4F6ZA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
232
structure length
221
Chain Sequence
PDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNEHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 60
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6zA00
1WUOA 4D1WA 1XM8A 4UAMA 4H0DA 3A4YA 4F6HA 5IQKA 2CBNA 3P2UA 3RKKA 4BP0A 2YZ3A 5K0WA 3R2UA 1KO3A 3IE1A 4UWOB 4EYLA 4D02A 3SW3A 2Q9UA 1SMLA 4AX0B 3ZR9A 5EV6A 4NQ4A 5AHOA 3I13A 4AD9A 2BR6A 4ZO3A 4UA4A 5ACQA 2R2DA 4EYFA 3IOGA 4AWZA 5A5ZA 2ZWRA 3IEMA 1KO2A 2M5CA 3MD7A 4TZ9A 3PY5A 4UWSB 2BG8B 4AX1B 1E5DA 4D1VA 4DILA 2YNTB 4GCWA 1A8TA 5ACPA 4YSLA 4EXYA 4C1HA 5EVDA 4AWYB 4JO0A 2YNVA 2BC2A 3L6NA 3QH8A 4NQ5A 2HB9A 5AEBA 3IE0A 1YCGA 1VGNA 4UWPB 5K4NA 3BC2A 2NYPA 2QJSA 5HH6A 2AIOA 4RL0A 4O98A 4FEKA 4YSKA 3T3NA 5DPXA 4EY2A 3DHBA 5B3RA 4DIKA 2P18A 4TZBA 1YCHA 5FQBA 4ZEJA 2BG7A 3DH8A 2I7XA 2YCBA 4Z6XA 4Z7RA 1L9YA 2Q0JA 4C1EA 4EYBA 2OHHA 3X2ZA 3KNRA 1X8GA 4FR7A 5ACUA 3X2YA 2WYMA 2M5DA 5EHTA 4EFZA 2ZZIA 1ZKPA 1Y44A 3SFPA 1DDKA 4TYTA 4C1CA 2Q42A 4CHLA 5A0TA 4LE6A 2P1EA 5A87A 5ACRA 5AHRA 5HH5A 2BG2A 2WYLA 2BFZA 2OHJA 4RBSA 5EH9A 3S0ZA 3VQZA 1BMCA 4PVTA 2ZO4A 3I11A 4UBQA 3T3OA 4U4LA 4TYFA 2FU8A 2OHIA 3X30A 3RKJA 2YNVB 2BFZB 2UYXA 3AF6A 5B15A 3IE2A 1K07A 2XF4A 5HIOA 1JJEA 3DHAA 3F9OA 4Z67A 4HL1A 4Z60A 1VMEA 4C1DA 1QH5A 3I14A 2DOOA 5B1UA 4RAMA 1WW1A 1WUPA 3FAIA 5LCAA 5EWAA 4D1TA 4D1UA 1XTOA 3JXPA 2QINA 3IOFA 3DHCA 4HL2A 5LLDA 1JT1A 3AF5A 5ACWA 1VJNA 2QEDA 2ZNBA 2P97A 1BVTA 4KEPA 4TZEA 4XWTA 4PVOA 5A0VA 4TZFA 5HISA 3KNSA 2NZFA 4HKYA 3TP9A 5LS3A 2BFLA 3LVZA 1P9EA 3Q6VA 2BGAA 4Z5ZA 3BK1A 2GMNA 3ESHA 4EXSA 5EW0A 2FK6A 2GFJA 5LMCA 3SPUA 2I7TA 1WRAA 4P62A 1ZTCA 2GFKA 3SD9A 2FM6A 5KILA 4GYUA 4NQ2A 3X2XA 3IDZA 3PG4A 3I0VA 5FQAA 2BG8A 5LSCA 3ZQ4A 4RM5A 2AZ4A 5EV8A 3RPCA 4RL2A 1DXKA 2WRSA 2A7MA 3IEKA 3H3EA 4YSBA 5LCFA 2NXAA 1QH3A 2FHXB 2BG6A 3ZWFA 3G1PA 5LE1A 5AXRA 2FHXA 1KR3A 5ACTA 2GKLA 1DD6A 3ZNBA 2FU6A 4Z5YA 4C09A 3WXCA 5ACXA 4KEQA 2Y8AA 3VPEA 5K4KA 5EVBA 2I7VA 2YNWA 5EVKA 2H6AA 4BZ3A 1MQOA 2Y87A 2Q0IA 3IELA 2QDTA 3AJ3A 5HIQA 5K4MA 3BK2A 2FU9A 2YNTA 5ACSA 3FCZA 2Y8BA 4ZNBA 4C1FA 1HLKA 3BV6A 2NZEA 2BIBA 4J5HA 1BC2A 5FQCA 3SRXA 3SBLA 2BFKA 4XUKA 5KIKA 2YNUA 4GYQA 4F6ZA 4ZO2A 4V0HA 4B87A 5LM6A 4WD6A 2GCUA 2P4ZA 5LCHA 4RAWA 1M2XA 4J5FA 3I15A 5AYAA 1X8IA 5AXOA 2VW8A 2E7YA 2FU7A 4UWRB 3PY6A 3KL7A 2WHGA 3ADRA 1JJTA 3T9MA 2DKFA 5HH4A 1YCFA 4NQ6A 2BMIA 5HIPA 1A7TA 4C1GA 2BTNA 4XWWA 1ZNBA 2QDSA 4FSBA 2WYMC 2XR1A 5ACVA 1X8HA
chains in the Genus database with same CATH superfamily
1WUOA 4D1WA 1XM8A 4UAMA 4H0DA 3A4YA 4F6HA 5IQKA 2CBNA 3P2UA 3RKKA 4BP0A 2YZ3A 5K0WA 3R2UA 1KO3A 3IE1A 4UWOB 4EYLA 4D02A 3SW3A 2Q9UA 1SMLA 4AX0B 3ZR9A 5EV6A 4NQ4A 5AHOA 3I13A 4AD9A 2BR6A 4ZO3A 4UA4A 5ACQA 2CG2A 2R2DA 4EYFA 3IOGA 4AWZA 5A5ZA 2ZWRA 3IEMA 1KO2A 2M5CA 3MD7A 4TZ9A 3PY5A 4UWSB 2BG8B 4AX1B 1E5DA 4D1VA 4DILA 2YNTB 4GCWA 1A8TA 5ACPA 4YSLA 4EXYA 4C1HA 5EVDA 4AWYB 4JO0A 2YNVA 2BC2A 3L6NA 3QH8A 4NQ5A 2HB9A 5AEBA 3IE0A 1YCGA 1VGNA 4UWPB 5K4NA 3BC2A 2NYPA 2QJSA 5HH6A 2AIOA 4RL0A 4O98A 4FEKA 4YSKA 3T3NA 5DPXA 4EY2A 3DHBA 5B3RA 4DIKA 2P18A 4TZBA 1YCHA 5FQBA 4ZEJA 2BG7A 3DH8A 2I7XA 2YCBA 4Z6XA 4Z7RA 1L9YA 2Q0JA 4C1EA 4EYBA 2OHHA 3X2ZA 3KNRA 1X8GA 4FR7A 5ACUA 3X2YA 2WYMA 4AXHA 2M5DA 5EHTA 4EFZA 2ZZIA 1ZKPA 1Y44A 3SFPA 1DDKA 4TYTA 4C1CA 2Q42A 4CHLA 5A0TA 4LE6A 2P1EA 5A87A 5ACRA 5AHRA 5HH5A 2BG2A 2WYLA 2BFZA 2OHJA 4RBSA 5EH9A 3S0ZA 3VQZA 1BMCA 4PVTA 2ZO4A 3I11A 5A23A 2CG3A 4UBQA 3T3OA 4U4LA 4TYFA 2FU8A 2OHIA 3X30A 3RKJA 2CFZA 2YNVB 2BFZB 2UYXA 3AF6A 5B15A 3IE2A 1K07A 2XF4A 5HIOA 1JJEA 3DHAA 3F9OA 4Z67A 4HL1A 4Z60A 1VMEA 4C1DA 1QH5A 3I14A 2DOOA 5B1UA 4RAMA 1WW1A 1WUPA 3FAIA 5LCAA 5EWAA 4D1TA 4D1UA 1XTOA 3JXPA 2QINA 3IOFA 3DHCA 4HL2A 5LLDA 2YHEA 1JT1A 3AF5A 5ACWA 1VJNA 2QEDA 2ZNBA 2P97A 1BVTA 4KEPA 4TZEA 4XWTA 4PVOA 5A0VA 4TZFA 5HISA 3KNSA 2NZFA 4HKYA 4NURA 3TP9A 5LS3A 2BFLA 3LVZA 1P9EA 3Q6VA 2BGAA 4Z5ZA 3BK1A 5AJLA 2GMNA 3ESHA 4EXSA 5EW0A 2FK6A 2GFJA 5LMCA 2CFUA 3SPUA 2I7TA 1WRAA 4P62A 1ZTCA 2GFKA 3SD9A 2FM6A 5KILA 4GYUA 4NQ2A 3X2XA 3IDZA 3PG4A 3I0VA 5FQAA 2BG8A 5LSCA 3ZQ4A 4RM5A 2AZ4A 5EV8A 3RPCA 4RL2A 1DXKA 2WRSA 2A7MA 3IEKA 3H3EA 4YSBA 5LCFA 2NXAA 1QH3A 2FHXB 2BG6A 3ZWFA 3G1PA 5LE1A 5AXRA 2FHXA 1KR3A 5ACTA 2GKLA 1DD6A 3ZNBA 2FU6A 4Z5YA 4C09A 3WXCA 5ACXA 4KEQA 2Y8AA 3VPEA 5K4KA 4PDXA 5EVBA 2I7VA 2YNWA 5EVKA 2H6AA 4BZ3A 1MQOA 2Y87A 2Q0IA 3IELA 2QDTA 3AJ3A 5HIQA 5K4MA 3BK2A 2FU9A 2YNTA 5ACSA 3FCZA 2Y8BA 4ZNBA 4C1FA 1HLKA 3BV6A 2NZEA 2BIBA 4J5HA 1BC2A 5FQCA 3SRXA 3SBLA 2BFKA 4XUKA 5KIKA 2YNUA 5AIJA 4GYQA 4F6ZA 4ZO2A 4V0HA 4B87A 5LM6A 4WD6A 2GCUA 2P4ZA 5LCHA 4RAWA 1M2XA 4J5FA 3I15A 5AYAA 1X8IA 5AXOA 2VW8A 2E7YA 2FU7A 4UWRB 3PY6A 3KL7A 2WHGA 3ADRA 1JJTA 3T9MA 2DKFA 5HH4A 1YCFA 4NQ6A 2BMIA 5HIPA 1A7TA 4AV7A 4C1GA 2BTNA 4XWWA 1ZNBA 2QDSA 4FSBA 2WYMC 2XR1A 5ACVA 1X8HA
chains in the Genus database with same CATH topology
1WUOA 4D1WA 1XM8A 4UAMA 4H0DA 3A4YA 4F6HA 5IQKA 2CBNA 3P2UA 3RKKA 4BP0A 2YZ3A 5K0WA 3R2UA 1KO3A 3IE1A 4UWOB 4EYLA 4D02A 3SW3A 2Q9UA 1SMLA 4AX0B 3ZR9A 5EV6A 4NQ4A 5AHOA 3I13A 4AD9A 2BR6A 4ZO3A 4UA4A 5ACQA 2R2DA 4EYFA 3IOGA 4AWZA 5A5ZA 2ZWRA 3IEMA 1KO2A 2M5CA 3MD7A 4TZ9A 3PY5A 4UWSB 2BG8B 4AX1B 1E5DA 4D1VA 4DILA 2YNTB 4GCWA 1A8TA 5ACPA 4YSLA 4EXYA 4C1HA 5EVDA 4AWYB 4JO0A 2YNVA 2BC2A 3L6NA 3QH8A 4NQ5A 2HB9A 5AEBA 3IE0A 1YCGA 1VGNA 4UWPB 5K4NA 3BC2A 2NYPA 2QJSA 5HH6A 2AIOA 4RL0A 4O98A 4FEKA 4YSKA 3T3NA 5DPXA 4EY2A 3DHBA 5B3RA 4DIKA 2P18A 4TZBA 1YCHA 5FQBA 4ZEJA 2BG7A 3DH8A 2I7XA 2YCBA 4Z6XA 4Z7RA 1L9YA 2Q0JA 4C1EA 4EYBA 2OHHA 3X2ZA 3KNRA 1X8GA 4FR7A 5ACUA 3X2YA 2WYMA 2M5DA 5EHTA 4EFZA 2ZZIA 1ZKPA 1Y44A 3SFPA 1DDKA 4TYTA 4C1CA 2Q42A 4CHLA 5A0TA 4LE6A 2P1EA 5A87A 5ACRA 5AHRA 5HH5A 2BG2A 2WYLA 2BFZA 2OHJA 4RBSA 5EH9A 3S0ZA 3VQZA 1BMCA 4PVTA 2ZO4A 3I11A 4UBQA 3T3OA 4U4LA 4TYFA 2FU8A 2OHIA 3X30A 3RKJA 2YNVB 2BFZB 2UYXA 3AF6A 5B15A 3IE2A 1K07A 2XF4A 5HIOA 1JJEA 3DHAA 3F9OA 4Z67A 4HL1A 4Z60A 1VMEA 4C1DA 1QH5A 3I14A 2DOOA 5B1UA 4RAMA 1WW1A 1WUPA 3FAIA 5LCAA 5EWAA 4D1TA 4D1UA 1XTOA 3JXPA 2QINA 3IOFA 3DHCA 4HL2A 5LLDA 1JT1A 3AF5A 5ACWA 1VJNA 2QEDA 2ZNBA 2P97A 1BVTA 4KEPA 4TZEA 4XWTA 4PVOA 5A0VA 4TZFA 5HISA 3KNSA 2NZFA 4HKYA 3TP9A 5LS3A 2BFLA 3LVZA 1P9EA 3Q6VA 2BGAA 4Z5ZA 3BK1A 2GMNA 3ESHA 4EXSA 5EW0A 2FK6A 2GFJA 5LMCA 3SPUA 2I7TA 1WRAA 4P62A 1ZTCA 2GFKA 3SD9A 2FM6A 5KILA 4GYUA 4NQ2A 3X2XA 3IDZA 3PG4A 3I0VA 5FQAA 2BG8A 5LSCA 3ZQ4A 4RM5A 2AZ4A 5EV8A 3RPCA 4RL2A 1DXKA 2WRSA 2A7MA 3IEKA 3H3EA 4YSBA 5LCFA 2NXAA 1QH3A 2FHXB 2BG6A 3ZWFA 3G1PA 5LE1A 5AXRA 2FHXA 1KR3A 5ACTA 2GKLA 1DD6A 3ZNBA 2FU6A 4Z5YA 4C09A 3WXCA 5ACXA 4KEQA 2Y8AA 3VPEA 5K4KA 5EVBA 2I7VA 2YNWA 5EVKA 2H6AA 4BZ3A 1MQOA 2Y87A 2Q0IA 3IELA 2QDTA 3AJ3A 5HIQA 5K4MA 3BK2A 2FU9A 2YNTA 5ACSA 3FCZA 2Y8BA 4ZNBA 4C1FA 1HLKA 3BV6A 2NZEA 2BIBA 4J5HA 1BC2A 5FQCA 3SRXA 3SBLA 2BFKA 4XUKA 5KIKA 2YNUA 4GYQA 4F6ZA 4ZO2A 4V0HA 4B87A 5LM6A 4WD6A 2GCUA 2P4ZA 5LCHA 4RAWA 1M2XA 4J5FA 3I15A 5AYAA 1X8IA 5AXOA 2VW8A 2E7YA 2FU7A 4UWRB 3PY6A 3KL7A 2WHGA 3ADRA 1JJTA 3T9MA 2DKFA 5HH4A 1YCFA 4NQ6A 2BMIA 5HIPA 1A7TA 4C1GA 2BTNA 4XWWA 1ZNBA 2QDSA 4FSBA 2WYMC 2XR1A 5ACVA 1X8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUO A;  4D1W A;  1XM8 A;  4UAM A;  4H0D A;  3A4Y A;  4F6H A;  5IQK A;  2CBN A;  3P2U A;  3RKK A;  4BP0 A;  2YZ3 A;  5K0W A;  3R2U A;  1KO3 A;  3IE1 A;  4UWO B;  4EYL A;  4D02 A;  3SW3 A;  2Q9U A;  1SML A;  4AX0 B;  3ZR9 A;  5EV6 A;  4NQ4 A;  5AHO A;  3I13 A;  4AD9 A;  2BR6 A;  4ZO3 A;  4UA4 A;  5ACQ A;  2R2D A;  4EYF A;  3IOG A;  4AWZ A;  5A5Z A;  2ZWR A;  3IEM A;  1KO2 A;  2M5C A;  3MD7 A;  4TZ9 A;  3PY5 A;  4UWS B;  2BG8 B;  4AX1 B;  1E5D A;  4D1V A;  4DIL A;  2YNT B;  4GCW A;  1A8T A;  5ACP A;  4YSL A;  4EXY A;  4C1H A;  5EVD A;  4AWY B;  4JO0 A;  2YNV A;  2BC2 A;  3L6N A;  3QH8 A;  4NQ5 A;  2HB9 A;  5AEB A;  3IE0 A;  1YCG A;  1VGN A;  4UWP B;  5K4N A;  3BC2 A;  2NYP A;  2QJS A;  5HH6 A;  2AIO A;  4RL0 A;  4O98 A;  4FEK A;  4YSK A;  3T3N A;  5DPX A;  4EY2 A;  3DHB A;  5B3R A;  4DIK A;  2P18 A;  4TZB A;  1YCH A;  5FQB A;  4ZEJ A;  2BG7 A;  3DH8 A;  2I7X A;  2YCB A;  4Z6X A;  4Z7R A;  1L9Y A;  2Q0J A;  4C1E A;  4EYB A;  2OHH A;  3X2Z A;  3KNR A;  1X8G A;  4FR7 A;  5ACU A;  3X2Y A;  2WYM A;  2M5D A;  5EHT A;  4EFZ A;  2ZZI A;  1ZKP A;  1Y44 A;  3SFP A;  1DDK A;  4TYT A;  4C1C A;  2Q42 A;  4CHL A;  5A0T A;  4LE6 A;  2P1E A;  5A87 A;  5ACR A;  5AHR A;  5HH5 A;  2BG2 A;  2WYL A;  2BFZ A;  2OHJ A;  4RBS A;  5EH9 A;  3S0Z A;  3VQZ A;  1BMC A;  4PVT A;  2ZO4 A;  3I11 A;  4UBQ A;  3T3O A;  4U4L A;  4TYF A;  2FU8 A;  2OHI A;  3X30 A;  3RKJ A;  2YNV B;  2BFZ B;  2UYX A;  3AF6 A;  5B15 A;  3IE2 A;  1K07 A;  2XF4 A;  5HIO A;  1JJE A;  3DHA A;  3F9O A;  4Z67 A;  4HL1 A;  4Z60 A;  1VME A;  4C1D A;  1QH5 A;  3I14 A;  2DOO A;  5B1U A;  4RAM A;  1WW1 A;  1WUP A;  3FAI A;  5LCA A;  5EWA A;  4D1T A;  4D1U A;  1XTO A;  3JXP A;  2QIN A;  3IOF A;  3DHC A;  4HL2 A;  5LLD A;  1JT1 A;  3AF5 A;  5ACW A;  1VJN A;  2QED A;  2ZNB A;  2P97 A;  1BVT A;  4KEP A;  4TZE A;  4XWT A;  4PVO A;  5A0V A;  4TZF A;  5HIS A;  3KNS A;  2NZF A;  4HKY A;  3TP9 A;  5LS3 A;  2BFL A;  3LVZ A;  1P9E A;  3Q6V A;  2BGA A;  4Z5Z A;  3BK1 A;  2GMN A;  3ESH A;  4EXS A;  5EW0 A;  2FK6 A;  2GFJ A;  5LMC A;  3SPU A;  2I7T A;  1WRA A;  4P62 A;  1ZTC A;  2GFK A;  3SD9 A;  2FM6 A;  5KIL A;  4GYU A;  4NQ2 A;  3X2X A;  3IDZ A;  3PG4 A;  3I0V A;  5FQA A;  2BG8 A;  5LSC A;  3ZQ4 A;  4RM5 A;  2AZ4 A;  5EV8 A;  3RPC A;  4RL2 A;  1DXK A;  2WRS A;  2A7M A;  3IEK A;  3H3E A;  4YSB A;  5LCF A;  2NXA A;  1QH3 A;  2FHX B;  2BG6 A;  3ZWF A;  3G1P A;  5LE1 A;  5AXR A;  2FHX A;  1KR3 A;  5ACT A;  2GKL A;  1DD6 A;  3ZNB A;  2FU6 A;  4Z5Y A;  4C09 A;  3WXC A;  5ACX A;  4KEQ A;  2Y8A A;  3VPE A;  5K4K A;  5EVB A;  2I7V A;  2YNW A;  5EVK A;  2H6A A;  4BZ3 A;  1MQO A;  2Y87 A;  2Q0I A;  3IEL A;  2QDT A;  3AJ3 A;  5HIQ A;  5K4M A;  3BK2 A;  2FU9 A;  2YNT A;  5ACS A;  3FCZ A;  2Y8B A;  4ZNB A;  4C1F A;  1HLK A;  3BV6 A;  2NZE A;  2BIB A;  4J5H A;  1BC2 A;  5FQC A;  3SRX A;  3SBL A;  2BFK A;  4XUK A;  5KIK A;  2YNU A;  4GYQ A;  4F6Z A;  4ZO2 A;  4V0H A;  4B87 A;  5LM6 A;  4WD6 A;  2GCU A;  2P4Z A;  5LCH A;  4RAW A;  1M2X A;  4J5F A;  3I15 A;  5AYA A;  1X8I A;  5AXO A;  2VW8 A;  2E7Y A;  2FU7 A;  4UWR B;  3PY6 A;  3KL7 A;  2WHG A;  3ADR A;  1JJT A;  3T9M A;  2DKF A;  5HH4 A;  1YCF A;  4NQ6 A;  2BMI A;  5HIP A;  1A7T A;  4C1G A;  2BTN A;  4XWW A;  1ZNB A;  2QDS A;  4FSB A;  2WYM C;  2XR1 A;  5ACV A;  1X8H A; 
#chains in the Genus database with same CATH topology
 1WUO A;  4D1W A;  1XM8 A;  4UAM A;  4H0D A;  3A4Y A;  4F6H A;  5IQK A;  2CBN A;  3P2U A;  3RKK A;  4BP0 A;  2YZ3 A;  5K0W A;  3R2U A;  1KO3 A;  3IE1 A;  4UWO B;  4EYL A;  4D02 A;  3SW3 A;  2Q9U A;  1SML A;  4AX0 B;  3ZR9 A;  5EV6 A;  4NQ4 A;  5AHO A;  3I13 A;  4AD9 A;  2BR6 A;  4ZO3 A;  4UA4 A;  5ACQ A;  2CG2 A;  2R2D A;  4EYF A;  3IOG A;  4AWZ A;  5A5Z A;  2ZWR A;  3IEM A;  1KO2 A;  2M5C A;  3MD7 A;  4TZ9 A;  3PY5 A;  4UWS B;  2BG8 B;  4AX1 B;  1E5D A;  4D1V A;  4DIL A;  2YNT B;  4GCW A;  1A8T A;  5ACP A;  4YSL A;  4EXY A;  4C1H A;  5EVD A;  4AWY B;  4JO0 A;  2YNV A;  2BC2 A;  3L6N A;  3QH8 A;  4NQ5 A;  2HB9 A;  5AEB A;  3IE0 A;  1YCG A;  1VGN A;  4UWP B;  5K4N A;  3BC2 A;  2NYP A;  2QJS A;  5HH6 A;  2AIO A;  4RL0 A;  4O98 A;  4FEK A;  4YSK A;  3T3N A;  5DPX A;  4EY2 A;  3DHB A;  5B3R A;  4DIK A;  2P18 A;  4TZB A;  1YCH A;  5FQB A;  4ZEJ A;  2BG7 A;  3DH8 A;  2I7X A;  2YCB A;  4Z6X A;  4Z7R A;  1L9Y A;  2Q0J A;  4C1E A;  4EYB A;  2OHH A;  3X2Z A;  3KNR A;  1X8G A;  4FR7 A;  5ACU A;  3X2Y A;  2WYM A;  4AXH A;  2M5D A;  5EHT A;  4EFZ A;  2ZZI A;  1ZKP A;  1Y44 A;  3SFP A;  1DDK A;  4TYT A;  4C1C A;  2Q42 A;  4CHL A;  5A0T A;  4LE6 A;  2P1E A;  5A87 A;  5ACR A;  5AHR A;  5HH5 A;  2BG2 A;  2WYL A;  2BFZ A;  2OHJ A;  4RBS A;  5EH9 A;  3S0Z A;  3VQZ A;  1BMC A;  4PVT A;  2ZO4 A;  3I11 A;  5A23 A;  2CG3 A;  4UBQ A;  3T3O A;  4U4L A;  4TYF A;  2FU8 A;  2OHI A;  3X30 A;  3RKJ A;  2CFZ A;  2YNV B;  2BFZ B;  2UYX A;  3AF6 A;  5B15 A;  3IE2 A;  1K07 A;  2XF4 A;  5HIO A;  1JJE A;  3DHA A;  3F9O A;  4Z67 A;  4HL1 A;  4Z60 A;  1VME A;  4C1D A;  1QH5 A;  3I14 A;  2DOO A;  5B1U A;  4RAM A;  1WW1 A;  1WUP A;  3FAI A;  5LCA A;  5EWA A;  4D1T A;  4D1U A;  1XTO A;  3JXP A;  2QIN A;  3IOF A;  3DHC A;  4HL2 A;  5LLD A;  2YHE A;  1JT1 A;  3AF5 A;  5ACW A;  1VJN A;  2QED A;  2ZNB A;  2P97 A;  1BVT A;  4KEP A;  4TZE A;  4XWT A;  4PVO A;  5A0V A;  4TZF A;  5HIS A;  3KNS A;  2NZF A;  4HKY A;  4NUR A;  3TP9 A;  5LS3 A;  2BFL A;  3LVZ A;  1P9E A;  3Q6V A;  2BGA A;  4Z5Z A;  3BK1 A;  5AJL A;  2GMN A;  3ESH A;  4EXS A;  5EW0 A;  2FK6 A;  2GFJ A;  5LMC A;  2CFU A;  3SPU A;  2I7T A;  1WRA A;  4P62 A;  1ZTC A;  2GFK A;  3SD9 A;  2FM6 A;  5KIL A;  4GYU A;  4NQ2 A;  3X2X A;  3IDZ A;  3PG4 A;  3I0V A;  5FQA A;  2BG8 A;  5LSC A;  3ZQ4 A;  4RM5 A;  2AZ4 A;  5EV8 A;  3RPC A;  4RL2 A;  1DXK A;  2WRS A;  2A7M A;  3IEK A;  3H3E A;  4YSB A;  5LCF A;  2NXA A;  1QH3 A;  2FHX B;  2BG6 A;  3ZWF A;  3G1P A;  5LE1 A;  5AXR A;  2FHX A;  1KR3 A;  5ACT A;  2GKL A;  1DD6 A;  3ZNB A;  2FU6 A;  4Z5Y A;  4C09 A;  3WXC A;  5ACX A;  4KEQ A;  2Y8A A;  3VPE A;  5K4K A;  4PDX A;  5EVB A;  2I7V A;  2YNW A;  5EVK A;  2H6A A;  4BZ3 A;  1MQO A;  2Y87 A;  2Q0I A;  3IEL A;  2QDT A;  3AJ3 A;  5HIQ A;  5K4M A;  3BK2 A;  2FU9 A;  2YNT A;  5ACS A;  3FCZ A;  2Y8B A;  4ZNB A;  4C1F A;  1HLK A;  3BV6 A;  2NZE A;  2BIB A;  4J5H A;  1BC2 A;  5FQC A;  3SRX A;  3SBL A;  2BFK A;  4XUK A;  5KIK A;  2YNU A;  5AIJ A;  4GYQ A;  4F6Z A;  4ZO2 A;  4V0H A;  4B87 A;  5LM6 A;  4WD6 A;  2GCU A;  2P4Z A;  5LCH A;  4RAW A;  1M2X A;  4J5F A;  3I15 A;  5AYA A;  1X8I A;  5AXO A;  2VW8 A;  2E7Y A;  2FU7 A;  4UWR B;  3PY6 A;  3KL7 A;  2WHG A;  3ADR A;  1JJT A;  3T9M A;  2DKF A;  5HH4 A;  1YCF A;  4NQ6 A;  2BMI A;  5HIP A;  1A7T A;  4AV7 A;  4C1G A;  2BTN A;  4XWW A;  1ZNB A;  2QDS A;  4FSB A;  2WYM C;  2XR1 A;  5ACV A;  1X8H A; 
#chains in the Genus database with same CATH homology
 1WUO A;  4D1W A;  1XM8 A;  4UAM A;  4H0D A;  3A4Y A;  4F6H A;  5IQK A;  2CBN A;  3P2U A;  3RKK A;  4BP0 A;  2YZ3 A;  5K0W A;  3R2U A;  1KO3 A;  3IE1 A;  4UWO B;  4EYL A;  4D02 A;  3SW3 A;  2Q9U A;  1SML A;  4AX0 B;  3ZR9 A;  5EV6 A;  4NQ4 A;  5AHO A;  3I13 A;  4AD9 A;  2BR6 A;  4ZO3 A;  4UA4 A;  5ACQ A;  2R2D A;  4EYF A;  3IOG A;  4AWZ A;  5A5Z A;  2ZWR A;  3IEM A;  1KO2 A;  2M5C A;  3MD7 A;  4TZ9 A;  3PY5 A;  4UWS B;  2BG8 B;  4AX1 B;  1E5D A;  4D1V A;  4DIL A;  2YNT B;  4GCW A;  1A8T A;  5ACP A;  4YSL A;  4EXY A;  4C1H A;  5EVD A;  4AWY B;  4JO0 A;  2YNV A;  2BC2 A;  3L6N A;  3QH8 A;  4NQ5 A;  2HB9 A;  5AEB A;  3IE0 A;  1YCG A;  1VGN A;  4UWP B;  5K4N A;  3BC2 A;  2NYP A;  2QJS A;  5HH6 A;  2AIO A;  4RL0 A;  4O98 A;  4FEK A;  4YSK A;  3T3N A;  5DPX A;  4EY2 A;  3DHB A;  5B3R A;  4DIK A;  2P18 A;  4TZB A;  1YCH A;  5FQB A;  4ZEJ A;  2BG7 A;  3DH8 A;  2I7X A;  2YCB A;  4Z6X A;  4Z7R A;  1L9Y A;  2Q0J A;  4C1E A;  4EYB A;  2OHH A;  3X2Z A;  3KNR A;  1X8G A;  4FR7 A;  5ACU A;  3X2Y A;  2WYM A;  2M5D A;  5EHT A;  4EFZ A;  2ZZI A;  1ZKP A;  1Y44 A;  3SFP A;  1DDK A;  4TYT A;  4C1C A;  2Q42 A;  4CHL A;  5A0T A;  4LE6 A;  2P1E A;  5A87 A;  5ACR A;  5AHR A;  5HH5 A;  2BG2 A;  2WYL A;  2BFZ A;  2OHJ A;  4RBS A;  5EH9 A;  3S0Z A;  3VQZ A;  1BMC A;  4PVT A;  2ZO4 A;  3I11 A;  4UBQ A;  3T3O A;  4U4L A;  4TYF A;  2FU8 A;  2OHI A;  3X30 A;  3RKJ A;  2YNV B;  2BFZ B;  2UYX A;  3AF6 A;  5B15 A;  3IE2 A;  1K07 A;  2XF4 A;  5HIO A;  1JJE A;  3DHA A;  3F9O A;  4Z67 A;  4HL1 A;  4Z60 A;  1VME A;  4C1D A;  1QH5 A;  3I14 A;  2DOO A;  5B1U A;  4RAM A;  1WW1 A;  1WUP A;  3FAI A;  5LCA A;  5EWA A;  4D1T A;  4D1U A;  1XTO A;  3JXP A;  2QIN A;  3IOF A;  3DHC A;  4HL2 A;  5LLD A;  1JT1 A;  3AF5 A;  5ACW A;  1VJN A;  2QED A;  2ZNB A;  2P97 A;  1BVT A;  4KEP A;  4TZE A;  4XWT A;  4PVO A;  5A0V A;  4TZF A;  5HIS A;  3KNS A;  2NZF A;  4HKY A;  3TP9 A;  5LS3 A;  2BFL A;  3LVZ A;  1P9E A;  3Q6V A;  2BGA A;  4Z5Z A;  3BK1 A;  2GMN A;  3ESH A;  4EXS A;  5EW0 A;  2FK6 A;  2GFJ A;  5LMC A;  3SPU A;  2I7T A;  1WRA A;  4P62 A;  1ZTC A;  2GFK A;  3SD9 A;  2FM6 A;  5KIL A;  4GYU A;  4NQ2 A;  3X2X A;  3IDZ A;  3PG4 A;  3I0V A;  5FQA A;  2BG8 A;  5LSC A;  3ZQ4 A;  4RM5 A;  2AZ4 A;  5EV8 A;  3RPC A;  4RL2 A;  1DXK A;  2WRS A;  2A7M A;  3IEK A;  3H3E A;  4YSB A;  5LCF A;  2NXA A;  1QH3 A;  2FHX B;  2BG6 A;  3ZWF A;  3G1P A;  5LE1 A;  5AXR A;  2FHX A;  1KR3 A;  5ACT A;  2GKL A;  1DD6 A;  3ZNB A;  2FU6 A;  4Z5Y A;  4C09 A;  3WXC A;  5ACX A;  4KEQ A;  2Y8A A;  3VPE A;  5K4K A;  5EVB A;  2I7V A;  2YNW A;  5EVK A;  2H6A A;  4BZ3 A;  1MQO A;  2Y87 A;  2Q0I A;  3IEL A;  2QDT A;  3AJ3 A;  5HIQ A;  5K4M A;  3BK2 A;  2FU9 A;  2YNT A;  5ACS A;  3FCZ A;  2Y8B A;  4ZNB A;  4C1F A;  1HLK A;  3BV6 A;  2NZE A;  2BIB A;  4J5H A;  1BC2 A;  5FQC A;  3SRX A;  3SBL A;  2BFK A;  4XUK A;  5KIK A;  2YNU A;  4GYQ A;  4F6Z A;  4ZO2 A;  4V0H A;  4B87 A;  5LM6 A;  4WD6 A;  2GCU A;  2P4Z A;  5LCH A;  4RAW A;  1M2X A;  4J5F A;  3I15 A;  5AYA A;  1X8I A;  5AXO A;  2VW8 A;  2E7Y A;  2FU7 A;  4UWR B;  3PY6 A;  3KL7 A;  2WHG A;  3ADR A;  1JJT A;  3T9M A;  2DKF A;  5HH4 A;  1YCF A;  4NQ6 A;  2BMI A;  5HIP A;  1A7T A;  4C1G A;  2BTN A;  4XWW A;  1ZNB A;  2QDS A;  4FSB A;  2WYM C;  2XR1 A;  5ACV A;  1X8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...