4F6ZA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
232
structure length
221
Chain Sequence
PDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNEHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 60
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6zA00
1JJEA 5LCFA 2WYLA 4RM5A 5ACUA 1MQOA 3IE2A 1Y44A 4EY2A 2NZFA 2Y8AA 5LLDA 2YZ3A 4D1TA 5AEBA 5ACRA 4Z5ZA 2FU7A 1HLKA 3IOGA 4CHLA 1XTOA 2M5DA 1M2XA 2CBNA 3I14A 2FU9A 1VJNA 4P62A 2NYPA 2ZWRA 2NZEA 5B15A 4H0DA 1KO3A 2FK6A 5ACWA 3BC2A 3ADRA 2QJSA 4TYFA 2BMIA 3X30A 2Q9UA 5AXOA 2XF4A 4FSBA 5EV8A 4F6HA 5K4MA 4XUKA 2GFKA 3X2YA 5DPXA 1X8GA 2BG7A 4UWPB 1A8TA 4GYQA 3ZNBA 4BP0A 4UWSB 3S0ZA 5HH6A 4C1EA 3RKJA 5LM6A 4Z5YA 5HIQA 3WXCA 4NQ4A 3I11A 1SMLA 1E5DA 3AF5A 5LSCA 1BC2A 5LCHA 3P2UA 4Z67A 4EXSA 3X2ZA 4DIKA 1BMCA 1WW1A 1KO2A 2GKLA 4RL2A 4GCWA 2YNVB 1KR3A 1VGNA 2FHXA 5ACPA 2A7MA 1VMEA 2GCUA 1ZTCA 1ZKPA 1YCHA 3SFPA 5EVKA 4XWWA 2R2DA 2QINA 3SRXA 5HH5A 3G1PA 4YSLA 1X8HA 2BC2A 4Z60A 3F9OA 3I15A 2YNWA 4PVOA 2P4ZA 4U4LA 4AD9A 5EV6A 3SBLA 2FU6A 5KILA 2NXAA 4KEPA 2OHIA 5EVBA 2ZZIA 1JJTA 2Q0IA 5FQAA 4C1DA 2BFZA 4UAMA 4J5FA 2BG8A 2WYMC 5A5ZA 4LE6A 5AHRA 3MD7A 3PG4A 2HB9A 3DH8A 4UA4A 4D1UA 2BFLA 2I7XA 1A7TA 4TZEA 1DXKA 5B1UA 3ZWFA 3H3EA 5A0TA 2YNUA 1K07A 3Q6VA 1X8IA 4EXYA 3BV6A 5AHOA 3QH8A 2P18A 2Q0JA 1ZNBA 2I7VA 3IE0A 4AX1B 4ZNBA 3L6NA 4WD6A 3I0VA 2Y87A 4F6ZA 4EYFA 1YCFA 2WHGA 3IEMA 2VW8A 2Q42A 3PY6A 1QH5A 5LCAA 4ZO3A 3DHAA 2UYXA 2DKFA 1WUOA 2XR1A 4HL2A 3PY5A 3ESHA 5AXRA 2ZNBA 3AF6A 4EYBA 2BFKA 3IELA 4RL0A 3X2XA 5ACQA 3TP9A 5HH4A 4FEKA 3R2UA 3BK2A 4UBQA 5ACVA 1DD6A 2BG6A 3RPCA 3LVZA 5K4NA 5K4KA 4V0HA 3ZR9A 5ACSA 5A87A 2YNVA 2BR6A 4RBSA 2BGAA 5K0WA 4FR7A 5EH9A 2E7YA 5LE1A 4AWZA 3VPEA 3DHCA 2M5CA 2AIOA 3IDZA 2P97A 2DOOA 2OHJA 3ZQ4A 5FQBA 5LS3A 1QH3A 2OHHA 5ACXA 4HL1A 5FQCA 4C09A 3VQZA 2BG2A 1WUPA 3KNRA 3IEKA 4AX0B 2YCBA 3IOFA 4TZFA 4D1WA 4EYLA 1BVTA 2GFJA 3KNSA 3SD9A 4YSBA 2QEDA 3I13A 4TZBA 5HIOA 4NQ5A 4RAMA 4XWTA 3A4YA 4BZ3A 1L9YA 3AJ3A 2YNTB 5EVDA 1XM8A 4AWYB 4C1GA 4GYUA 5HIPA 3IE1A 4D1VA 4C1FA 4O98A 4HKYA 5ACTA 4J5HA 4NQ2A 2YNTA 5EWAA 3RKKA 4C1HA 4NQ6A 2WYMA 4C1CA 4UWOB 5EHTA 2BTNA 3BK1A 2FU8A 5HISA 2WRSA 4RAWA 1JT1A 2Y8BA 4EFZA 2QDSA 5IQKA 3SW3A 1WRAA 4DILA 4Z7RA 2FHXB 4TYTA 2AZ4A 3T3NA 4Z6XA 3FAIA 3T3OA 2BIBA 1YCGA 4ZEJA 4TZ9A 2I7TA 4D02A 4PVTA 2GMNA 2FM6A 4YSKA 3FCZA 3T9MA 2P1EA 5EW0A 4B87A 4JO0A 2QDTA 5A0VA 3KL7A 2H6AA 3SPUA 4ZO2A 1P9EA 4UWRB 4KEQA 2ZO4A 2BFZB 5KIKA 5B3RA 2BG8B 3DHBA 5AYAA 1DDKA 3JXPA 5LMCA
chains in the Genus database with same CATH superfamily
2CFUA 1JJEA 5LCFA 2WYLA 4RM5A 5ACUA 2CG3A 1MQOA 3IE2A 1Y44A 4EY2A 2NZFA 2Y8AA 5LLDA 2YZ3A 4D1TA 5AEBA 5ACRA 4Z5ZA 2FU7A 1HLKA 3IOGA 4CHLA 1XTOA 2M5DA 1M2XA 2CBNA 3I14A 2FU9A 1VJNA 4P62A 2NYPA 2ZWRA 2NZEA 5B15A 4H0DA 1KO3A 2FK6A 5ACWA 3BC2A 3ADRA 2QJSA 4TYFA 2BMIA 3X30A 2Q9UA 5AXOA 2XF4A 4FSBA 5EV8A 4F6HA 5K4MA 4XUKA 2GFKA 3X2YA 5DPXA 1X8GA 2BG7A 4UWPB 1A8TA 4GYQA 3ZNBA 4BP0A 2CFZA 4UWSB 3S0ZA 5HH6A 4C1EA 3RKJA 5LM6A 4Z5YA 5HIQA 3WXCA 4NQ4A 3I11A 1SMLA 1E5DA 3AF5A 5LSCA 1BC2A 5LCHA 3P2UA 4Z67A 4EXSA 3X2ZA 4DIKA 1BMCA 1WW1A 1KO2A 2GKLA 4RL2A 4GCWA 2YNVB 1KR3A 1VGNA 2FHXA 5ACPA 2A7MA 1VMEA 2GCUA 1ZTCA 1ZKPA 1YCHA 3SFPA 5EVKA 4XWWA 2R2DA 2QINA 3SRXA 5HH5A 3G1PA 4YSLA 1X8HA 2BC2A 4Z60A 3F9OA 3I15A 2YNWA 4PVOA 2P4ZA 4U4LA 4AD9A 5EV6A 3SBLA 2FU6A 5KILA 2NXAA 4KEPA 2OHIA 5EVBA 2ZZIA 1JJTA 2Q0IA 5FQAA 4C1DA 2BFZA 4UAMA 4J5FA 2BG8A 2WYMC 5A5ZA 4LE6A 5AHRA 3MD7A 3PG4A 2HB9A 3DH8A 4UA4A 4D1UA 2BFLA 2I7XA 1A7TA 4TZEA 1DXKA 5B1UA 3ZWFA 3H3EA 5A0TA 2YNUA 1K07A 3Q6VA 1X8IA 4EXYA 3BV6A 5A23A 5AHOA 3QH8A 2P18A 2Q0JA 1ZNBA 2I7VA 3IE0A 4AX1B 4NURA 4ZNBA 3L6NA 4WD6A 3I0VA 2Y87A 4F6ZA 4EYFA 1YCFA 2WHGA 3IEMA 2VW8A 2Q42A 3PY6A 1QH5A 5LCAA 4ZO3A 3DHAA 5AIJA 2UYXA 2DKFA 1WUOA 2XR1A 4HL2A 3PY5A 4AV7A 3ESHA 5AXRA 2ZNBA 3AF6A 4EYBA 2BFKA 3IELA 4RL0A 3X2XA 5ACQA 3TP9A 5HH4A 4FEKA 3R2UA 3BK2A 4UBQA 5ACVA 1DD6A 2BG6A 3RPCA 3LVZA 5K4NA 5K4KA 4V0HA 3ZR9A 5ACSA 5A87A 2YNVA 2BR6A 4RBSA 2BGAA 5K0WA 4FR7A 5EH9A 2E7YA 5LE1A 4AWZA 3VPEA 3DHCA 2M5CA 2AIOA 3IDZA 2P97A 2DOOA 2OHJA 3ZQ4A 5FQBA 5LS3A 1QH3A 2OHHA 5ACXA 4HL1A 5FQCA 4C09A 3VQZA 2BG2A 1WUPA 3KNRA 3IEKA 4AX0B 2YCBA 3IOFA 4TZFA 4D1WA 4EYLA 1BVTA 2GFJA 3KNSA 3SD9A 4AXHA 4YSBA 2QEDA 3I13A 4TZBA 5HIOA 4NQ5A 4RAMA 4XWTA 3A4YA 4BZ3A 1L9YA 3AJ3A 2YNTB 5EVDA 1XM8A 5AJLA 4AWYB 4C1GA 4GYUA 5HIPA 3IE1A 4D1VA 4C1FA 4O98A 4HKYA 5ACTA 4J5HA 4NQ2A 2YNTA 5EWAA 3RKKA 2YHEA 4C1HA 4NQ6A 2WYMA 4C1CA 4UWOB 5EHTA 2BTNA 3BK1A 2FU8A 5HISA 2WRSA 4RAWA 1JT1A 2Y8BA 4EFZA 2QDSA 5IQKA 3SW3A 1WRAA 4DILA 4Z7RA 2FHXB 4TYTA 2AZ4A 3T3NA 4Z6XA 3FAIA 3T3OA 2BIBA 2CG2A 1YCGA 4ZEJA 4TZ9A 2I7TA 4D02A 4PVTA 2GMNA 2FM6A 4YSKA 3FCZA 3T9MA 2P1EA 5EW0A 4B87A 4JO0A 2QDTA 5A0VA 3KL7A 2H6AA 3SPUA 4PDXA 4ZO2A 1P9EA 4UWRB 4KEQA 2ZO4A 2BFZB 5KIKA 5B3RA 2BG8B 3DHBA 5AYAA 1DDKA 3JXPA 5LMCA
chains in the Genus database with same CATH topology
1JJEA 5LCFA 2WYLA 4RM5A 5ACUA 1MQOA 3IE2A 1Y44A 4EY2A 2NZFA 2Y8AA 5LLDA 2YZ3A 4D1TA 5AEBA 5ACRA 4Z5ZA 2FU7A 1HLKA 3IOGA 4CHLA 1XTOA 2M5DA 1M2XA 2CBNA 3I14A 2FU9A 1VJNA 4P62A 2NYPA 2ZWRA 2NZEA 5B15A 4H0DA 1KO3A 2FK6A 5ACWA 3BC2A 3ADRA 2QJSA 4TYFA 2BMIA 3X30A 2Q9UA 5AXOA 2XF4A 4FSBA 5EV8A 4F6HA 5K4MA 4XUKA 2GFKA 3X2YA 5DPXA 1X8GA 2BG7A 4UWPB 1A8TA 4GYQA 3ZNBA 4BP0A 4UWSB 3S0ZA 5HH6A 4C1EA 3RKJA 5LM6A 4Z5YA 5HIQA 3WXCA 4NQ4A 3I11A 1SMLA 1E5DA 3AF5A 5LSCA 1BC2A 5LCHA 3P2UA 4Z67A 4EXSA 3X2ZA 4DIKA 1BMCA 1WW1A 1KO2A 2GKLA 4RL2A 4GCWA 2YNVB 1KR3A 1VGNA 2FHXA 5ACPA 2A7MA 1VMEA 2GCUA 1ZTCA 1ZKPA 1YCHA 3SFPA 5EVKA 4XWWA 2R2DA 2QINA 3SRXA 5HH5A 3G1PA 4YSLA 1X8HA 2BC2A 4Z60A 3F9OA 3I15A 2YNWA 4PVOA 2P4ZA 4U4LA 4AD9A 5EV6A 3SBLA 2FU6A 5KILA 2NXAA 4KEPA 2OHIA 5EVBA 2ZZIA 1JJTA 2Q0IA 5FQAA 4C1DA 2BFZA 4UAMA 4J5FA 2BG8A 2WYMC 5A5ZA 4LE6A 5AHRA 3MD7A 3PG4A 2HB9A 3DH8A 4UA4A 4D1UA 2BFLA 2I7XA 1A7TA 4TZEA 1DXKA 5B1UA 3ZWFA 3H3EA 5A0TA 2YNUA 1K07A 3Q6VA 1X8IA 4EXYA 3BV6A 5AHOA 3QH8A 2P18A 2Q0JA 1ZNBA 2I7VA 3IE0A 4AX1B 4ZNBA 3L6NA 4WD6A 3I0VA 2Y87A 4F6ZA 4EYFA 1YCFA 2WHGA 3IEMA 2VW8A 2Q42A 3PY6A 1QH5A 5LCAA 4ZO3A 3DHAA 2UYXA 2DKFA 1WUOA 2XR1A 4HL2A 3PY5A 3ESHA 5AXRA 2ZNBA 3AF6A 4EYBA 2BFKA 3IELA 4RL0A 3X2XA 5ACQA 3TP9A 5HH4A 4FEKA 3R2UA 3BK2A 4UBQA 5ACVA 1DD6A 2BG6A 3RPCA 3LVZA 5K4NA 5K4KA 4V0HA 3ZR9A 5ACSA 5A87A 2YNVA 2BR6A 4RBSA 2BGAA 5K0WA 4FR7A 5EH9A 2E7YA 5LE1A 4AWZA 3VPEA 3DHCA 2M5CA 2AIOA 3IDZA 2P97A 2DOOA 2OHJA 3ZQ4A 5FQBA 5LS3A 1QH3A 2OHHA 5ACXA 4HL1A 5FQCA 4C09A 3VQZA 2BG2A 1WUPA 3KNRA 3IEKA 4AX0B 2YCBA 3IOFA 4TZFA 4D1WA 4EYLA 1BVTA 2GFJA 3KNSA 3SD9A 4YSBA 2QEDA 3I13A 4TZBA 5HIOA 4NQ5A 4RAMA 4XWTA 3A4YA 4BZ3A 1L9YA 3AJ3A 2YNTB 5EVDA 1XM8A 4AWYB 4C1GA 4GYUA 5HIPA 3IE1A 4D1VA 4C1FA 4O98A 4HKYA 5ACTA 4J5HA 4NQ2A 2YNTA 5EWAA 3RKKA 4C1HA 4NQ6A 2WYMA 4C1CA 4UWOB 5EHTA 2BTNA 3BK1A 2FU8A 5HISA 2WRSA 4RAWA 1JT1A 2Y8BA 4EFZA 2QDSA 5IQKA 3SW3A 1WRAA 4DILA 4Z7RA 2FHXB 4TYTA 2AZ4A 3T3NA 4Z6XA 3FAIA 3T3OA 2BIBA 1YCGA 4ZEJA 4TZ9A 2I7TA 4D02A 4PVTA 2GMNA 2FM6A 4YSKA 3FCZA 3T9MA 2P1EA 5EW0A 4B87A 4JO0A 2QDTA 5A0VA 3KL7A 2H6AA 3SPUA 4ZO2A 1P9EA 4UWRB 4KEQA 2ZO4A 2BFZB 5KIKA 5B3RA 2BG8B 3DHBA 5AYAA 1DDKA 3JXPA 5LMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJE A;  5LCF A;  2WYL A;  4RM5 A;  5ACU A;  1MQO A;  3IE2 A;  1Y44 A;  4EY2 A;  2NZF A;  2Y8A A;  5LLD A;  2YZ3 A;  4D1T A;  5AEB A;  5ACR A;  4Z5Z A;  2FU7 A;  1HLK A;  3IOG A;  4CHL A;  1XTO A;  2M5D A;  1M2X A;  2CBN A;  3I14 A;  2FU9 A;  1VJN A;  4P62 A;  2NYP A;  2ZWR A;  2NZE A;  5B15 A;  4H0D A;  1KO3 A;  2FK6 A;  5ACW A;  3BC2 A;  3ADR A;  2QJS A;  4TYF A;  2BMI A;  3X30 A;  2Q9U A;  5AXO A;  2XF4 A;  4FSB A;  5EV8 A;  4F6H A;  5K4M A;  4XUK A;  2GFK A;  3X2Y A;  5DPX A;  1X8G A;  2BG7 A;  4UWP B;  1A8T A;  4GYQ A;  3ZNB A;  4BP0 A;  4UWS B;  3S0Z A;  5HH6 A;  4C1E A;  3RKJ A;  5LM6 A;  4Z5Y A;  5HIQ A;  3WXC A;  4NQ4 A;  3I11 A;  1SML A;  1E5D A;  3AF5 A;  5LSC A;  1BC2 A;  5LCH A;  3P2U A;  4Z67 A;  4EXS A;  3X2Z A;  4DIK A;  1BMC A;  1WW1 A;  1KO2 A;  2GKL A;  4RL2 A;  4GCW A;  2YNV B;  1KR3 A;  1VGN A;  2FHX A;  5ACP A;  2A7M A;  1VME A;  2GCU A;  1ZTC A;  1ZKP A;  1YCH A;  3SFP A;  5EVK A;  4XWW A;  2R2D A;  2QIN A;  3SRX A;  5HH5 A;  3G1P A;  4YSL A;  1X8H A;  2BC2 A;  4Z60 A;  3F9O A;  3I15 A;  2YNW A;  4PVO A;  2P4Z A;  4U4L A;  4AD9 A;  5EV6 A;  3SBL A;  2FU6 A;  5KIL A;  2NXA A;  4KEP A;  2OHI A;  5EVB A;  2ZZI A;  1JJT A;  2Q0I A;  5FQA A;  4C1D A;  2BFZ A;  4UAM A;  4J5F A;  2BG8 A;  2WYM C;  5A5Z A;  4LE6 A;  5AHR A;  3MD7 A;  3PG4 A;  2HB9 A;  3DH8 A;  4UA4 A;  4D1U A;  2BFL A;  2I7X A;  1A7T A;  4TZE A;  1DXK A;  5B1U A;  3ZWF A;  3H3E A;  5A0T A;  2YNU A;  1K07 A;  3Q6V A;  1X8I A;  4EXY A;  3BV6 A;  5AHO A;  3QH8 A;  2P18 A;  2Q0J A;  1ZNB A;  2I7V A;  3IE0 A;  4AX1 B;  4ZNB A;  3L6N A;  4WD6 A;  3I0V A;  2Y87 A;  4F6Z A;  4EYF A;  1YCF A;  2WHG A;  3IEM A;  2VW8 A;  2Q42 A;  3PY6 A;  1QH5 A;  5LCA A;  4ZO3 A;  3DHA A;  2UYX A;  2DKF A;  1WUO A;  2XR1 A;  4HL2 A;  3PY5 A;  3ESH A;  5AXR A;  2ZNB A;  3AF6 A;  4EYB A;  2BFK A;  3IEL A;  4RL0 A;  3X2X A;  5ACQ A;  3TP9 A;  5HH4 A;  4FEK A;  3R2U A;  3BK2 A;  4UBQ A;  5ACV A;  1DD6 A;  2BG6 A;  3RPC A;  3LVZ A;  5K4N A;  5K4K A;  4V0H A;  3ZR9 A;  5ACS A;  5A87 A;  2YNV A;  2BR6 A;  4RBS A;  2BGA A;  5K0W A;  4FR7 A;  5EH9 A;  2E7Y A;  5LE1 A;  4AWZ A;  3VPE A;  3DHC A;  2M5C A;  2AIO A;  3IDZ A;  2P97 A;  2DOO A;  2OHJ A;  3ZQ4 A;  5FQB A;  5LS3 A;  1QH3 A;  2OHH A;  5ACX A;  4HL1 A;  5FQC A;  4C09 A;  3VQZ A;  2BG2 A;  1WUP A;  3KNR A;  3IEK A;  4AX0 B;  2YCB A;  3IOF A;  4TZF A;  4D1W A;  4EYL A;  1BVT A;  2GFJ A;  3KNS A;  3SD9 A;  4YSB A;  2QED A;  3I13 A;  4TZB A;  5HIO A;  4NQ5 A;  4RAM A;  4XWT A;  3A4Y A;  4BZ3 A;  1L9Y A;  3AJ3 A;  2YNT B;  5EVD A;  1XM8 A;  4AWY B;  4C1G A;  4GYU A;  5HIP A;  3IE1 A;  4D1V A;  4C1F A;  4O98 A;  4HKY A;  5ACT A;  4J5H A;  4NQ2 A;  2YNT A;  5EWA A;  3RKK A;  4C1H A;  4NQ6 A;  2WYM A;  4C1C A;  4UWO B;  5EHT A;  2BTN A;  3BK1 A;  2FU8 A;  5HIS A;  2WRS A;  4RAW A;  1JT1 A;  2Y8B A;  4EFZ A;  2QDS A;  5IQK A;  3SW3 A;  1WRA A;  4DIL A;  4Z7R A;  2FHX B;  4TYT A;  2AZ4 A;  3T3N A;  4Z6X A;  3FAI A;  3T3O A;  2BIB A;  1YCG A;  4ZEJ A;  4TZ9 A;  2I7T A;  4D02 A;  4PVT A;  2GMN A;  2FM6 A;  4YSK A;  3FCZ A;  3T9M A;  2P1E A;  5EW0 A;  4B87 A;  4JO0 A;  2QDT A;  5A0V A;  3KL7 A;  2H6A A;  3SPU A;  4ZO2 A;  1P9E A;  4UWR B;  4KEQ A;  2ZO4 A;  2BFZ B;  5KIK A;  5B3R A;  2BG8 B;  3DHB A;  5AYA A;  1DDK A;  3JXP A;  5LMC A; 
#chains in the Genus database with same CATH topology
 2CFU A;  1JJE A;  5LCF A;  2WYL A;  4RM5 A;  5ACU A;  2CG3 A;  1MQO A;  3IE2 A;  1Y44 A;  4EY2 A;  2NZF A;  2Y8A A;  5LLD A;  2YZ3 A;  4D1T A;  5AEB A;  5ACR A;  4Z5Z A;  2FU7 A;  1HLK A;  3IOG A;  4CHL A;  1XTO A;  2M5D A;  1M2X A;  2CBN A;  3I14 A;  2FU9 A;  1VJN A;  4P62 A;  2NYP A;  2ZWR A;  2NZE A;  5B15 A;  4H0D A;  1KO3 A;  2FK6 A;  5ACW A;  3BC2 A;  3ADR A;  2QJS A;  4TYF A;  2BMI A;  3X30 A;  2Q9U A;  5AXO A;  2XF4 A;  4FSB A;  5EV8 A;  4F6H A;  5K4M A;  4XUK A;  2GFK A;  3X2Y A;  5DPX A;  1X8G A;  2BG7 A;  4UWP B;  1A8T A;  4GYQ A;  3ZNB A;  4BP0 A;  2CFZ A;  4UWS B;  3S0Z A;  5HH6 A;  4C1E A;  3RKJ A;  5LM6 A;  4Z5Y A;  5HIQ A;  3WXC A;  4NQ4 A;  3I11 A;  1SML A;  1E5D A;  3AF5 A;  5LSC A;  1BC2 A;  5LCH A;  3P2U A;  4Z67 A;  4EXS A;  3X2Z A;  4DIK A;  1BMC A;  1WW1 A;  1KO2 A;  2GKL A;  4RL2 A;  4GCW A;  2YNV B;  1KR3 A;  1VGN A;  2FHX A;  5ACP A;  2A7M A;  1VME A;  2GCU A;  1ZTC A;  1ZKP A;  1YCH A;  3SFP A;  5EVK A;  4XWW A;  2R2D A;  2QIN A;  3SRX A;  5HH5 A;  3G1P A;  4YSL A;  1X8H A;  2BC2 A;  4Z60 A;  3F9O A;  3I15 A;  2YNW A;  4PVO A;  2P4Z A;  4U4L A;  4AD9 A;  5EV6 A;  3SBL A;  2FU6 A;  5KIL A;  2NXA A;  4KEP A;  2OHI A;  5EVB A;  2ZZI A;  1JJT A;  2Q0I A;  5FQA A;  4C1D A;  2BFZ A;  4UAM A;  4J5F A;  2BG8 A;  2WYM C;  5A5Z A;  4LE6 A;  5AHR A;  3MD7 A;  3PG4 A;  2HB9 A;  3DH8 A;  4UA4 A;  4D1U A;  2BFL A;  2I7X A;  1A7T A;  4TZE A;  1DXK A;  5B1U A;  3ZWF A;  3H3E A;  5A0T A;  2YNU A;  1K07 A;  3Q6V A;  1X8I A;  4EXY A;  3BV6 A;  5A23 A;  5AHO A;  3QH8 A;  2P18 A;  2Q0J A;  1ZNB A;  2I7V A;  3IE0 A;  4AX1 B;  4NUR A;  4ZNB A;  3L6N A;  4WD6 A;  3I0V A;  2Y87 A;  4F6Z A;  4EYF A;  1YCF A;  2WHG A;  3IEM A;  2VW8 A;  2Q42 A;  3PY6 A;  1QH5 A;  5LCA A;  4ZO3 A;  3DHA A;  5AIJ A;  2UYX A;  2DKF A;  1WUO A;  2XR1 A;  4HL2 A;  3PY5 A;  4AV7 A;  3ESH A;  5AXR A;  2ZNB A;  3AF6 A;  4EYB A;  2BFK A;  3IEL A;  4RL0 A;  3X2X A;  5ACQ A;  3TP9 A;  5HH4 A;  4FEK A;  3R2U A;  3BK2 A;  4UBQ A;  5ACV A;  1DD6 A;  2BG6 A;  3RPC A;  3LVZ A;  5K4N A;  5K4K A;  4V0H A;  3ZR9 A;  5ACS A;  5A87 A;  2YNV A;  2BR6 A;  4RBS A;  2BGA A;  5K0W A;  4FR7 A;  5EH9 A;  2E7Y A;  5LE1 A;  4AWZ A;  3VPE A;  3DHC A;  2M5C A;  2AIO A;  3IDZ A;  2P97 A;  2DOO A;  2OHJ A;  3ZQ4 A;  5FQB A;  5LS3 A;  1QH3 A;  2OHH A;  5ACX A;  4HL1 A;  5FQC A;  4C09 A;  3VQZ A;  2BG2 A;  1WUP A;  3KNR A;  3IEK A;  4AX0 B;  2YCB A;  3IOF A;  4TZF A;  4D1W A;  4EYL A;  1BVT A;  2GFJ A;  3KNS A;  3SD9 A;  4AXH A;  4YSB A;  2QED A;  3I13 A;  4TZB A;  5HIO A;  4NQ5 A;  4RAM A;  4XWT A;  3A4Y A;  4BZ3 A;  1L9Y A;  3AJ3 A;  2YNT B;  5EVD A;  1XM8 A;  5AJL A;  4AWY B;  4C1G A;  4GYU A;  5HIP A;  3IE1 A;  4D1V A;  4C1F A;  4O98 A;  4HKY A;  5ACT A;  4J5H A;  4NQ2 A;  2YNT A;  5EWA A;  3RKK A;  2YHE A;  4C1H A;  4NQ6 A;  2WYM A;  4C1C A;  4UWO B;  5EHT A;  2BTN A;  3BK1 A;  2FU8 A;  5HIS A;  2WRS A;  4RAW A;  1JT1 A;  2Y8B A;  4EFZ A;  2QDS A;  5IQK A;  3SW3 A;  1WRA A;  4DIL A;  4Z7R A;  2FHX B;  4TYT A;  2AZ4 A;  3T3N A;  4Z6X A;  3FAI A;  3T3O A;  2BIB A;  2CG2 A;  1YCG A;  4ZEJ A;  4TZ9 A;  2I7T A;  4D02 A;  4PVT A;  2GMN A;  2FM6 A;  4YSK A;  3FCZ A;  3T9M A;  2P1E A;  5EW0 A;  4B87 A;  4JO0 A;  2QDT A;  5A0V A;  3KL7 A;  2H6A A;  3SPU A;  4PDX A;  4ZO2 A;  1P9E A;  4UWR B;  4KEQ A;  2ZO4 A;  2BFZ B;  5KIK A;  5B3R A;  2BG8 B;  3DHB A;  5AYA A;  1DDK A;  3JXP A;  5LMC A; 
#chains in the Genus database with same CATH homology
 1JJE A;  5LCF A;  2WYL A;  4RM5 A;  5ACU A;  1MQO A;  3IE2 A;  1Y44 A;  4EY2 A;  2NZF A;  2Y8A A;  5LLD A;  2YZ3 A;  4D1T A;  5AEB A;  5ACR A;  4Z5Z A;  2FU7 A;  1HLK A;  3IOG A;  4CHL A;  1XTO A;  2M5D A;  1M2X A;  2CBN A;  3I14 A;  2FU9 A;  1VJN A;  4P62 A;  2NYP A;  2ZWR A;  2NZE A;  5B15 A;  4H0D A;  1KO3 A;  2FK6 A;  5ACW A;  3BC2 A;  3ADR A;  2QJS A;  4TYF A;  2BMI A;  3X30 A;  2Q9U A;  5AXO A;  2XF4 A;  4FSB A;  5EV8 A;  4F6H A;  5K4M A;  4XUK A;  2GFK A;  3X2Y A;  5DPX A;  1X8G A;  2BG7 A;  4UWP B;  1A8T A;  4GYQ A;  3ZNB A;  4BP0 A;  4UWS B;  3S0Z A;  5HH6 A;  4C1E A;  3RKJ A;  5LM6 A;  4Z5Y A;  5HIQ A;  3WXC A;  4NQ4 A;  3I11 A;  1SML A;  1E5D A;  3AF5 A;  5LSC A;  1BC2 A;  5LCH A;  3P2U A;  4Z67 A;  4EXS A;  3X2Z A;  4DIK A;  1BMC A;  1WW1 A;  1KO2 A;  2GKL A;  4RL2 A;  4GCW A;  2YNV B;  1KR3 A;  1VGN A;  2FHX A;  5ACP A;  2A7M A;  1VME A;  2GCU A;  1ZTC A;  1ZKP A;  1YCH A;  3SFP A;  5EVK A;  4XWW A;  2R2D A;  2QIN A;  3SRX A;  5HH5 A;  3G1P A;  4YSL A;  1X8H A;  2BC2 A;  4Z60 A;  3F9O A;  3I15 A;  2YNW A;  4PVO A;  2P4Z A;  4U4L A;  4AD9 A;  5EV6 A;  3SBL A;  2FU6 A;  5KIL A;  2NXA A;  4KEP A;  2OHI A;  5EVB A;  2ZZI A;  1JJT A;  2Q0I A;  5FQA A;  4C1D A;  2BFZ A;  4UAM A;  4J5F A;  2BG8 A;  2WYM C;  5A5Z A;  4LE6 A;  5AHR A;  3MD7 A;  3PG4 A;  2HB9 A;  3DH8 A;  4UA4 A;  4D1U A;  2BFL A;  2I7X A;  1A7T A;  4TZE A;  1DXK A;  5B1U A;  3ZWF A;  3H3E A;  5A0T A;  2YNU A;  1K07 A;  3Q6V A;  1X8I A;  4EXY A;  3BV6 A;  5AHO A;  3QH8 A;  2P18 A;  2Q0J A;  1ZNB A;  2I7V A;  3IE0 A;  4AX1 B;  4ZNB A;  3L6N A;  4WD6 A;  3I0V A;  2Y87 A;  4F6Z A;  4EYF A;  1YCF A;  2WHG A;  3IEM A;  2VW8 A;  2Q42 A;  3PY6 A;  1QH5 A;  5LCA A;  4ZO3 A;  3DHA A;  2UYX A;  2DKF A;  1WUO A;  2XR1 A;  4HL2 A;  3PY5 A;  3ESH A;  5AXR A;  2ZNB A;  3AF6 A;  4EYB A;  2BFK A;  3IEL A;  4RL0 A;  3X2X A;  5ACQ A;  3TP9 A;  5HH4 A;  4FEK A;  3R2U A;  3BK2 A;  4UBQ A;  5ACV A;  1DD6 A;  2BG6 A;  3RPC A;  3LVZ A;  5K4N A;  5K4K A;  4V0H A;  3ZR9 A;  5ACS A;  5A87 A;  2YNV A;  2BR6 A;  4RBS A;  2BGA A;  5K0W A;  4FR7 A;  5EH9 A;  2E7Y A;  5LE1 A;  4AWZ A;  3VPE A;  3DHC A;  2M5C A;  2AIO A;  3IDZ A;  2P97 A;  2DOO A;  2OHJ A;  3ZQ4 A;  5FQB A;  5LS3 A;  1QH3 A;  2OHH A;  5ACX A;  4HL1 A;  5FQC A;  4C09 A;  3VQZ A;  2BG2 A;  1WUP A;  3KNR A;  3IEK A;  4AX0 B;  2YCB A;  3IOF A;  4TZF A;  4D1W A;  4EYL A;  1BVT A;  2GFJ A;  3KNS A;  3SD9 A;  4YSB A;  2QED A;  3I13 A;  4TZB A;  5HIO A;  4NQ5 A;  4RAM A;  4XWT A;  3A4Y A;  4BZ3 A;  1L9Y A;  3AJ3 A;  2YNT B;  5EVD A;  1XM8 A;  4AWY B;  4C1G A;  4GYU A;  5HIP A;  3IE1 A;  4D1V A;  4C1F A;  4O98 A;  4HKY A;  5ACT A;  4J5H A;  4NQ2 A;  2YNT A;  5EWA A;  3RKK A;  4C1H A;  4NQ6 A;  2WYM A;  4C1C A;  4UWO B;  5EHT A;  2BTN A;  3BK1 A;  2FU8 A;  5HIS A;  2WRS A;  4RAW A;  1JT1 A;  2Y8B A;  4EFZ A;  2QDS A;  5IQK A;  3SW3 A;  1WRA A;  4DIL A;  4Z7R A;  2FHX B;  4TYT A;  2AZ4 A;  3T3N A;  4Z6X A;  3FAI A;  3T3O A;  2BIB A;  1YCG A;  4ZEJ A;  4TZ9 A;  2I7T A;  4D02 A;  4PVT A;  2GMN A;  2FM6 A;  4YSK A;  3FCZ A;  3T9M A;  2P1E A;  5EW0 A;  4B87 A;  4JO0 A;  2QDT A;  5A0V A;  3KL7 A;  2H6A A;  3SPU A;  4ZO2 A;  1P9E A;  4UWR B;  4KEQ A;  2ZO4 A;  2BFZ B;  5KIK A;  5B3R A;  2BG8 B;  3DHB A;  5AYA A;  1DDK A;  3JXP A;  5LMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...