D1TA 3A4YA 2CBNA 4TZFA 4UWRB 2R2DA 5HH6A 5EV6A 2M5DA 4RM5A 4D02A 3PY5A 4YSLA 4Z67A 2FHXB 1DXKA 4Z7RA 2Q42A 3VQZA 4B87A 3X30A 2FM6A 5ACWA 2NZEA 4EY2A 2WYMC 1X8IA 1JJTA 2E7YA 4C1FA 1QH3A 5FQAA 1SMLA 5LCAA 5HIPA 2I7TA 5A0VA 2BFZB 4ZO2A 3IE2A 3MD7A 4J5FA 5LCFA 2Q0IA 5K4KA 4Z5YA 3SPUA 4PVOA 5HH5A 2BG7A 2GMNA 4HL2A 2QEDA 3X2YA 3AF5A 2YNUA 2WHGA 3SBLA 3KL7A 4C09A 3FCZA 4XUKA 4AD9A 4PVTA 4DILA 3DH8A 4TZEA 3I0VA 4H0DA 2OHHA 3PY6A 1P9EA 1KO2A 1QH5A 4Z60A 2Q0JA 2QDTA 1YCFA 4UA4A 3KNSA 3IOFA 2BFLA 2P4ZA 2BG8B 3KNRA 4V0HA 4GYUA 2ZO4A 5KILA 3DHAA 4EXSA 2FHXA 5DPXA 3DHBA 2UYXA 2AIOA 4RAMA 3BC2A 2P97A 4NQ5A 4RL0A 4AWYB 5LLDA 4CHLA 4RBSA 2ZNBA 3AF6A 5KIKA 1WW1A 3IEKA 4GCWA 5K4MA 2FU9A 4D1WA 4J5HA 5EW0A 3IDZA 1ZTCA 4ZEJA 5AYAA 2QINA 5LSCA 4EYFA 2AZ4A 1JJEA 5LE1A 5ACXA 4DIKA 3ESHA 2Y8BA 2BG8A 4TYTA 1L9YA 4XWWA 3RKKA 4AX0B 4BZ3A 4D1UA 5HH4A 3S0ZA 4NQ6A 2GKLA 1X8HA 2BFKA 3F9OA 4C1CA 4GYQA 1ZKPA 5ACSA 3L6NA 5EVDA 3G1PA 5ACQA 2NYPA 4TYFA 3VPEA 4WD6A 2GFJA 2YNTA 4UWOB 4ZNBA 4C1EA 4D1VA 5IQKA 1VGNA 2QDSA 4LE6A 3WXCA 2DKFA 2XF4A 1A8TA 2GCUA 2NXAA 4KEPA 2FU7A 3ZWFA 4U4LA 5EHTA 1A7TA 1YCGA 5EV8A 4AWZA 5A87A 4UWPB 3ADRA 2BMIA 3ZNBA 4EYBA 1BC2A 2YZ3A 5HIOA 2I7VA 2YNVB 2OHIA 3X2ZA 1Y44A 2WRSA 5A5ZA 4BP0A 3RKJA 4C1GA 5B3RA 2YNTB 2ZZIA 4F6HA 2HB9A 3IE1A 3RPCA 3TP9A 4HL1A 4FR7A 5ACUA 2H6AA 3JXPA 5AEBA 3SD9A 5AHRA 2OHJA 3SW3A 2GFKA 3IEMA 4Z5ZA 2BG2A 3T9MA 5EWAA 2BGAA 2M5CA 3IELA 5ACVA 1BVTA 3BK2A 1JT1A 4O98A 4C1DA 3BV6A 5K4NA 2XR1A 1WRAA 1X8GA 4P62A 4JO0A 1HLKA 2YNWA 4F6ZA 5ACPA 1VMEA 1KO3A 5B1UA 5HISA 1DD6A 2Q9UA 5AXRA 4TZ9A 5LMCA 4NQ2A 3T3OA 5ACTA 4HKYA 2WYMA 4C1HA 2BFZA 5AXOA 3IE0A 4RAWA 1XM8A 2P1EA 4XWTA 5LS3A 3P2UA 2NZFA 2FU6A 2YNVA 3X2XA 5B15A 4KEQA 4RL2A 4EYLA 2BTNA 4FSBA 4EXYA 3BK1A 3LVZA 2DOOA 1MQOA 5AHOA 1XTOA 5EH9A 2BIBA 3IOGA 4EFZA 1WUPA 4Z6XA 2I7XA 3H3EA 5K0WA 1DDKA 1ZNBA 1VJNA 2FK6A 1KR3A 1WUOA 2BC2A 5EVKA 3PG4A 4UWSB 2QJSA 4YSKA 2WYLA 4UBQA 3FAIA 3ZQ4A 1BMCA 2BR6A 2P18A 5FQBA 5EVBA 3R2UA 2YCBA 4FEKA 5HIQA 1YCHA 2A7MA 3SFPA 3I13A 4TZBA 3Q6VA 4NQ4A 2VW8A 3I11A 4YSBA 5LCHA 3ZR9A 3I14A 3I15A 1K07A 2FU8A 5A0TA 5ACRA 3T3NA 4AX1B 1E5DA 5FQCA 3SRXA 2BG6A 4UAMA 5LM6A 2Y8AA 3QH8A 2Y87A 3DHCA 2ZWRA 3AJ3A 1M2XA 4ZO3A
chains in the Genus database with same CATH superfamily
5A23A 4D1TA 3A4YA 2CBNA 4TZFA 4UWRB 2R2DA 5HH6A 5EV6A 2M5DA 4RM5A 4D02A 3PY5A 4YSLA 4Z67A 2FHXB 1DXKA 4Z7RA 2Q42A 3VQZA 4B87A 3X30A 2FM6A 5ACWA 2NZEA 4EY2A 2WYMC 1X8IA 1JJTA 2E7YA 4C1FA 1QH3A 5FQAA 1SMLA 5LCAA 5HIPA 2I7TA 5A0VA 2BFZB 4ZO2A 3IE2A 3MD7A 2CG3A 4J5FA 5LCFA 2Q0IA 5K4KA 4Z5YA 3SPUA 4PVOA 5HH5A 2BG7A 2GMNA 4HL2A 2QEDA 3X2YA 3AF5A 2YNUA 2WHGA 3SBLA 3KL7A 4C09A 3FCZA 4XUKA 4AD9A 4PVTA 4DILA 3DH8A 4TZEA 3I0VA 4H0DA 2OHHA 3PY6A 1P9EA 1KO2A 1QH5A 4Z60A 2Q0JA 2QDTA 1YCFA 4UA4A 3KNSA 3IOFA 2BFLA 2P4ZA 2BG8B 3KNRA 4V0HA 4GYUA 2ZO4A 5KILA 3DHAA 4EXSA 2FHXA 5DPXA 3DHBA 2UYXA 2AIOA 4RAMA 3BC2A 2P97A 4NQ5A 4RL0A 4AWYB 5LLDA 4CHLA 4RBSA 2ZNBA 3AF6A 5KIKA 1WW1A 3IEKA 4GCWA 5K4MA 2FU9A 4D1WA 4J5HA 5EW0A 3IDZA 1ZTCA 4ZEJA 5AYAA 2QINA 5LSCA 4EYFA 2AZ4A 1JJEA 5LE1A 5ACXA 4DIKA 3ESHA 2Y8BA 2BG8A 4TYTA 1L9YA 4XWWA 3RKKA 4AX0B 4BZ3A 4D1UA 5HH4A 3S0ZA 4NQ6A 2GKLA 1X8HA 2BFKA 3F9OA 4C1CA 4GYQA 1ZKPA 5ACSA 3L6NA 5EVDA 3G1PA 5ACQA 2NYPA 4TYFA 3VPEA 4WD6A 2GFJA 2YNTA 4UWOB 4ZNBA 4C1EA 4D1VA 5IQKA 1VGNA 2QDSA 2CG2A 4LE6A 3WXCA 2DKFA 2XF4A 1A8TA 2GCUA 2NXAA 4AV7A 4KEPA 2FU7A 3ZWFA 4U4LA 5EHTA 1A7TA 1YCGA 5EV8A 4AWZA 5A87A 4UWPB 3ADRA 2BMIA 3ZNBA 4EYBA 1BC2A 2YZ3A 5HIOA 2I7VA 2YNVB 2OHIA 3X2ZA 1Y44A 2WRSA 5A5ZA 4BP0A 3RKJA 4C1GA 5B3RA 2YNTB 2ZZIA 4F6HA 2HB9A 3IE1A 2CFUA 3RPCA 3TP9A 4HL1A 4FR7A 5ACUA 2H6AA 3JXPA 5AEBA 3SD9A 5AHRA 2OHJA 3SW3A 2GFKA 3IEMA 4Z5ZA 2BG2A 3T9MA 5EWAA 2BGAA 2M5CA 3IELA 5ACVA 1BVTA 3BK2A 1JT1A 4O98A 4C1DA 3BV6A 5K4NA 2XR1A 1WRAA 1X8GA 4AXHA 4P62A 4JO0A 1HLKA 2YNWA 4F6ZA 5ACPA 1VMEA 2CFZA 1KO3A 5B1UA 5HISA 1DD6A 2Q9UA 5AXRA 4TZ9A 5LMCA 4NQ2A 3T3OA 5ACTA 4HKYA 2WYMA 4C1HA 2BFZA 5AXOA 3IE0A 4RAWA 1XM8A 2P1EA 4XWTA 5LS3A 3P2UA 2NZFA 2FU6A 2YNVA 3X2XA 5B15A 4KEQA 4RL2A 4EYLA 2BTNA 4FSBA 4EXYA 3BK1A 3LVZA 2DOOA 1MQOA 4PDXA 5AHOA 1XTOA 5EH9A 2BIBA 3IOGA 4EFZA 1WUPA 4Z6XA 2I7XA 3H3EA 5K0WA 5AJLA 1DDKA 1ZNBA 1VJNA 2FK6A 1KR3A 1WUOA 2BC2A 5EVKA 3PG4A 4UWSB 2QJSA 5AIJA 4YSKA 2WYLA 4UBQA 3FAIA 3ZQ4A 1BMCA 2BR6A 2P18A 5FQBA 5EVBA 4NURA 3R2UA 2YCBA 4FEKA 5HIQA 1YCHA 2A7MA 3SFPA 3I13A 4TZBA 3Q6VA 4NQ4A 2VW8A 3I11A 4YSBA 5LCHA 3ZR9A 3I14A 3I15A 1K07A 2FU8A 5A0TA 5ACRA 3T3NA 2YHEA 4AX1B 1E5DA 5FQCA 3SRXA 2BG6A 4UAMA 5LM6A 2Y8AA 3QH8A 2Y87A 3DHCA 2ZWRA 3AJ3A 1M2XA 4ZO3A
chains in the Genus database with same CATH topology
4D1TA 3A4YA 2CBNA 4TZFA 4UWRB 2R2DA 5HH6A 5EV6A 2M5DA 4RM5A 4D02A 3PY5A 4YSLA 4Z67A 2FHXB 1DXKA 4Z7RA 2Q42A 3VQZA 4B87A 3X30A 2FM6A 5ACWA 2NZEA 4EY2A 2WYMC 1X8IA 1JJTA 2E7YA 4C1FA 1QH3A 5FQAA 1SMLA 5LCAA 5HIPA 2I7TA 5A0VA 2BFZB 4ZO2A 3IE2A 3MD7A 4J5FA 5LCFA 2Q0IA 5K4KA 4Z5YA 3SPUA 4PVOA 5HH5A 2BG7A 2GMNA 4HL2A 2QEDA 3X2YA 3AF5A 2YNUA 2WHGA 3SBLA 3KL7A 4C09A 3FCZA 4XUKA 4AD9A 4PVTA 4DILA 3DH8A 4TZEA 3I0VA 4H0DA 2OHHA 3PY6A 1P9EA 1KO2A 1QH5A 4Z60A 2Q0JA 2QDTA 1YCFA 4UA4A 3KNSA 3IOFA 2BFLA 2P4ZA 2BG8B 3KNRA 4V0HA 4GYUA 2ZO4A 5KILA 3DHAA 4EXSA 2FHXA 5DPXA 3DHBA 2UYXA 2AIOA 4RAMA 3BC2A 2P97A 4NQ5A 4RL0A 4AWYB 5LLDA 4CHLA 4RBSA 2ZNBA 3AF6A 5KIKA 1WW1A 3IEKA 4GCWA 5K4MA 2FU9A 4D1WA 4J5HA 5EW0A 3IDZA 1ZTCA 4ZEJA 5AYAA 2QINA 5LSCA 4EYFA 2AZ4A 1JJEA 5LE1A 5ACXA 4DIKA 3ESHA 2Y8BA 2BG8A 4TYTA 1L9YA 4XWWA 3RKKA 4AX0B 4BZ3A 4D1UA 5HH4A 3S0ZA 4NQ6A 2GKLA 1X8HA 2BFKA 3F9OA 4C1CA 4GYQA 1ZKPA 5ACSA 3L6NA 5EVDA 3G1PA 5ACQA 2NYPA 4TYFA 3VPEA 4WD6A 2GFJA 2YNTA 4UWOB 4ZNBA 4C1EA 4D1VA 5IQKA 1VGNA 2QDSA 4LE6A 3WXCA 2DKFA 2XF4A 1A8TA 2GCUA 2NXAA 4KEPA 2FU7A 3ZWFA 4U4LA 5EHTA 1A7TA 1YCGA 5EV8A 4AWZA 5A87A 4UWPB 3ADRA 2BMIA 3ZNBA 4EYBA 1BC2A 2YZ3A 5HIOA 2I7VA 2YNVB 2OHIA 3X2ZA 1Y44A 2WRSA 5A5ZA 4BP0A 3RKJA 4C1GA 5B3RA 2YNTB 2ZZIA 4F6HA 2HB9A 3IE1A 3RPCA 3TP9A 4HL1A 4FR7A 5ACUA 2H6AA 3JXPA 5AEBA 3SD9A 5AHRA 2OHJA 3SW3A 2GFKA 3IEMA 4Z5ZA 2BG2A 3T9MA 5EWAA 2BGAA 2M5CA 3IELA 5ACVA 1BVTA 3BK2A 1JT1A 4O98A 4C1DA 3BV6A 5K4NA 2XR1A 1WRAA 1X8GA 4P62A 4JO0A 1HLKA 2YNWA 4F6ZA 5ACPA 1VMEA 1KO3A 5B1UA 5HISA 1DD6A 2Q9UA 5AXRA 4TZ9A 5LMCA 4NQ2A 3T3OA 5ACTA 4HKYA 2WYMA 4C1HA 2BFZA 5AXOA 3IE0A 4RAWA 1XM8A 2P1EA 4XWTA 5LS3A 3P2UA 2NZFA 2FU6A 2YNVA 3X2XA 5B15A 4KEQA 4RL2A 4EYLA 2BTNA 4FSBA 4EXYA 3BK1A 3LVZA 2DOOA 1MQOA 5AHOA 1XTOA 5EH9A 2BIBA 3IOGA 4EFZA 1WUPA 4Z6XA 2I7XA 3H3EA 5K0WA 1DDKA 1ZNBA 1VJNA 2FK6A 1KR3A 1WUOA 2BC2A 5EVKA 3PG4A 4UWSB 2QJSA 4YSKA 2WYLA 4UBQA 3FAIA 3ZQ4A 1BMCA 2BR6A 2P18A 5FQBA 5EVBA 3R2UA 2YCBA 4FEKA 5HIQA 1YCHA 2A7MA 3SFPA 3I13A 4TZBA 3Q6VA 4NQ4A 2VW8A 3I11A 4YSBA 5LCHA 3ZR9A 3I14A 3I15A 1K07A 2FU8A 5A0TA 5ACRA 3T3NA 4AX1B 1E5DA 5FQCA 3SRXA 2BG6A 4UAMA 5LM6A 2Y8AA 3QH8A 2Y87A 3DHCA 2ZWRA 3AJ3A 1M2XA 4ZO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1T A;  3A4Y A;  2CBN A;  4TZF A;  4UWR B;  2R2D A;  5HH6 A;  5EV6 A;  2M5D A;  4RM5 A;  4D02 A;  3PY5 A;  4YSL A;  4Z67 A;  2FHX B;  1DXK A;  4Z7R A;  2Q42 A;  3VQZ A;  4B87 A;  3X30 A;  2FM6 A;  5ACW A;  2NZE A;  4EY2 A;  2WYM C;  1X8I A;  1JJT A;  2E7Y A;  4C1F A;  1QH3 A;  5FQA A;  1SML A;  5LCA A;  5HIP A;  2I7T A;  5A0V A;  2BFZ B;  4ZO2 A;  3IE2 A;  3MD7 A;  4J5F A;  5LCF A;  2Q0I A;  5K4K A;  4Z5Y A;  3SPU A;  4PVO A;  5HH5 A;  2BG7 A;  2GMN A;  4HL2 A;  2QED A;  3X2Y A;  3AF5 A;  2YNU A;  2WHG A;  3SBL A;  3KL7 A;  4C09 A;  3FCZ A;  4XUK A;  4AD9 A;  4PVT A;  4DIL A;  3DH8 A;  4TZE A;  3I0V A;  4H0D A;  2OHH A;  3PY6 A;  1P9E A;  1KO2 A;  1QH5 A;  4Z60 A;  2Q0J A;  2QDT A;  1YCF A;  4UA4 A;  3KNS A;  3IOF A;  2BFL A;  2P4Z A;  2BG8 B;  3KNR A;  4V0H A;  4GYU A;  2ZO4 A;  5KIL A;  3DHA A;  4EXS A;  2FHX A;  5DPX A;  3DHB A;  2UYX A;  2AIO A;  4RAM A;  3BC2 A;  2P97 A;  4NQ5 A;  4RL0 A;  4AWY B;  5LLD A;  4CHL A;  4RBS A;  2ZNB A;  3AF6 A;  5KIK A;  1WW1 A;  3IEK A;  4GCW A;  5K4M A;  2FU9 A;  4D1W A;  4J5H A;  5EW0 A;  3IDZ A;  1ZTC A;  4ZEJ A;  5AYA A;  2QIN A;  5LSC A;  4EYF A;  2AZ4 A;  1JJE A;  5LE1 A;  5ACX A;  4DIK A;  3ESH A;  2Y8B A;  2BG8 A;  4TYT A;  1L9Y A;  4XWW A;  3RKK A;  4AX0 B;  4BZ3 A;  4D1U A;  5HH4 A;  3S0Z A;  4NQ6 A;  2GKL A;  1X8H A;  2BFK A;  3F9O A;  4C1C A;  4GYQ A;  1ZKP A;  5ACS A;  3L6N A;  5EVD A;  3G1P A;  5ACQ A;  2NYP A;  4TYF A;  3VPE A;  4WD6 A;  2GFJ A;  2YNT A;  4UWO B;  4ZNB A;  4C1E A;  4D1V A;  5IQK A;  1VGN A;  2QDS A;  4LE6 A;  3WXC A;  2DKF A;  2XF4 A;  1A8T A;  2GCU A;  2NXA A;  4KEP A;  2FU7 A;  3ZWF A;  4U4L A;  5EHT A;  1A7T A;  1YCG A;  5EV8 A;  4AWZ A;  5A87 A;  4UWP B;  3ADR A;  2BMI A;  3ZNB A;  4EYB A;  1BC2 A;  2YZ3 A;  5HIO A;  2I7V A;  2YNV B;  2OHI A;  3X2Z A;  1Y44 A;  2WRS A;  5A5Z A;  4BP0 A;  3RKJ A;  4C1G A;  5B3R A;  2YNT B;  2ZZI A;  4F6H A;  2HB9 A;  3IE1 A;  3RPC A;  3TP9 A;  4HL1 A;  4FR7 A;  5ACU A;  2H6A A;  3JXP A;  5AEB A;  3SD9 A;  5AHR A;  2OHJ A;  3SW3 A;  2GFK A;  3IEM A;  4Z5Z A;  2BG2 A;  3T9M A;  5EWA A;  2BGA A;  2M5C A;  3IEL A;  5ACV A;  1BVT A;  3BK2 A;  1JT1 A;  4O98 A;  4C1D A;  3BV6 A;  5K4N A;  2XR1 A;  1WRA A;  1X8G A;  4P62 A;  4JO0 A;  1HLK A;  2YNW A;  4F6Z A;  5ACP A;  1VME A;  1KO3 A;  5B1U A;  5HIS A;  1DD6 A;  2Q9U A;  5AXR A;  4TZ9 A;  5LMC A;  4NQ2 A;  3T3O A;  5ACT A;  4HKY A;  2WYM A;  4C1H A;  2BFZ A;  5AXO A;  3IE0 A;  4RAW A;  1XM8 A;  2P1E A;  4XWT A;  5LS3 A;  3P2U A;  2NZF A;  2FU6 A;  2YNV A;  3X2X A;  5B15 A;  4KEQ A;  4RL2 A;  4EYL A;  2BTN A;  4FSB A;  4EXY A;  3BK1 A;  3LVZ A;  2DOO A;  1MQO A;  5AHO A;  1XTO A;  5EH9 A;  2BIB A;  3IOG A;  4EFZ A;  1WUP A;  4Z6X A;  2I7X A;  3H3E A;  5K0W A;  1DDK A;  1ZNB A;  1VJN A;  2FK6 A;  1KR3 A;  1WUO A;  2BC2 A;  5EVK A;  3PG4 A;  4UWS B;  2QJS A;  4YSK A;  2WYL A;  4UBQ A;  3FAI A;  3ZQ4 A;  1BMC A;  2BR6 A;  2P18 A;  5FQB A;  5EVB A;  3R2U A;  2YCB A;  4FEK A;  5HIQ A;  1YCH A;  2A7M A;  3SFP A;  3I13 A;  4TZB A;  3Q6V A;  4NQ4 A;  2VW8 A;  3I11 A;  4YSB A;  5LCH A;  3ZR9 A;  3I14 A;  3I15 A;  1K07 A;  2FU8 A;  5A0T A;  5ACR A;  3T3N A;  4AX1 B;  1E5D A;  5FQC A;  3SRX A;  2BG6 A;  4UAM A;  5LM6 A;  2Y8A A;  3QH8 A;  2Y87 A;  3DHC A;  2ZWR A;  3AJ3 A;  1M2X A;  4ZO3 A; 
#chains in the Genus database with same CATH topology
 5A23 A;  4D1T A;  3A4Y A;  2CBN A;  4TZF A;  4UWR B;  2R2D A;  5HH6 A;  5EV6 A;  2M5D A;  4RM5 A;  4D02 A;  3PY5 A;  4YSL A;  4Z67 A;  2FHX B;  1DXK A;  4Z7R A;  2Q42 A;  3VQZ A;  4B87 A;  3X30 A;  2FM6 A;  5ACW A;  2NZE A;  4EY2 A;  2WYM C;  1X8I A;  1JJT A;  2E7Y A;  4C1F A;  1QH3 A;  5FQA A;  1SML A;  5LCA A;  5HIP A;  2I7T A;  5A0V A;  2BFZ B;  4ZO2 A;  3IE2 A;  3MD7 A;  2CG3 A;  4J5F A;  5LCF A;  2Q0I A;  5K4K A;  4Z5Y A;  3SPU A;  4PVO A;  5HH5 A;  2BG7 A;  2GMN A;  4HL2 A;  2QED A;  3X2Y A;  3AF5 A;  2YNU A;  2WHG A;  3SBL A;  3KL7 A;  4C09 A;  3FCZ A;  4XUK A;  4AD9 A;  4PVT A;  4DIL A;  3DH8 A;  4TZE A;  3I0V A;  4H0D A;  2OHH A;  3PY6 A;  1P9E A;  1KO2 A;  1QH5 A;  4Z60 A;  2Q0J A;  2QDT A;  1YCF A;  4UA4 A;  3KNS A;  3IOF A;  2BFL A;  2P4Z A;  2BG8 B;  3KNR A;  4V0H A;  4GYU A;  2ZO4 A;  5KIL A;  3DHA A;  4EXS A;  2FHX A;  5DPX A;  3DHB A;  2UYX A;  2AIO A;  4RAM A;  3BC2 A;  2P97 A;  4NQ5 A;  4RL0 A;  4AWY B;  5LLD A;  4CHL A;  4RBS A;  2ZNB A;  3AF6 A;  5KIK A;  1WW1 A;  3IEK A;  4GCW A;  5K4M A;  2FU9 A;  4D1W A;  4J5H A;  5EW0 A;  3IDZ A;  1ZTC A;  4ZEJ A;  5AYA A;  2QIN A;  5LSC A;  4EYF A;  2AZ4 A;  1JJE A;  5LE1 A;  5ACX A;  4DIK A;  3ESH A;  2Y8B A;  2BG8 A;  4TYT A;  1L9Y A;  4XWW A;  3RKK A;  4AX0 B;  4BZ3 A;  4D1U A;  5HH4 A;  3S0Z A;  4NQ6 A;  2GKL A;  1X8H A;  2BFK A;  3F9O A;  4C1C A;  4GYQ A;  1ZKP A;  5ACS A;  3L6N A;  5EVD A;  3G1P A;  5ACQ A;  2NYP A;  4TYF A;  3VPE A;  4WD6 A;  2GFJ A;  2YNT A;  4UWO B;  4ZNB A;  4C1E A;  4D1V A;  5IQK A;  1VGN A;  2QDS A;  2CG2 A;  4LE6 A;  3WXC A;  2DKF A;  2XF4 A;  1A8T A;  2GCU A;  2NXA A;  4AV7 A;  4KEP A;  2FU7 A;  3ZWF A;  4U4L A;  5EHT A;  1A7T A;  1YCG A;  5EV8 A;  4AWZ A;  5A87 A;  4UWP B;  3ADR A;  2BMI A;  3ZNB A;  4EYB A;  1BC2 A;  2YZ3 A;  5HIO A;  2I7V A;  2YNV B;  2OHI A;  3X2Z A;  1Y44 A;  2WRS A;  5A5Z A;  4BP0 A;  3RKJ A;  4C1G A;  5B3R A;  2YNT B;  2ZZI A;  4F6H A;  2HB9 A;  3IE1 A;  2CFU A;  3RPC A;  3TP9 A;  4HL1 A;  4FR7 A;  5ACU A;  2H6A A;  3JXP A;  5AEB A;  3SD9 A;  5AHR A;  2OHJ A;  3SW3 A;  2GFK A;  3IEM A;  4Z5Z A;  2BG2 A;  3T9M A;  5EWA A;  2BGA A;  2M5C A;  3IEL A;  5ACV A;  1BVT A;  3BK2 A;  1JT1 A;  4O98 A;  4C1D A;  3BV6 A;  5K4N A;  2XR1 A;  1WRA A;  1X8G A;  4AXH A;  4P62 A;  4JO0 A;  1HLK A;  2YNW A;  4F6Z A;  5ACP A;  1VME A;  2CFZ A;  1KO3 A;  5B1U A;  5HIS A;  1DD6 A;  2Q9U A;  5AXR A;  4TZ9 A;  5LMC A;  4NQ2 A;  3T3O A;  5ACT A;  4HKY A;  2WYM A;  4C1H A;  2BFZ A;  5AXO A;  3IE0 A;  4RAW A;  1XM8 A;  2P1E A;  4XWT A;  5LS3 A;  3P2U A;  2NZF A;  2FU6 A;  2YNV A;  3X2X A;  5B15 A;  4KEQ A;  4RL2 A;  4EYL A;  2BTN A;  4FSB A;  4EXY A;  3BK1 A;  3LVZ A;  2DOO A;  1MQO A;  4PDX A;  5AHO A;  1XTO A;  5EH9 A;  2BIB A;  3IOG A;  4EFZ A;  1WUP A;  4Z6X A;  2I7X A;  3H3E A;  5K0W A;  5AJL A;  1DDK A;  1ZNB A;  1VJN A;  2FK6 A;  1KR3 A;  1WUO A;  2BC2 A;  5EVK A;  3PG4 A;  4UWS B;  2QJS A;  5AIJ A;  4YSK A;  2WYL A;  4UBQ A;  3FAI A;  3ZQ4 A;  1BMC A;  2BR6 A;  2P18 A;  5FQB A;  5EVB A;  4NUR A;  3R2U A;  2YCB A;  4FEK A;  5HIQ A;  1YCH A;  2A7M A;  3SFP A;  3I13 A;  4TZB A;  3Q6V A;  4NQ4 A;  2VW8 A;  3I11 A;  4YSB A;  5LCH A;  3ZR9 A;  3I14 A;  3I15 A;  1K07 A;  2FU8 A;  5A0T A;  5ACR A;  3T3N A;  2YHE A;  4AX1 B;  1E5D A;  5FQC A;  3SRX A;  2BG6 A;  4UAM A;  5LM6 A;  2Y8A A;  3QH8 A;  2Y87 A;  3DHC A;  2ZWR A;  3AJ3 A;  1M2X A;  4ZO3 A; 
#chains in the Genus database with same CATH homology
 4D1T A;  3A4Y A;  2CBN A;  4TZF A;  4UWR B;  2R2D A;  5HH6 A;  5EV6 A;  2M5D A;  4RM5 A;  4D02 A;  3PY5 A;  4YSL A;  4Z67 A;  2FHX B;  1DXK A;  4Z7R A;  2Q42 A;  3VQZ A;  4B87 A;  3X30 A;  2FM6 A;  5ACW A;  2NZE A;  4EY2 A;  2WYM C;  1X8I A;  1JJT A;  2E7Y A;  4C1F A;  1QH3 A;  5FQA A;  1SML A;  5LCA A;  5HIP A;  2I7T A;  5A0V A;  2BFZ B;  4ZO2 A;  3IE2 A;  3MD7 A;  4J5F A;  5LCF A;  2Q0I A;  5K4K A;  4Z5Y A;  3SPU A;  4PVO A;  5HH5 A;  2BG7 A;  2GMN A;  4HL2 A;  2QED A;  3X2Y A;  3AF5 A;  2YNU A;  2WHG A;  3SBL A;  3KL7 A;  4C09 A;  3FCZ A;  4XUK A;  4AD9 A;  4PVT A;  4DIL A;  3DH8 A;  4TZE A;  3I0V A;  4H0D A;  2OHH A;  3PY6 A;  1P9E A;  1KO2 A;  1QH5 A;  4Z60 A;  2Q0J A;  2QDT A;  1YCF A;  4UA4 A;  3KNS A;  3IOF A;  2BFL A;  2P4Z A;  2BG8 B;  3KNR A;  4V0H A;  4GYU A;  2ZO4 A;  5KIL A;  3DHA A;  4EXS A;  2FHX A;  5DPX A;  3DHB A;  2UYX A;  2AIO A;  4RAM A;  3BC2 A;  2P97 A;  4NQ5 A;  4RL0 A;  4AWY B;  5LLD A;  4CHL A;  4RBS A;  2ZNB A;  3AF6 A;  5KIK A;  1WW1 A;  3IEK A;  4GCW A;  5K4M A;  2FU9 A;  4D1W A;  4J5H A;  5EW0 A;  3IDZ A;  1ZTC A;  4ZEJ A;  5AYA A;  2QIN A;  5LSC A;  4EYF A;  2AZ4 A;  1JJE A;  5LE1 A;  5ACX A;  4DIK A;  3ESH A;  2Y8B A;  2BG8 A;  4TYT A;  1L9Y A;  4XWW A;  3RKK A;  4AX0 B;  4BZ3 A;  4D1U A;  5HH4 A;  3S0Z A;  4NQ6 A;  2GKL A;  1X8H A;  2BFK A;  3F9O A;  4C1C A;  4GYQ A;  1ZKP A;  5ACS A;  3L6N A;  5EVD A;  3G1P A;  5ACQ A;  2NYP A;  4TYF A;  3VPE A;  4WD6 A;  2GFJ A;  2YNT A;  4UWO B;  4ZNB A;  4C1E A;  4D1V A;  5IQK A;  1VGN A;  2QDS A;  4LE6 A;  3WXC A;  2DKF A;  2XF4 A;  1A8T A;  2GCU A;  2NXA A;  4KEP A;  2FU7 A;  3ZWF A;  4U4L A;  5EHT A;  1A7T A;  1YCG A;  5EV8 A;  4AWZ A;  5A87 A;  4UWP B;  3ADR A;  2BMI A;  3ZNB A;  4EYB A;  1BC2 A;  2YZ3 A;  5HIO A;  2I7V A;  2YNV B;  2OHI A;  3X2Z A;  1Y44 A;  2WRS A;  5A5Z A;  4BP0 A;  3RKJ A;  4C1G A;  5B3R A;  2YNT B;  2ZZI A;  4F6H A;  2HB9 A;  3IE1 A;  3RPC A;  3TP9 A;  4HL1 A;  4FR7 A;  5ACU A;  2H6A A;  3JXP A;  5AEB A;  3SD9 A;  5AHR A;  2OHJ A;  3SW3 A;  2GFK A;  3IEM A;  4Z5Z A;  2BG2 A;  3T9M A;  5EWA A;  2BGA A;  2M5C A;  3IEL A;  5ACV A;  1BVT A;  3BK2 A;  1JT1 A;  4O98 A;  4C1D A;  3BV6 A;  5K4N A;  2XR1 A;  1WRA A;  1X8G A;  4P62 A;  4JO0 A;  1HLK A;  2YNW A;  4F6Z A;  5ACP A;  1VME A;  1KO3 A;  5B1U A;  5HIS A;  1DD6 A;  2Q9U A;  5AXR A;  4TZ9 A;  5LMC A;  4NQ2 A;  3T3O A;  5ACT A;  4HKY A;  2WYM A;  4C1H A;  2BFZ A;  5AXO A;  3IE0 A;  4RAW A;  1XM8 A;  2P1E A;  4XWT A;  5LS3 A;  3P2U A;  2NZF A;  2FU6 A;  2YNV A;  3X2X A;  5B15 A;  4KEQ A;  4RL2 A;  4EYL A;  2BTN A;  4FSB A;  4EXY A;  3BK1 A;  3LVZ A;  2DOO A;  1MQO A;  5AHO A;  1XTO A;  5EH9 A;  2BIB A;  3IOG A;  4EFZ A;  1WUP A;  4Z6X A;  2I7X A;  3H3E A;  5K0W A;  1DDK A;  1ZNB A;  1VJN A;  2FK6 A;  1KR3 A;  1WUO A;  2BC2 A;  5EVK A;  3PG4 A;  4UWS B;  2QJS A;  4YSK A;  2WYL A;  4UBQ A;  3FAI A;  3ZQ4 A;  1BMC A;  2BR6 A;  2P18 A;  5FQB A;  5EVB A;  3R2U A;  2YCB A;  4FEK A;  5HIQ A;  1YCH A;  2A7M A;  3SFP A;  3I13 A;  4TZB A;  3Q6V A;  4NQ4 A;  2VW8 A;  3I11 A;  4YSB A;  5LCH A;  3ZR9 A;  3I14 A;  3I15 A;  1K07 A;  2FU8 A;  5A0T A;  5ACR A;  3T3N A;  4AX1 B;  1E5D A;  5FQC A;  3SRX A;  2BG6 A;  4UAM A;  5LM6 A;  2Y8A A;  3QH8 A;  2Y87 A;  3DHC A;  2ZWR A;  3AJ3 A;  1M2X A;  4ZO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...