3MD7A

Crystal structure of a beta-lactamase-like protein bound to gmp from brucella melitensis
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
270
structure length
270
Chain Sequence
SPRNCLRFTLLGCGSSPGVPRINGDWGKCDPKNPKNRRRRASLLVERYDAEGNNTVVVIDTGPDFRMQMIDSGVHMLDAAVYTHPHADHIHGIDDLRTYVVDNGRLMDVYANRLTRNRLYDTFGYCFETPVGSSYPPILSMHDIAPETPFSIEGAGGAIRFEPFSQVHGDIESLGFRIGSVVYCTDVSAFPEQSLQYIKDADVLIIGALQYRPHPSHFSLGEALEWIEKLSPKRAILTHMHVPLDYETVMRETPHHVEPGYDGLRFEVAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase-like
publication title BrabA.11339.a: anomalous diffraction and ligand binding guide towards the elucidation of the function of a `putative beta-lactamase-like protein from Brucella melitensis.
pubmed doi rcsb
source organism Brucella melitensis biovar abortus
molecule tags Hydrolase
total genus 83
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3md7A00
2NXAA 2Y8AA 5ACSA 2YNUA 4NQ5A 3AF5A 4V0HA 3P2UA 2VW8A 4C1FA 3H3EA 4WD6A 2GCUA 1WUOA 3IEKA 3SD9A 5A87A 1WRAA 1E5DA 5AXOA 3IE0A 3A4YA 4ZNBA 2OHIA 5LCHA 1ZTCA 3KNSA 5EVDA 2WRSA 1BC2A 5HIOA 4Z67A 2FK6A 2FHXA 4C09A 5EVBA 2GKLA 4NQ4A 1ZKPA 4JO0A 1QH5A 4UWPB 1YCHA 3X2XA 2BFZB 2BG8A 3X2YA 5LS3A 3AF6A 2CBNA 3SBLA 5K4KA 2A7MA 5ACWA 1DXKA 2Q9UA 5EW0A 4D1WA 5ACPA 4D1TA 4EY2A 2YZ3A 3IOGA 3R2UA 5EV6A 1DDKA 2P1EA 4TZBA 2UYXA 4YSKA 1QH3A 3ZWFA 4D1VA 4XUKA 2XR1A 4EXYA 4PVOA 4UWOB 5KILA 5ACVA 3PY6A 1KR3A 3FAIA 4YSLA 2FU6A 2BG2A 3RKJA 4O98A 2NZFA 5ACXA 3T3OA 2YNTA 5K4NA 3PY5A 3FCZA 1P9EA 4XWTA 2BR6A 5B1UA 3DHAA 5HISA 4XWWA 2ZO4A 2DOOA 5A0VA 4C1EA 4U4LA 4EXSA 3VPEA 3VQZA 4J5HA 5KIKA 5HIQA 4RL0A 1BVTA 1YCFA 3DHCA 3ZQ4A 2QDTA 3KNRA 4EYBA 2Y87A 3MD7A 4RL2A 4TYTA 1VMEA 2YNVA 3AJ3A 2QEDA 1ZNBA 2P4ZA 2Q0JA 4KEQA 5LSCA 5FQCA 4RBSA 4F6HA 2ZZIA 3LVZA 5A5ZA 3Q6VA 5LM6A 5ACTA 1M2XA 2XF4A 2GFJA 5FQAA 1WW1A 3T3NA 2BGAA 4Z60A 4AWZA 4UAMA 5DPXA 1X8IA 4EFZA 4AWYB 1Y44A 3S0ZA 4TZ9A 2ZWRA 4ZO3A 3PG4A 5HH4A 3IDZA 3IELA 3TP9A 2ZNBA 2QJSA 2GMNA 2WHGA 3DHBA 3JXPA 1XTOA 4C1DA 4DILA 5EV8A 2YNWA 3I13A 4HL1A 3IOFA 5IQKA 5AHOA 2OHJA 3G1PA 5ACRA 4NQ2A 4AX0B 1VJNA 3RPCA 5EWAA 2QINA 3BK1A 1VGNA 4RM5A 2FM6A 5LCAA 3ADRA 5A0TA 1XM8A 4AD9A 1A7TA 3SRXA 5ACQA 3IE2A 4H0DA 2FHXB 5K4MA 2I7XA 2AIOA 1A8TA 2I7VA 3IE1A 4P62A 3BV6A 3I0VA 1X8GA 5AHRA 3SFPA 2BG8B 3DH8A 3ESHA 2P97A 4EYLA 1SMLA 2WYMC 4UA4A 5AXRA 5HH5A 4HKYA 2BFLA 2M5CA 4Z5YA 4Z5ZA 4C1GA 3ZR9A 3QH8A 2R2DA 4YSBA 4FEKA 4UWSB 4J5FA 1X8HA 2BFZA 2P18A 3KL7A 2BFKA 2WYMA 2H6AA 4Z6XA 1YCGA 4CHLA 4D02A 2GFKA 2Y8BA 2I7TA 4GYUA 2YNTB 5EVKA 5ACUA 4PVTA 2FU8A 4ZEJA 2AZ4A 4C1CA 1JJEA 3F9OA 3X30A 3ZNBA 1WUPA 3RKKA 2NZEA 2YCBA 5LE1A 3BC2A 4TZEA 4C1HA 4TYFA 2YNVB 3I15A 2OHHA 4KEPA 4DIKA 3SW3A 5AEBA 1KO2A 4BZ3A 3WXCA 3I14A 2NYPA 4B87A 1HLKA 3X2ZA 4RAMA 4LE6A 5LMCA 5B3RA 2HB9A 4AX1B 2BMIA 4BP0A 4FR7A 5K0WA 2BG6A 5EH9A 5B15A 5HIPA 3L6NA 4EYFA 5EHTA 2BG7A 1K07A 4Z7RA 1DD6A 2Q42A 2DKFA 4NQ6A 2FU7A 2BTNA 3IEMA 1KO3A 2M5DA 4FSBA 2E7YA 1JT1A 4GYQA 5FQBA 5LCFA 3BK2A 2QDSA 4UBQA 1MQOA 4HL2A 4RAWA 3SPUA 1L9YA 5LLDA 4D1UA 4ZO2A 2BC2A 2BIBA 2WYLA 5HH6A 4GCWA 5AYAA 2FU9A 2Q0IA 4F6ZA 3I11A 4UWRB 4TZFA 1JJTA 3T9MA 1BMCA
chains in the Genus database with same CATH superfamily
2NXAA 2Y8AA 5ACSA 2YNUA 4NQ5A 3AF5A 4V0HA 3P2UA 2VW8A 4C1FA 3H3EA 4WD6A 2GCUA 1WUOA 3IEKA 3SD9A 5A87A 1WRAA 1E5DA 5AXOA 3IE0A 3A4YA 4ZNBA 2OHIA 5LCHA 1ZTCA 3KNSA 5EVDA 2WRSA 1BC2A 5HIOA 4Z67A 2FK6A 2FHXA 4C09A 5EVBA 2GKLA 4NQ4A 1ZKPA 4JO0A 1QH5A 4UWPB 1YCHA 3X2XA 2BFZB 2BG8A 3X2YA 2CG2A 5LS3A 3AF6A 2CBNA 3SBLA 5K4KA 2A7MA 5ACWA 1DXKA 2Q9UA 5EW0A 4D1WA 5ACPA 4D1TA 4EY2A 2YZ3A 3IOGA 3R2UA 5EV6A 1DDKA 2P1EA 4TZBA 2UYXA 4YSKA 1QH3A 3ZWFA 4D1VA 4XUKA 2XR1A 4EXYA 4PVOA 4UWOB 5KILA 5ACVA 3PY6A 1KR3A 3FAIA 4YSLA 2FU6A 2BG2A 3RKJA 4O98A 2NZFA 5ACXA 3T3OA 2YNTA 5K4NA 3PY5A 3FCZA 1P9EA 4XWTA 2BR6A 5B1UA 3DHAA 5HISA 4XWWA 2ZO4A 2DOOA 5A0VA 4C1EA 4U4LA 4EXSA 3VPEA 3VQZA 4J5HA 5KIKA 5HIQA 4PDXA 4RL0A 1BVTA 1YCFA 3DHCA 3ZQ4A 2QDTA 3KNRA 4EYBA 2Y87A 3MD7A 4RL2A 4TYTA 1VMEA 2YNVA 3AJ3A 2QEDA 4AXHA 1ZNBA 2P4ZA 2Q0JA 4KEQA 5LSCA 5FQCA 4RBSA 4F6HA 2ZZIA 3LVZA 5A5ZA 3Q6VA 5LM6A 5ACTA 1M2XA 2XF4A 2GFJA 5FQAA 1WW1A 3T3NA 2BGAA 4Z60A 4AWZA 2CG3A 4UAMA 5DPXA 1X8IA 4EFZA 4AWYB 1Y44A 3S0ZA 4TZ9A 2ZWRA 4ZO3A 3PG4A 5HH4A 3IDZA 3IELA 3TP9A 2ZNBA 2QJSA 2GMNA 2WHGA 3DHBA 3JXPA 1XTOA 4C1DA 4DILA 5EV8A 2YNWA 3I13A 4HL1A 3IOFA 5IQKA 5AHOA 2OHJA 3G1PA 5ACRA 4NQ2A 4AX0B 1VJNA 3RPCA 5EWAA 2QINA 3BK1A 1VGNA 5A23A 4RM5A 2FM6A 5LCAA 3ADRA 2CFZA 5A0TA 1XM8A 4AD9A 1A7TA 3SRXA 5ACQA 3IE2A 5AIJA 4AV7A 4H0DA 2FHXB 5K4MA 2I7XA 2AIOA 1A8TA 2CFUA 2I7VA 3IE1A 4P62A 3BV6A 3I0VA 1X8GA 5AHRA 3SFPA 2BG8B 3DH8A 3ESHA 2P97A 4EYLA 1SMLA 2WYMC 4UA4A 5AXRA 5HH5A 4HKYA 2BFLA 2M5CA 4Z5YA 4Z5ZA 4C1GA 3ZR9A 3QH8A 2R2DA 2YHEA 4YSBA 4FEKA 4UWSB 4J5FA 1X8HA 2BFZA 2P18A 3KL7A 2BFKA 2WYMA 2H6AA 4Z6XA 1YCGA 4CHLA 4D02A 2GFKA 2Y8BA 2I7TA 4GYUA 2YNTB 5EVKA 5ACUA 4PVTA 2FU8A 4ZEJA 2AZ4A 4C1CA 1JJEA 5AJLA 3F9OA 3X30A 3ZNBA 1WUPA 3RKKA 2NZEA 2YCBA 5LE1A 4NURA 3BC2A 4TZEA 4C1HA 4TYFA 2YNVB 3I15A 2OHHA 4KEPA 4DIKA 3SW3A 5AEBA 1KO2A 4BZ3A 3WXCA 3I14A 2NYPA 4B87A 1HLKA 3X2ZA 4RAMA 4LE6A 5LMCA 5B3RA 2HB9A 4AX1B 2BMIA 4BP0A 4FR7A 5K0WA 2BG6A 5EH9A 5B15A 5HIPA 3L6NA 4EYFA 5EHTA 2BG7A 1K07A 4Z7RA 1DD6A 2Q42A 2DKFA 4NQ6A 2FU7A 2BTNA 3IEMA 1KO3A 2M5DA 4FSBA 2E7YA 1JT1A 4GYQA 5FQBA 5LCFA 3BK2A 2QDSA 4UBQA 1MQOA 4HL2A 4RAWA 3SPUA 1L9YA 5LLDA 4D1UA 4ZO2A 2BC2A 2BIBA 2WYLA 5HH6A 4GCWA 5AYAA 2FU9A 2Q0IA 4F6ZA 3I11A 4UWRB 4TZFA 1JJTA 3T9MA 1BMCA
chains in the Genus database with same CATH topology
2NXAA 2Y8AA 5ACSA 2YNUA 4NQ5A 3AF5A 4V0HA 3P2UA 2VW8A 4C1FA 3H3EA 4WD6A 2GCUA 1WUOA 3IEKA 3SD9A 5A87A 1WRAA 1E5DA 5AXOA 3IE0A 3A4YA 4ZNBA 2OHIA 5LCHA 1ZTCA 3KNSA 5EVDA 2WRSA 1BC2A 5HIOA 4Z67A 2FK6A 2FHXA 4C09A 5EVBA 2GKLA 4NQ4A 1ZKPA 4JO0A 1QH5A 4UWPB 1YCHA 3X2XA 2BFZB 2BG8A 3X2YA 5LS3A 3AF6A 2CBNA 3SBLA 5K4KA 2A7MA 5ACWA 1DXKA 2Q9UA 5EW0A 4D1WA 5ACPA 4D1TA 4EY2A 2YZ3A 3IOGA 3R2UA 5EV6A 1DDKA 2P1EA 4TZBA 2UYXA 4YSKA 1QH3A 3ZWFA 4D1VA 4XUKA 2XR1A 4EXYA 4PVOA 4UWOB 5KILA 5ACVA 3PY6A 1KR3A 3FAIA 4YSLA 2FU6A 2BG2A 3RKJA 4O98A 2NZFA 5ACXA 3T3OA 2YNTA 5K4NA 3PY5A 3FCZA 1P9EA 4XWTA 2BR6A 5B1UA 3DHAA 5HISA 4XWWA 2ZO4A 2DOOA 5A0VA 4C1EA 4U4LA 4EXSA 3VPEA 3VQZA 4J5HA 5KIKA 5HIQA 4RL0A 1BVTA 1YCFA 3DHCA 3ZQ4A 2QDTA 3KNRA 4EYBA 2Y87A 3MD7A 4RL2A 4TYTA 1VMEA 2YNVA 3AJ3A 2QEDA 1ZNBA 2P4ZA 2Q0JA 4KEQA 5LSCA 5FQCA 4RBSA 4F6HA 2ZZIA 3LVZA 5A5ZA 3Q6VA 5LM6A 5ACTA 1M2XA 2XF4A 2GFJA 5FQAA 1WW1A 3T3NA 2BGAA 4Z60A 4AWZA 4UAMA 5DPXA 1X8IA 4EFZA 4AWYB 1Y44A 3S0ZA 4TZ9A 2ZWRA 4ZO3A 3PG4A 5HH4A 3IDZA 3IELA 3TP9A 2ZNBA 2QJSA 2GMNA 2WHGA 3DHBA 3JXPA 1XTOA 4C1DA 4DILA 5EV8A 2YNWA 3I13A 4HL1A 3IOFA 5IQKA 5AHOA 2OHJA 3G1PA 5ACRA 4NQ2A 4AX0B 1VJNA 3RPCA 5EWAA 2QINA 3BK1A 1VGNA 4RM5A 2FM6A 5LCAA 3ADRA 5A0TA 1XM8A 4AD9A 1A7TA 3SRXA 5ACQA 3IE2A 4H0DA 2FHXB 5K4MA 2I7XA 2AIOA 1A8TA 2I7VA 3IE1A 4P62A 3BV6A 3I0VA 1X8GA 5AHRA 3SFPA 2BG8B 3DH8A 3ESHA 2P97A 4EYLA 1SMLA 2WYMC 4UA4A 5AXRA 5HH5A 4HKYA 2BFLA 2M5CA 4Z5YA 4Z5ZA 4C1GA 3ZR9A 3QH8A 2R2DA 4YSBA 4FEKA 4UWSB 4J5FA 1X8HA 2BFZA 2P18A 3KL7A 2BFKA 2WYMA 2H6AA 4Z6XA 1YCGA 4CHLA 4D02A 2GFKA 2Y8BA 2I7TA 4GYUA 2YNTB 5EVKA 5ACUA 4PVTA 2FU8A 4ZEJA 2AZ4A 4C1CA 1JJEA 3F9OA 3X30A 3ZNBA 1WUPA 3RKKA 2NZEA 2YCBA 5LE1A 3BC2A 4TZEA 4C1HA 4TYFA 2YNVB 3I15A 2OHHA 4KEPA 4DIKA 3SW3A 5AEBA 1KO2A 4BZ3A 3WXCA 3I14A 2NYPA 4B87A 1HLKA 3X2ZA 4RAMA 4LE6A 5LMCA 5B3RA 2HB9A 4AX1B 2BMIA 4BP0A 4FR7A 5K0WA 2BG6A 5EH9A 5B15A 5HIPA 3L6NA 4EYFA 5EHTA 2BG7A 1K07A 4Z7RA 1DD6A 2Q42A 2DKFA 4NQ6A 2FU7A 2BTNA 3IEMA 1KO3A 2M5DA 4FSBA 2E7YA 1JT1A 4GYQA 5FQBA 5LCFA 3BK2A 2QDSA 4UBQA 1MQOA 4HL2A 4RAWA 3SPUA 1L9YA 5LLDA 4D1UA 4ZO2A 2BC2A 2BIBA 2WYLA 5HH6A 4GCWA 5AYAA 2FU9A 2Q0IA 4F6ZA 3I11A 4UWRB 4TZFA 1JJTA 3T9MA 1BMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NXA A;  2Y8A A;  5ACS A;  2YNU A;  4NQ5 A;  3AF5 A;  4V0H A;  3P2U A;  2VW8 A;  4C1F A;  3H3E A;  4WD6 A;  2GCU A;  1WUO A;  3IEK A;  3SD9 A;  5A87 A;  1WRA A;  1E5D A;  5AXO A;  3IE0 A;  3A4Y A;  4ZNB A;  2OHI A;  5LCH A;  1ZTC A;  3KNS A;  5EVD A;  2WRS A;  1BC2 A;  5HIO A;  4Z67 A;  2FK6 A;  2FHX A;  4C09 A;  5EVB A;  2GKL A;  4NQ4 A;  1ZKP A;  4JO0 A;  1QH5 A;  4UWP B;  1YCH A;  3X2X A;  2BFZ B;  2BG8 A;  3X2Y A;  5LS3 A;  3AF6 A;  2CBN A;  3SBL A;  5K4K A;  2A7M A;  5ACW A;  1DXK A;  2Q9U A;  5EW0 A;  4D1W A;  5ACP A;  4D1T A;  4EY2 A;  2YZ3 A;  3IOG A;  3R2U A;  5EV6 A;  1DDK A;  2P1E A;  4TZB A;  2UYX A;  4YSK A;  1QH3 A;  3ZWF A;  4D1V A;  4XUK A;  2XR1 A;  4EXY A;  4PVO A;  4UWO B;  5KIL A;  5ACV A;  3PY6 A;  1KR3 A;  3FAI A;  4YSL A;  2FU6 A;  2BG2 A;  3RKJ A;  4O98 A;  2NZF A;  5ACX A;  3T3O A;  2YNT A;  5K4N A;  3PY5 A;  3FCZ A;  1P9E A;  4XWT A;  2BR6 A;  5B1U A;  3DHA A;  5HIS A;  4XWW A;  2ZO4 A;  2DOO A;  5A0V A;  4C1E A;  4U4L A;  4EXS A;  3VPE A;  3VQZ A;  4J5H A;  5KIK A;  5HIQ A;  4RL0 A;  1BVT A;  1YCF A;  3DHC A;  3ZQ4 A;  2QDT A;  3KNR A;  4EYB A;  2Y87 A;  3MD7 A;  4RL2 A;  4TYT A;  1VME A;  2YNV A;  3AJ3 A;  2QED A;  1ZNB A;  2P4Z A;  2Q0J A;  4KEQ A;  5LSC A;  5FQC A;  4RBS A;  4F6H A;  2ZZI A;  3LVZ A;  5A5Z A;  3Q6V A;  5LM6 A;  5ACT A;  1M2X A;  2XF4 A;  2GFJ A;  5FQA A;  1WW1 A;  3T3N A;  2BGA A;  4Z60 A;  4AWZ A;  4UAM A;  5DPX A;  1X8I A;  4EFZ A;  4AWY B;  1Y44 A;  3S0Z A;  4TZ9 A;  2ZWR A;  4ZO3 A;  3PG4 A;  5HH4 A;  3IDZ A;  3IEL A;  3TP9 A;  2ZNB A;  2QJS A;  2GMN A;  2WHG A;  3DHB A;  3JXP A;  1XTO A;  4C1D A;  4DIL A;  5EV8 A;  2YNW A;  3I13 A;  4HL1 A;  3IOF A;  5IQK A;  5AHO A;  2OHJ A;  3G1P A;  5ACR A;  4NQ2 A;  4AX0 B;  1VJN A;  3RPC A;  5EWA A;  2QIN A;  3BK1 A;  1VGN A;  4RM5 A;  2FM6 A;  5LCA A;  3ADR A;  5A0T A;  1XM8 A;  4AD9 A;  1A7T A;  3SRX A;  5ACQ A;  3IE2 A;  4H0D A;  2FHX B;  5K4M A;  2I7X A;  2AIO A;  1A8T A;  2I7V A;  3IE1 A;  4P62 A;  3BV6 A;  3I0V A;  1X8G A;  5AHR A;  3SFP A;  2BG8 B;  3DH8 A;  3ESH A;  2P97 A;  4EYL A;  1SML A;  2WYM C;  4UA4 A;  5AXR A;  5HH5 A;  4HKY A;  2BFL A;  2M5C A;  4Z5Y A;  4Z5Z A;  4C1G A;  3ZR9 A;  3QH8 A;  2R2D A;  4YSB A;  4FEK A;  4UWS B;  4J5F A;  1X8H A;  2BFZ A;  2P18 A;  3KL7 A;  2BFK A;  2WYM A;  2H6A A;  4Z6X A;  1YCG A;  4CHL A;  4D02 A;  2GFK A;  2Y8B A;  2I7T A;  4GYU A;  2YNT B;  5EVK A;  5ACU A;  4PVT A;  2FU8 A;  4ZEJ A;  2AZ4 A;  4C1C A;  1JJE A;  3F9O A;  3X30 A;  3ZNB A;  1WUP A;  3RKK A;  2NZE A;  2YCB A;  5LE1 A;  3BC2 A;  4TZE A;  4C1H A;  4TYF A;  2YNV B;  3I15 A;  2OHH A;  4KEP A;  4DIK A;  3SW3 A;  5AEB A;  1KO2 A;  4BZ3 A;  3WXC A;  3I14 A;  2NYP A;  4B87 A;  1HLK A;  3X2Z A;  4RAM A;  4LE6 A;  5LMC A;  5B3R A;  2HB9 A;  4AX1 B;  2BMI A;  4BP0 A;  4FR7 A;  5K0W A;  2BG6 A;  5EH9 A;  5B15 A;  5HIP A;  3L6N A;  4EYF A;  5EHT A;  2BG7 A;  1K07 A;  4Z7R A;  1DD6 A;  2Q42 A;  2DKF A;  4NQ6 A;  2FU7 A;  2BTN A;  3IEM A;  1KO3 A;  2M5D A;  4FSB A;  2E7Y A;  1JT1 A;  4GYQ A;  5FQB A;  5LCF A;  3BK2 A;  2QDS A;  4UBQ A;  1MQO A;  4HL2 A;  4RAW A;  3SPU A;  1L9Y A;  5LLD A;  4D1U A;  4ZO2 A;  2BC2 A;  2BIB A;  2WYL A;  5HH6 A;  4GCW A;  5AYA A;  2FU9 A;  2Q0I A;  4F6Z A;  3I11 A;  4UWR B;  4TZF A;  1JJT A;  3T9M A;  1BMC A; 
#chains in the Genus database with same CATH topology
 2NXA A;  2Y8A A;  5ACS A;  2YNU A;  4NQ5 A;  3AF5 A;  4V0H A;  3P2U A;  2VW8 A;  4C1F A;  3H3E A;  4WD6 A;  2GCU A;  1WUO A;  3IEK A;  3SD9 A;  5A87 A;  1WRA A;  1E5D A;  5AXO A;  3IE0 A;  3A4Y A;  4ZNB A;  2OHI A;  5LCH A;  1ZTC A;  3KNS A;  5EVD A;  2WRS A;  1BC2 A;  5HIO A;  4Z67 A;  2FK6 A;  2FHX A;  4C09 A;  5EVB A;  2GKL A;  4NQ4 A;  1ZKP A;  4JO0 A;  1QH5 A;  4UWP B;  1YCH A;  3X2X A;  2BFZ B;  2BG8 A;  3X2Y A;  2CG2 A;  5LS3 A;  3AF6 A;  2CBN A;  3SBL A;  5K4K A;  2A7M A;  5ACW A;  1DXK A;  2Q9U A;  5EW0 A;  4D1W A;  5ACP A;  4D1T A;  4EY2 A;  2YZ3 A;  3IOG A;  3R2U A;  5EV6 A;  1DDK A;  2P1E A;  4TZB A;  2UYX A;  4YSK A;  1QH3 A;  3ZWF A;  4D1V A;  4XUK A;  2XR1 A;  4EXY A;  4PVO A;  4UWO B;  5KIL A;  5ACV A;  3PY6 A;  1KR3 A;  3FAI A;  4YSL A;  2FU6 A;  2BG2 A;  3RKJ A;  4O98 A;  2NZF A;  5ACX A;  3T3O A;  2YNT A;  5K4N A;  3PY5 A;  3FCZ A;  1P9E A;  4XWT A;  2BR6 A;  5B1U A;  3DHA A;  5HIS A;  4XWW A;  2ZO4 A;  2DOO A;  5A0V A;  4C1E A;  4U4L A;  4EXS A;  3VPE A;  3VQZ A;  4J5H A;  5KIK A;  5HIQ A;  4PDX A;  4RL0 A;  1BVT A;  1YCF A;  3DHC A;  3ZQ4 A;  2QDT A;  3KNR A;  4EYB A;  2Y87 A;  3MD7 A;  4RL2 A;  4TYT A;  1VME A;  2YNV A;  3AJ3 A;  2QED A;  4AXH A;  1ZNB A;  2P4Z A;  2Q0J A;  4KEQ A;  5LSC A;  5FQC A;  4RBS A;  4F6H A;  2ZZI A;  3LVZ A;  5A5Z A;  3Q6V A;  5LM6 A;  5ACT A;  1M2X A;  2XF4 A;  2GFJ A;  5FQA A;  1WW1 A;  3T3N A;  2BGA A;  4Z60 A;  4AWZ A;  2CG3 A;  4UAM A;  5DPX A;  1X8I A;  4EFZ A;  4AWY B;  1Y44 A;  3S0Z A;  4TZ9 A;  2ZWR A;  4ZO3 A;  3PG4 A;  5HH4 A;  3IDZ A;  3IEL A;  3TP9 A;  2ZNB A;  2QJS A;  2GMN A;  2WHG A;  3DHB A;  3JXP A;  1XTO A;  4C1D A;  4DIL A;  5EV8 A;  2YNW A;  3I13 A;  4HL1 A;  3IOF A;  5IQK A;  5AHO A;  2OHJ A;  3G1P A;  5ACR A;  4NQ2 A;  4AX0 B;  1VJN A;  3RPC A;  5EWA A;  2QIN A;  3BK1 A;  1VGN A;  5A23 A;  4RM5 A;  2FM6 A;  5LCA A;  3ADR A;  2CFZ A;  5A0T A;  1XM8 A;  4AD9 A;  1A7T A;  3SRX A;  5ACQ A;  3IE2 A;  5AIJ A;  4AV7 A;  4H0D A;  2FHX B;  5K4M A;  2I7X A;  2AIO A;  1A8T A;  2CFU A;  2I7V A;  3IE1 A;  4P62 A;  3BV6 A;  3I0V A;  1X8G A;  5AHR A;  3SFP A;  2BG8 B;  3DH8 A;  3ESH A;  2P97 A;  4EYL A;  1SML A;  2WYM C;  4UA4 A;  5AXR A;  5HH5 A;  4HKY A;  2BFL A;  2M5C A;  4Z5Y A;  4Z5Z A;  4C1G A;  3ZR9 A;  3QH8 A;  2R2D A;  2YHE A;  4YSB A;  4FEK A;  4UWS B;  4J5F A;  1X8H A;  2BFZ A;  2P18 A;  3KL7 A;  2BFK A;  2WYM A;  2H6A A;  4Z6X A;  1YCG A;  4CHL A;  4D02 A;  2GFK A;  2Y8B A;  2I7T A;  4GYU A;  2YNT B;  5EVK A;  5ACU A;  4PVT A;  2FU8 A;  4ZEJ A;  2AZ4 A;  4C1C A;  1JJE A;  5AJL A;  3F9O A;  3X30 A;  3ZNB A;  1WUP A;  3RKK A;  2NZE A;  2YCB A;  5LE1 A;  4NUR A;  3BC2 A;  4TZE A;  4C1H A;  4TYF A;  2YNV B;  3I15 A;  2OHH A;  4KEP A;  4DIK A;  3SW3 A;  5AEB A;  1KO2 A;  4BZ3 A;  3WXC A;  3I14 A;  2NYP A;  4B87 A;  1HLK A;  3X2Z A;  4RAM A;  4LE6 A;  5LMC A;  5B3R A;  2HB9 A;  4AX1 B;  2BMI A;  4BP0 A;  4FR7 A;  5K0W A;  2BG6 A;  5EH9 A;  5B15 A;  5HIP A;  3L6N A;  4EYF A;  5EHT A;  2BG7 A;  1K07 A;  4Z7R A;  1DD6 A;  2Q42 A;  2DKF A;  4NQ6 A;  2FU7 A;  2BTN A;  3IEM A;  1KO3 A;  2M5D A;  4FSB A;  2E7Y A;  1JT1 A;  4GYQ A;  5FQB A;  5LCF A;  3BK2 A;  2QDS A;  4UBQ A;  1MQO A;  4HL2 A;  4RAW A;  3SPU A;  1L9Y A;  5LLD A;  4D1U A;  4ZO2 A;  2BC2 A;  2BIB A;  2WYL A;  5HH6 A;  4GCW A;  5AYA A;  2FU9 A;  2Q0I A;  4F6Z A;  3I11 A;  4UWR B;  4TZF A;  1JJT A;  3T9M A;  1BMC A; 
#chains in the Genus database with same CATH homology
 2NXA A;  2Y8A A;  5ACS A;  2YNU A;  4NQ5 A;  3AF5 A;  4V0H A;  3P2U A;  2VW8 A;  4C1F A;  3H3E A;  4WD6 A;  2GCU A;  1WUO A;  3IEK A;  3SD9 A;  5A87 A;  1WRA A;  1E5D A;  5AXO A;  3IE0 A;  3A4Y A;  4ZNB A;  2OHI A;  5LCH A;  1ZTC A;  3KNS A;  5EVD A;  2WRS A;  1BC2 A;  5HIO A;  4Z67 A;  2FK6 A;  2FHX A;  4C09 A;  5EVB A;  2GKL A;  4NQ4 A;  1ZKP A;  4JO0 A;  1QH5 A;  4UWP B;  1YCH A;  3X2X A;  2BFZ B;  2BG8 A;  3X2Y A;  5LS3 A;  3AF6 A;  2CBN A;  3SBL A;  5K4K A;  2A7M A;  5ACW A;  1DXK A;  2Q9U A;  5EW0 A;  4D1W A;  5ACP A;  4D1T A;  4EY2 A;  2YZ3 A;  3IOG A;  3R2U A;  5EV6 A;  1DDK A;  2P1E A;  4TZB A;  2UYX A;  4YSK A;  1QH3 A;  3ZWF A;  4D1V A;  4XUK A;  2XR1 A;  4EXY A;  4PVO A;  4UWO B;  5KIL A;  5ACV A;  3PY6 A;  1KR3 A;  3FAI A;  4YSL A;  2FU6 A;  2BG2 A;  3RKJ A;  4O98 A;  2NZF A;  5ACX A;  3T3O A;  2YNT A;  5K4N A;  3PY5 A;  3FCZ A;  1P9E A;  4XWT A;  2BR6 A;  5B1U A;  3DHA A;  5HIS A;  4XWW A;  2ZO4 A;  2DOO A;  5A0V A;  4C1E A;  4U4L A;  4EXS A;  3VPE A;  3VQZ A;  4J5H A;  5KIK A;  5HIQ A;  4RL0 A;  1BVT A;  1YCF A;  3DHC A;  3ZQ4 A;  2QDT A;  3KNR A;  4EYB A;  2Y87 A;  3MD7 A;  4RL2 A;  4TYT A;  1VME A;  2YNV A;  3AJ3 A;  2QED A;  1ZNB A;  2P4Z A;  2Q0J A;  4KEQ A;  5LSC A;  5FQC A;  4RBS A;  4F6H A;  2ZZI A;  3LVZ A;  5A5Z A;  3Q6V A;  5LM6 A;  5ACT A;  1M2X A;  2XF4 A;  2GFJ A;  5FQA A;  1WW1 A;  3T3N A;  2BGA A;  4Z60 A;  4AWZ A;  4UAM A;  5DPX A;  1X8I A;  4EFZ A;  4AWY B;  1Y44 A;  3S0Z A;  4TZ9 A;  2ZWR A;  4ZO3 A;  3PG4 A;  5HH4 A;  3IDZ A;  3IEL A;  3TP9 A;  2ZNB A;  2QJS A;  2GMN A;  2WHG A;  3DHB A;  3JXP A;  1XTO A;  4C1D A;  4DIL A;  5EV8 A;  2YNW A;  3I13 A;  4HL1 A;  3IOF A;  5IQK A;  5AHO A;  2OHJ A;  3G1P A;  5ACR A;  4NQ2 A;  4AX0 B;  1VJN A;  3RPC A;  5EWA A;  2QIN A;  3BK1 A;  1VGN A;  4RM5 A;  2FM6 A;  5LCA A;  3ADR A;  5A0T A;  1XM8 A;  4AD9 A;  1A7T A;  3SRX A;  5ACQ A;  3IE2 A;  4H0D A;  2FHX B;  5K4M A;  2I7X A;  2AIO A;  1A8T A;  2I7V A;  3IE1 A;  4P62 A;  3BV6 A;  3I0V A;  1X8G A;  5AHR A;  3SFP A;  2BG8 B;  3DH8 A;  3ESH A;  2P97 A;  4EYL A;  1SML A;  2WYM C;  4UA4 A;  5AXR A;  5HH5 A;  4HKY A;  2BFL A;  2M5C A;  4Z5Y A;  4Z5Z A;  4C1G A;  3ZR9 A;  3QH8 A;  2R2D A;  4YSB A;  4FEK A;  4UWS B;  4J5F A;  1X8H A;  2BFZ A;  2P18 A;  3KL7 A;  2BFK A;  2WYM A;  2H6A A;  4Z6X A;  1YCG A;  4CHL A;  4D02 A;  2GFK A;  2Y8B A;  2I7T A;  4GYU A;  2YNT B;  5EVK A;  5ACU A;  4PVT A;  2FU8 A;  4ZEJ A;  2AZ4 A;  4C1C A;  1JJE A;  3F9O A;  3X30 A;  3ZNB A;  1WUP A;  3RKK A;  2NZE A;  2YCB A;  5LE1 A;  3BC2 A;  4TZE A;  4C1H A;  4TYF A;  2YNV B;  3I15 A;  2OHH A;  4KEP A;  4DIK A;  3SW3 A;  5AEB A;  1KO2 A;  4BZ3 A;  3WXC A;  3I14 A;  2NYP A;  4B87 A;  1HLK A;  3X2Z A;  4RAM A;  4LE6 A;  5LMC A;  5B3R A;  2HB9 A;  4AX1 B;  2BMI A;  4BP0 A;  4FR7 A;  5K0W A;  2BG6 A;  5EH9 A;  5B15 A;  5HIP A;  3L6N A;  4EYF A;  5EHT A;  2BG7 A;  1K07 A;  4Z7R A;  1DD6 A;  2Q42 A;  2DKF A;  4NQ6 A;  2FU7 A;  2BTN A;  3IEM A;  1KO3 A;  2M5D A;  4FSB A;  2E7Y A;  1JT1 A;  4GYQ A;  5FQB A;  5LCF A;  3BK2 A;  2QDS A;  4UBQ A;  1MQO A;  4HL2 A;  4RAW A;  3SPU A;  1L9Y A;  5LLD A;  4D1U A;  4ZO2 A;  2BC2 A;  2BIB A;  2WYL A;  5HH6 A;  4GCW A;  5AYA A;  2FU9 A;  2Q0I A;  4F6Z A;  3I11 A;  4UWR B;  4TZF A;  1JJT A;  3T9M A;  1BMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...