3MD7A

Crystal structure of a beta-lactamase-like protein bound to gmp from brucella melitensis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BrabA.11339.a: anomalous diffraction and ligand binding guide towards the elucidation of the function of a `putative beta-lactamase-like protein from Brucella melitensis.
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
molecule tags Hydrolase
molecule keywords Beta-lactamase-like
total genus 83
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3md7A00
4Z7RA 5LM6A 1K07A 2Q0JA 4HKYA 4DIKA 1JJTA 3JXPA 2UYXA 3F9OA 4PVOA 4J5FA 1XM8A 4UWSB 5EVKA 4BP0A 3IE0A 4EFZA 4PVTA 4RL2A 4TZBA 2Q0IA 3SD9A 4CHLA 5AXOA 4Z6XA 3SFPA 4DILA 4UWOB 3T3NA 3IOFA 4J5HA 5ACSA 5ACWA 2HB9A 3KNRA 1A7TA 4Z5YA 2BFKA 2WYLA 4EY2A 2QJSA 4EXSA 4AWZA 2YCBA 2OHJA 2P4ZA 3SPUA 2BG8B 4GCWA 3AF6A 4F6ZA 2QINA 3L6NA 3BK2A 4D02A 2ZO4A 2YNVB 4BZ3A 5AXRA 4FSBA 5FQBA 5HIQA 3BK1A 4UBQA 2GMNA 3ESHA 3G1PA 3PY5A 3T9MA 3IDZA 4AD9A 5LE1A 2E7YA 4WD6A 4HL1A 5HH4A 2M5DA 4GYQA 2Q9UA 4YSKA 4UWPB 5AEBA 1KO3A 2YNWA 2BFZA 3BC2A 3X2YA 4C1GA 1JJEA 2P1EA 2NXAA 4TZFA 2YNVA 3ADRA 5FQAA 4AX0B 5EWAA 4XWTA 1E5DA 2QDSA 1BMCA 4U4LA 2XR1A 2BFLA 2OHHA 5K4NA 3ZR9A 2FU6A 3X2ZA 3TP9A 4Z5ZA 4C1FA 2GCUA 2VW8A 4AX1B 1ZNBA 2FK6A 4UAMA 2BG6A 2ZWRA 1VJNA 3VPEA 3DHBA 4C1HA 5KIKA 5ACQA 2BTNA 2FM6A 3AJ3A 2A7MA 3DH8A 5AYAA 4C1DA 4FEKA 1X8HA 4NQ5A 2ZNBA 1WRAA 5DPXA 4TYTA 3IOGA 3SW3A 4KEQA 4B87A 5B1UA 4D1WA 4ZEJA 3H3EA 3KNSA 3RPCA 4NQ4A 3IE2A 3RKJA 2QDTA 5FQCA 3KL7A 1A8TA 2BGAA 2ZZIA 2BR6A 3I11A 5A5ZA 3R2UA 4EXYA 4HL2A 2XF4A 3FAIA 4ZO3A 5IQKA 4GYUA 1WW1A 2OHIA 3A4YA 5A0TA 3VQZA 2FHXA 5LMCA 2BG8A 1BVTA 5ACVA 1Y44A 4C1CA 4V0HA 4C09A 2CBNA 2YZ3A 5ACPA 1WUOA 5B15A 1JT1A 5HISA 3DHCA 3RKKA 1M2XA 3IEMA 5AHRA 5A0VA 3I14A 3BV6A 4NQ6A 5LCAA 1BC2A 2I7VA 1QH3A 5EVDA 3SBLA 1YCHA 2FU8A 2WRSA 4EYLA 4C1EA 2YNTA 3MD7A 2NYPA 2FHXB 3AF5A 4AWYB 5ACXA 4O98A 5LS3A 4ZO2A 5EV6A 4KEPA 4FR7A 5B3RA 5LCFA 2AIOA 3X2XA 3I0VA 4TYFA 1DXKA 2GFJA 3IELA 4JO0A 4D1TA 2QEDA 4F6HA 3PG4A 1L9YA 4TZ9A 5LLDA 2H6AA 4D1UA 3FCZA 4P62A 5EV8A 1MQOA 2WHGA 2YNTB 3T3OA 1ZTCA 2GFKA 2DOOA 4RM5A 4EYFA 2M5CA 4RL0A 5EW0A 4UWRB 5K4MA 1YCFA 3ZQ4A 1X8IA 1HLKA 2WYMC 5LCHA 5LSCA 5AHOA 4TZEA 2R2DA 4YSBA 1VGNA 1ZKPA 4LE6A 5EVBA 2FU7A 5HH6A 4Z60A 3LVZA 2BC2A 4D1VA 1YCGA 1SMLA 2FU9A 1P9EA 2BFZB 3I13A 1QH5A 1WUPA 2BG2A 3IE1A 5EH9A 2AZ4A 1VMEA 2BG7A 5HIOA 4RAMA 3ZWFA 3X30A 2Y87A 4RBSA 3S0ZA 3IEKA 5ACRA 4ZNBA 2NZFA 1DDKA 2Y8AA 5KILA 5HH5A 3I15A 2I7TA 5K4KA 2Q42A 3ZNBA 2P97A 2WYMA 5HIPA 4XWWA 2YNUA 1DD6A 4H0DA 5A87A 3DHAA 4EYBA 2I7XA 2BIBA 1KR3A 5K0WA 4RAWA 2NZEA 2GKLA 4UA4A 3SRXA 2DKFA 5ACUA 1XTOA 4YSLA 3PY6A 5ACTA 4Z67A 1X8GA 3QH8A 3P2UA 2Y8BA 1KO2A 4NQ2A 2P18A 4XUKA 3WXCA 5EHTA 2BMIA 3Q6VA
chains in the Genus database with same CATH superfamily
4Z7RA 5LM6A 1K07A 2Q0JA 4HKYA 4DIKA 1JJTA 3JXPA 2UYXA 5AIJA 3F9OA 4PVOA 4J5FA 1XM8A 4UWSB 5EVKA 4BP0A 3IE0A 4EFZA 4PVTA 4RL2A 4TZBA 2Q0IA 3SD9A 4CHLA 2CG3A 5AXOA 4Z6XA 3SFPA 4DILA 4UWOB 3T3NA 3IOFA 4J5HA 5ACSA 5ACWA 4AV7A 2HB9A 3KNRA 1A7TA 4Z5YA 2BFKA 2WYLA 4EY2A 2QJSA 4EXSA 4AWZA 2YCBA 2OHJA 2P4ZA 3SPUA 2BG8B 4GCWA 3AF6A 4F6ZA 2QINA 3L6NA 3BK2A 4D02A 2ZO4A 2YNVB 4BZ3A 5AXRA 4FSBA 5FQBA 5HIQA 3BK1A 4UBQA 2GMNA 3ESHA 3G1PA 3PY5A 4NURA 3T9MA 3IDZA 4AD9A 5LE1A 2E7YA 4WD6A 4HL1A 5HH4A 2M5DA 4GYQA 2Q9UA 4YSKA 4UWPB 5AEBA 1KO3A 2YNWA 2BFZA 3BC2A 3X2YA 4C1GA 1JJEA 2P1EA 4PDXA 2NXAA 4TZFA 2YNVA 3ADRA 5FQAA 4AX0B 5EWAA 4XWTA 2CFZA 1E5DA 2QDSA 1BMCA 4U4LA 2XR1A 2BFLA 2OHHA 5K4NA 3ZR9A 2FU6A 3X2ZA 3TP9A 4Z5ZA 4C1FA 2GCUA 2VW8A 4AX1B 5A23A 1ZNBA 2FK6A 4UAMA 2BG6A 2ZWRA 1VJNA 3VPEA 3DHBA 4C1HA 5KIKA 5ACQA 2BTNA 2FM6A 3AJ3A 2A7MA 3DH8A 5AYAA 4C1DA 4FEKA 1X8HA 4NQ5A 2ZNBA 1WRAA 5DPXA 4TYTA 3IOGA 3SW3A 4KEQA 4B87A 5B1UA 2CG2A 4D1WA 4ZEJA 3H3EA 3KNSA 3RPCA 4NQ4A 3IE2A 3RKJA 2QDTA 5FQCA 3KL7A 1A8TA 2BGAA 2ZZIA 2BR6A 3I11A 5A5ZA 3R2UA 4EXYA 4HL2A 2XF4A 3FAIA 4ZO3A 5IQKA 4GYUA 1WW1A 2OHIA 3A4YA 5A0TA 3VQZA 2FHXA 5LMCA 2BG8A 1BVTA 5ACVA 1Y44A 4C1CA 4V0HA 4C09A 2CBNA 2YZ3A 5ACPA 1WUOA 5B15A 1JT1A 5HISA 3DHCA 3RKKA 1M2XA 3IEMA 5AHRA 5A0VA 3I14A 3BV6A 4NQ6A 5LCAA 1BC2A 2I7VA 1QH3A 5EVDA 3SBLA 1YCHA 2FU8A 2WRSA 4AXHA 2YHEA 4EYLA 4C1EA 2YNTA 3MD7A 2NYPA 2FHXB 3AF5A 4AWYB 5ACXA 4O98A 5LS3A 4ZO2A 5EV6A 4KEPA 4FR7A 5B3RA 5LCFA 2AIOA 3X2XA 3I0VA 4TYFA 1DXKA 2GFJA 3IELA 4JO0A 4D1TA 2QEDA 4F6HA 3PG4A 1L9YA 4TZ9A 5LLDA 2H6AA 4D1UA 3FCZA 4P62A 5EV8A 1MQOA 2WHGA 2YNTB 3T3OA 1ZTCA 2CFUA 2GFKA 2DOOA 4RM5A 4EYFA 2M5CA 4RL0A 5EW0A 4UWRB 5K4MA 1YCFA 3ZQ4A 1X8IA 1HLKA 2WYMC 5LCHA 5LSCA 5AHOA 4TZEA 2R2DA 4YSBA 1VGNA 1ZKPA 4LE6A 5EVBA 2FU7A 5HH6A 4Z60A 3LVZA 2BC2A 4D1VA 1YCGA 1SMLA 2FU9A 1P9EA 2BFZB 3I13A 1QH5A 1WUPA 2BG2A 3IE1A 5EH9A 2AZ4A 1VMEA 2BG7A 5HIOA 4RAMA 3ZWFA 3X30A 2Y87A 4RBSA 3S0ZA 3IEKA 5ACRA 4ZNBA 2NZFA 1DDKA 2Y8AA 5KILA 5HH5A 3I15A 2I7TA 5K4KA 2Q42A 3ZNBA 2P97A 2WYMA 5HIPA 4XWWA 2YNUA 1DD6A 4H0DA 5A87A 3DHAA 4EYBA 2I7XA 2BIBA 1KR3A 5K0WA 4RAWA 2NZEA 2GKLA 4UA4A 5AJLA 3SRXA 2DKFA 5ACUA 1XTOA 4YSLA 3PY6A 5ACTA 4Z67A 1X8GA 3QH8A 3P2UA 2Y8BA 1KO2A 4NQ2A 2P18A 4XUKA 3WXCA 5EHTA 2BMIA 3Q6VA
chains in the Genus database with same CATH topology
4Z7RA 5LM6A 1K07A 2Q0JA 4HKYA 4DIKA 1JJTA 3JXPA 2UYXA 3F9OA 4PVOA 4J5FA 1XM8A 4UWSB 5EVKA 4BP0A 3IE0A 4EFZA 4PVTA 4RL2A 4TZBA 2Q0IA 3SD9A 4CHLA 5AXOA 4Z6XA 3SFPA 4DILA 4UWOB 3T3NA 3IOFA 4J5HA 5ACSA 5ACWA 2HB9A 3KNRA 1A7TA 4Z5YA 2BFKA 2WYLA 4EY2A 2QJSA 4EXSA 4AWZA 2YCBA 2OHJA 2P4ZA 3SPUA 2BG8B 4GCWA 3AF6A 4F6ZA 2QINA 3L6NA 3BK2A 4D02A 2ZO4A 2YNVB 4BZ3A 5AXRA 4FSBA 5FQBA 5HIQA 3BK1A 4UBQA 2GMNA 3ESHA 3G1PA 3PY5A 3T9MA 3IDZA 4AD9A 5LE1A 2E7YA 4WD6A 4HL1A 5HH4A 2M5DA 4GYQA 2Q9UA 4YSKA 4UWPB 5AEBA 1KO3A 2YNWA 2BFZA 3BC2A 3X2YA 4C1GA 1JJEA 2P1EA 2NXAA 4TZFA 2YNVA 3ADRA 5FQAA 4AX0B 5EWAA 4XWTA 1E5DA 2QDSA 1BMCA 4U4LA 2XR1A 2BFLA 2OHHA 5K4NA 3ZR9A 2FU6A 3X2ZA 3TP9A 4Z5ZA 4C1FA 2GCUA 2VW8A 4AX1B 1ZNBA 2FK6A 4UAMA 2BG6A 2ZWRA 1VJNA 3VPEA 3DHBA 4C1HA 5KIKA 5ACQA 2BTNA 2FM6A 3AJ3A 2A7MA 3DH8A 5AYAA 4C1DA 4FEKA 1X8HA 4NQ5A 2ZNBA 1WRAA 5DPXA 4TYTA 3IOGA 3SW3A 4KEQA 4B87A 5B1UA 4D1WA 4ZEJA 3H3EA 3KNSA 3RPCA 4NQ4A 3IE2A 3RKJA 2QDTA 5FQCA 3KL7A 1A8TA 2BGAA 2ZZIA 2BR6A 3I11A 5A5ZA 3R2UA 4EXYA 4HL2A 2XF4A 3FAIA 4ZO3A 5IQKA 4GYUA 1WW1A 2OHIA 3A4YA 5A0TA 3VQZA 2FHXA 5LMCA 2BG8A 1BVTA 5ACVA 1Y44A 4C1CA 4V0HA 4C09A 2CBNA 2YZ3A 5ACPA 1WUOA 5B15A 1JT1A 5HISA 3DHCA 3RKKA 1M2XA 3IEMA 5AHRA 5A0VA 3I14A 3BV6A 4NQ6A 5LCAA 1BC2A 2I7VA 1QH3A 5EVDA 3SBLA 1YCHA 2FU8A 2WRSA 4EYLA 4C1EA 2YNTA 3MD7A 2NYPA 2FHXB 3AF5A 4AWYB 5ACXA 4O98A 5LS3A 4ZO2A 5EV6A 4KEPA 4FR7A 5B3RA 5LCFA 2AIOA 3X2XA 3I0VA 4TYFA 1DXKA 2GFJA 3IELA 4JO0A 4D1TA 2QEDA 4F6HA 3PG4A 1L9YA 4TZ9A 5LLDA 2H6AA 4D1UA 3FCZA 4P62A 5EV8A 1MQOA 2WHGA 2YNTB 3T3OA 1ZTCA 2GFKA 2DOOA 4RM5A 4EYFA 2M5CA 4RL0A 5EW0A 4UWRB 5K4MA 1YCFA 3ZQ4A 1X8IA 1HLKA 2WYMC 5LCHA 5LSCA 5AHOA 4TZEA 2R2DA 4YSBA 1VGNA 1ZKPA 4LE6A 5EVBA 2FU7A 5HH6A 4Z60A 3LVZA 2BC2A 4D1VA 1YCGA 1SMLA 2FU9A 1P9EA 2BFZB 3I13A 1QH5A 1WUPA 2BG2A 3IE1A 5EH9A 2AZ4A 1VMEA 2BG7A 5HIOA 4RAMA 3ZWFA 3X30A 2Y87A 4RBSA 3S0ZA 3IEKA 5ACRA 4ZNBA 2NZFA 1DDKA 2Y8AA 5KILA 5HH5A 3I15A 2I7TA 5K4KA 2Q42A 3ZNBA 2P97A 2WYMA 5HIPA 4XWWA 2YNUA 1DD6A 4H0DA 5A87A 3DHAA 4EYBA 2I7XA 2BIBA 1KR3A 5K0WA 4RAWA 2NZEA 2GKLA 4UA4A 3SRXA 2DKFA 5ACUA 1XTOA 4YSLA 3PY6A 5ACTA 4Z67A 1X8GA 3QH8A 3P2UA 2Y8BA 1KO2A 4NQ2A 2P18A 4XUKA 3WXCA 5EHTA 2BMIA 3Q6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7R A;  5LM6 A;  1K07 A;  2Q0J A;  4HKY A;  4DIK A;  1JJT A;  3JXP A;  2UYX A;  3F9O A;  4PVO A;  4J5F A;  1XM8 A;  4UWS B;  5EVK A;  4BP0 A;  3IE0 A;  4EFZ A;  4PVT A;  4RL2 A;  4TZB A;  2Q0I A;  3SD9 A;  4CHL A;  5AXO A;  4Z6X A;  3SFP A;  4DIL A;  4UWO B;  3T3N A;  3IOF A;  4J5H A;  5ACS A;  5ACW A;  2HB9 A;  3KNR A;  1A7T A;  4Z5Y A;  2BFK A;  2WYL A;  4EY2 A;  2QJS A;  4EXS A;  4AWZ A;  2YCB A;  2OHJ A;  2P4Z A;  3SPU A;  2BG8 B;  4GCW A;  3AF6 A;  4F6Z A;  2QIN A;  3L6N A;  3BK2 A;  4D02 A;  2ZO4 A;  2YNV B;  4BZ3 A;  5AXR A;  4FSB A;  5FQB A;  5HIQ A;  3BK1 A;  4UBQ A;  2GMN A;  3ESH A;  3G1P A;  3PY5 A;  3T9M A;  3IDZ A;  4AD9 A;  5LE1 A;  2E7Y A;  4WD6 A;  4HL1 A;  5HH4 A;  2M5D A;  4GYQ A;  2Q9U A;  4YSK A;  4UWP B;  5AEB A;  1KO3 A;  2YNW A;  2BFZ A;  3BC2 A;  3X2Y A;  4C1G A;  1JJE A;  2P1E A;  2NXA A;  4TZF A;  2YNV A;  3ADR A;  5FQA A;  4AX0 B;  5EWA A;  4XWT A;  1E5D A;  2QDS A;  1BMC A;  4U4L A;  2XR1 A;  2BFL A;  2OHH A;  5K4N A;  3ZR9 A;  2FU6 A;  3X2Z A;  3TP9 A;  4Z5Z A;  4C1F A;  2GCU A;  2VW8 A;  4AX1 B;  1ZNB A;  2FK6 A;  4UAM A;  2BG6 A;  2ZWR A;  1VJN A;  3VPE A;  3DHB A;  4C1H A;  5KIK A;  5ACQ A;  2BTN A;  2FM6 A;  3AJ3 A;  2A7M A;  3DH8 A;  5AYA A;  4C1D A;  4FEK A;  1X8H A;  4NQ5 A;  2ZNB A;  1WRA A;  5DPX A;  4TYT A;  3IOG A;  3SW3 A;  4KEQ A;  4B87 A;  5B1U A;  4D1W A;  4ZEJ A;  3H3E A;  3KNS A;  3RPC A;  4NQ4 A;  3IE2 A;  3RKJ A;  2QDT A;  5FQC A;  3KL7 A;  1A8T A;  2BGA A;  2ZZI A;  2BR6 A;  3I11 A;  5A5Z A;  3R2U A;  4EXY A;  4HL2 A;  2XF4 A;  3FAI A;  4ZO3 A;  5IQK A;  4GYU A;  1WW1 A;  2OHI A;  3A4Y A;  5A0T A;  3VQZ A;  2FHX A;  5LMC A;  2BG8 A;  1BVT A;  5ACV A;  1Y44 A;  4C1C A;  4V0H A;  4C09 A;  2CBN A;  2YZ3 A;  5ACP A;  1WUO A;  5B15 A;  1JT1 A;  5HIS A;  3DHC A;  3RKK A;  1M2X A;  3IEM A;  5AHR A;  5A0V A;  3I14 A;  3BV6 A;  4NQ6 A;  5LCA A;  1BC2 A;  2I7V A;  1QH3 A;  5EVD A;  3SBL A;  1YCH A;  2FU8 A;  2WRS A;  4EYL A;  4C1E A;  2YNT A;  3MD7 A;  2NYP A;  2FHX B;  3AF5 A;  4AWY B;  5ACX A;  4O98 A;  5LS3 A;  4ZO2 A;  5EV6 A;  4KEP A;  4FR7 A;  5B3R A;  5LCF A;  2AIO A;  3X2X A;  3I0V A;  4TYF A;  1DXK A;  2GFJ A;  3IEL A;  4JO0 A;  4D1T A;  2QED A;  4F6H A;  3PG4 A;  1L9Y A;  4TZ9 A;  5LLD A;  2H6A A;  4D1U A;  3FCZ A;  4P62 A;  5EV8 A;  1MQO A;  2WHG A;  2YNT B;  3T3O A;  1ZTC A;  2GFK A;  2DOO A;  4RM5 A;  4EYF A;  2M5C A;  4RL0 A;  5EW0 A;  4UWR B;  5K4M A;  1YCF A;  3ZQ4 A;  1X8I A;  1HLK A;  2WYM C;  5LCH A;  5LSC A;  5AHO A;  4TZE A;  2R2D A;  4YSB A;  1VGN A;  1ZKP A;  4LE6 A;  5EVB A;  2FU7 A;  5HH6 A;  4Z60 A;  3LVZ A;  2BC2 A;  4D1V A;  1YCG A;  1SML A;  2FU9 A;  1P9E A;  2BFZ B;  3I13 A;  1QH5 A;  1WUP A;  2BG2 A;  3IE1 A;  5EH9 A;  2AZ4 A;  1VME A;  2BG7 A;  5HIO A;  4RAM A;  3ZWF A;  3X30 A;  2Y87 A;  4RBS A;  3S0Z A;  3IEK A;  5ACR A;  4ZNB A;  2NZF A;  1DDK A;  2Y8A A;  5KIL A;  5HH5 A;  3I15 A;  2I7T A;  5K4K A;  2Q42 A;  3ZNB A;  2P97 A;  2WYM A;  5HIP A;  4XWW A;  2YNU A;  1DD6 A;  4H0D A;  5A87 A;  3DHA A;  4EYB A;  2I7X A;  2BIB A;  1KR3 A;  5K0W A;  4RAW A;  2NZE A;  2GKL A;  4UA4 A;  3SRX A;  2DKF A;  5ACU A;  1XTO A;  4YSL A;  3PY6 A;  5ACT A;  4Z67 A;  1X8G A;  3QH8 A;  3P2U A;  2Y8B A;  1KO2 A;  4NQ2 A;  2P18 A;  4XUK A;  3WXC A;  5EHT A;  2BMI A;  3Q6V A; 
#chains in the Genus database with same CATH topology
 4Z7R A;  5LM6 A;  1K07 A;  2Q0J A;  4HKY A;  4DIK A;  1JJT A;  3JXP A;  2UYX A;  5AIJ A;  3F9O A;  4PVO A;  4J5F A;  1XM8 A;  4UWS B;  5EVK A;  4BP0 A;  3IE0 A;  4EFZ A;  4PVT A;  4RL2 A;  4TZB A;  2Q0I A;  3SD9 A;  4CHL A;  2CG3 A;  5AXO A;  4Z6X A;  3SFP A;  4DIL A;  4UWO B;  3T3N A;  3IOF A;  4J5H A;  5ACS A;  5ACW A;  4AV7 A;  2HB9 A;  3KNR A;  1A7T A;  4Z5Y A;  2BFK A;  2WYL A;  4EY2 A;  2QJS A;  4EXS A;  4AWZ A;  2YCB A;  2OHJ A;  2P4Z A;  3SPU A;  2BG8 B;  4GCW A;  3AF6 A;  4F6Z A;  2QIN A;  3L6N A;  3BK2 A;  4D02 A;  2ZO4 A;  2YNV B;  4BZ3 A;  5AXR A;  4FSB A;  5FQB A;  5HIQ A;  3BK1 A;  4UBQ A;  2GMN A;  3ESH A;  3G1P A;  3PY5 A;  4NUR A;  3T9M A;  3IDZ A;  4AD9 A;  5LE1 A;  2E7Y A;  4WD6 A;  4HL1 A;  5HH4 A;  2M5D A;  4GYQ A;  2Q9U A;  4YSK A;  4UWP B;  5AEB A;  1KO3 A;  2YNW A;  2BFZ A;  3BC2 A;  3X2Y A;  4C1G A;  1JJE A;  2P1E A;  4PDX A;  2NXA A;  4TZF A;  2YNV A;  3ADR A;  5FQA A;  4AX0 B;  5EWA A;  4XWT A;  2CFZ A;  1E5D A;  2QDS A;  1BMC A;  4U4L A;  2XR1 A;  2BFL A;  2OHH A;  5K4N A;  3ZR9 A;  2FU6 A;  3X2Z A;  3TP9 A;  4Z5Z A;  4C1F A;  2GCU A;  2VW8 A;  4AX1 B;  5A23 A;  1ZNB A;  2FK6 A;  4UAM A;  2BG6 A;  2ZWR A;  1VJN A;  3VPE A;  3DHB A;  4C1H A;  5KIK A;  5ACQ A;  2BTN A;  2FM6 A;  3AJ3 A;  2A7M A;  3DH8 A;  5AYA A;  4C1D A;  4FEK A;  1X8H A;  4NQ5 A;  2ZNB A;  1WRA A;  5DPX A;  4TYT A;  3IOG A;  3SW3 A;  4KEQ A;  4B87 A;  5B1U A;  2CG2 A;  4D1W A;  4ZEJ A;  3H3E A;  3KNS A;  3RPC A;  4NQ4 A;  3IE2 A;  3RKJ A;  2QDT A;  5FQC A;  3KL7 A;  1A8T A;  2BGA A;  2ZZI A;  2BR6 A;  3I11 A;  5A5Z A;  3R2U A;  4EXY A;  4HL2 A;  2XF4 A;  3FAI A;  4ZO3 A;  5IQK A;  4GYU A;  1WW1 A;  2OHI A;  3A4Y A;  5A0T A;  3VQZ A;  2FHX A;  5LMC A;  2BG8 A;  1BVT A;  5ACV A;  1Y44 A;  4C1C A;  4V0H A;  4C09 A;  2CBN A;  2YZ3 A;  5ACP A;  1WUO A;  5B15 A;  1JT1 A;  5HIS A;  3DHC A;  3RKK A;  1M2X A;  3IEM A;  5AHR A;  5A0V A;  3I14 A;  3BV6 A;  4NQ6 A;  5LCA A;  1BC2 A;  2I7V A;  1QH3 A;  5EVD A;  3SBL A;  1YCH A;  2FU8 A;  2WRS A;  4AXH A;  2YHE A;  4EYL A;  4C1E A;  2YNT A;  3MD7 A;  2NYP A;  2FHX B;  3AF5 A;  4AWY B;  5ACX A;  4O98 A;  5LS3 A;  4ZO2 A;  5EV6 A;  4KEP A;  4FR7 A;  5B3R A;  5LCF A;  2AIO A;  3X2X A;  3I0V A;  4TYF A;  1DXK A;  2GFJ A;  3IEL A;  4JO0 A;  4D1T A;  2QED A;  4F6H A;  3PG4 A;  1L9Y A;  4TZ9 A;  5LLD A;  2H6A A;  4D1U A;  3FCZ A;  4P62 A;  5EV8 A;  1MQO A;  2WHG A;  2YNT B;  3T3O A;  1ZTC A;  2CFU A;  2GFK A;  2DOO A;  4RM5 A;  4EYF A;  2M5C A;  4RL0 A;  5EW0 A;  4UWR B;  5K4M A;  1YCF A;  3ZQ4 A;  1X8I A;  1HLK A;  2WYM C;  5LCH A;  5LSC A;  5AHO A;  4TZE A;  2R2D A;  4YSB A;  1VGN A;  1ZKP A;  4LE6 A;  5EVB A;  2FU7 A;  5HH6 A;  4Z60 A;  3LVZ A;  2BC2 A;  4D1V A;  1YCG A;  1SML A;  2FU9 A;  1P9E A;  2BFZ B;  3I13 A;  1QH5 A;  1WUP A;  2BG2 A;  3IE1 A;  5EH9 A;  2AZ4 A;  1VME A;  2BG7 A;  5HIO A;  4RAM A;  3ZWF A;  3X30 A;  2Y87 A;  4RBS A;  3S0Z A;  3IEK A;  5ACR A;  4ZNB A;  2NZF A;  1DDK A;  2Y8A A;  5KIL A;  5HH5 A;  3I15 A;  2I7T A;  5K4K A;  2Q42 A;  3ZNB A;  2P97 A;  2WYM A;  5HIP A;  4XWW A;  2YNU A;  1DD6 A;  4H0D A;  5A87 A;  3DHA A;  4EYB A;  2I7X A;  2BIB A;  1KR3 A;  5K0W A;  4RAW A;  2NZE A;  2GKL A;  4UA4 A;  5AJL A;  3SRX A;  2DKF A;  5ACU A;  1XTO A;  4YSL A;  3PY6 A;  5ACT A;  4Z67 A;  1X8G A;  3QH8 A;  3P2U A;  2Y8B A;  1KO2 A;  4NQ2 A;  2P18 A;  4XUK A;  3WXC A;  5EHT A;  2BMI A;  3Q6V A; 
#chains in the Genus database with same CATH homology
 4Z7R A;  5LM6 A;  1K07 A;  2Q0J A;  4HKY A;  4DIK A;  1JJT A;  3JXP A;  2UYX A;  3F9O A;  4PVO A;  4J5F A;  1XM8 A;  4UWS B;  5EVK A;  4BP0 A;  3IE0 A;  4EFZ A;  4PVT A;  4RL2 A;  4TZB A;  2Q0I A;  3SD9 A;  4CHL A;  5AXO A;  4Z6X A;  3SFP A;  4DIL A;  4UWO B;  3T3N A;  3IOF A;  4J5H A;  5ACS A;  5ACW A;  2HB9 A;  3KNR A;  1A7T A;  4Z5Y A;  2BFK A;  2WYL A;  4EY2 A;  2QJS A;  4EXS A;  4AWZ A;  2YCB A;  2OHJ A;  2P4Z A;  3SPU A;  2BG8 B;  4GCW A;  3AF6 A;  4F6Z A;  2QIN A;  3L6N A;  3BK2 A;  4D02 A;  2ZO4 A;  2YNV B;  4BZ3 A;  5AXR A;  4FSB A;  5FQB A;  5HIQ A;  3BK1 A;  4UBQ A;  2GMN A;  3ESH A;  3G1P A;  3PY5 A;  3T9M A;  3IDZ A;  4AD9 A;  5LE1 A;  2E7Y A;  4WD6 A;  4HL1 A;  5HH4 A;  2M5D A;  4GYQ A;  2Q9U A;  4YSK A;  4UWP B;  5AEB A;  1KO3 A;  2YNW A;  2BFZ A;  3BC2 A;  3X2Y A;  4C1G A;  1JJE A;  2P1E A;  2NXA A;  4TZF A;  2YNV A;  3ADR A;  5FQA A;  4AX0 B;  5EWA A;  4XWT A;  1E5D A;  2QDS A;  1BMC A;  4U4L A;  2XR1 A;  2BFL A;  2OHH A;  5K4N A;  3ZR9 A;  2FU6 A;  3X2Z A;  3TP9 A;  4Z5Z A;  4C1F A;  2GCU A;  2VW8 A;  4AX1 B;  1ZNB A;  2FK6 A;  4UAM A;  2BG6 A;  2ZWR A;  1VJN A;  3VPE A;  3DHB A;  4C1H A;  5KIK A;  5ACQ A;  2BTN A;  2FM6 A;  3AJ3 A;  2A7M A;  3DH8 A;  5AYA A;  4C1D A;  4FEK A;  1X8H A;  4NQ5 A;  2ZNB A;  1WRA A;  5DPX A;  4TYT A;  3IOG A;  3SW3 A;  4KEQ A;  4B87 A;  5B1U A;  4D1W A;  4ZEJ A;  3H3E A;  3KNS A;  3RPC A;  4NQ4 A;  3IE2 A;  3RKJ A;  2QDT A;  5FQC A;  3KL7 A;  1A8T A;  2BGA A;  2ZZI A;  2BR6 A;  3I11 A;  5A5Z A;  3R2U A;  4EXY A;  4HL2 A;  2XF4 A;  3FAI A;  4ZO3 A;  5IQK A;  4GYU A;  1WW1 A;  2OHI A;  3A4Y A;  5A0T A;  3VQZ A;  2FHX A;  5LMC A;  2BG8 A;  1BVT A;  5ACV A;  1Y44 A;  4C1C A;  4V0H A;  4C09 A;  2CBN A;  2YZ3 A;  5ACP A;  1WUO A;  5B15 A;  1JT1 A;  5HIS A;  3DHC A;  3RKK A;  1M2X A;  3IEM A;  5AHR A;  5A0V A;  3I14 A;  3BV6 A;  4NQ6 A;  5LCA A;  1BC2 A;  2I7V A;  1QH3 A;  5EVD A;  3SBL A;  1YCH A;  2FU8 A;  2WRS A;  4EYL A;  4C1E A;  2YNT A;  3MD7 A;  2NYP A;  2FHX B;  3AF5 A;  4AWY B;  5ACX A;  4O98 A;  5LS3 A;  4ZO2 A;  5EV6 A;  4KEP A;  4FR7 A;  5B3R A;  5LCF A;  2AIO A;  3X2X A;  3I0V A;  4TYF A;  1DXK A;  2GFJ A;  3IEL A;  4JO0 A;  4D1T A;  2QED A;  4F6H A;  3PG4 A;  1L9Y A;  4TZ9 A;  5LLD A;  2H6A A;  4D1U A;  3FCZ A;  4P62 A;  5EV8 A;  1MQO A;  2WHG A;  2YNT B;  3T3O A;  1ZTC A;  2GFK A;  2DOO A;  4RM5 A;  4EYF A;  2M5C A;  4RL0 A;  5EW0 A;  4UWR B;  5K4M A;  1YCF A;  3ZQ4 A;  1X8I A;  1HLK A;  2WYM C;  5LCH A;  5LSC A;  5AHO A;  4TZE A;  2R2D A;  4YSB A;  1VGN A;  1ZKP A;  4LE6 A;  5EVB A;  2FU7 A;  5HH6 A;  4Z60 A;  3LVZ A;  2BC2 A;  4D1V A;  1YCG A;  1SML A;  2FU9 A;  1P9E A;  2BFZ B;  3I13 A;  1QH5 A;  1WUP A;  2BG2 A;  3IE1 A;  5EH9 A;  2AZ4 A;  1VME A;  2BG7 A;  5HIO A;  4RAM A;  3ZWF A;  3X30 A;  2Y87 A;  4RBS A;  3S0Z A;  3IEK A;  5ACR A;  4ZNB A;  2NZF A;  1DDK A;  2Y8A A;  5KIL A;  5HH5 A;  3I15 A;  2I7T A;  5K4K A;  2Q42 A;  3ZNB A;  2P97 A;  2WYM A;  5HIP A;  4XWW A;  2YNU A;  1DD6 A;  4H0D A;  5A87 A;  3DHA A;  4EYB A;  2I7X A;  2BIB A;  1KR3 A;  5K0W A;  4RAW A;  2NZE A;  2GKL A;  4UA4 A;  3SRX A;  2DKF A;  5ACU A;  1XTO A;  4YSL A;  3PY6 A;  5ACT A;  4Z67 A;  1X8G A;  3QH8 A;  3P2U A;  2Y8B A;  1KO2 A;  4NQ2 A;  2P18 A;  4XUK A;  3WXC A;  5EHT A;  2BMI A;  3Q6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...