4F6ZA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
232
structure length
221
Chain Sequence
PDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNEHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 60
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6zA00
5DPXA 2R2DA 2Y8AA 3X2ZA 2P97A 3IEKA 3WXCA 4GYUA 2Q0IA 3T3OA 5EVDA 2YNUA 3AJ3A 4TZBA 4PVOA 5B3RA 3I15A 2QEDA 4P62A 2QINA 4EXSA 2E7YA 1DDKA 5LMCA 5EV6A 1KO2A 4B87A 2BG7A 3FCZA 2I7VA 5ACQA 4EXYA 1YCGA 4EFZA 3BK2A 4AWZA 1YCHA 3PY6A 4NQ4A 3I13A 1WUPA 3KNSA 4C1FA 1E5DA 4RAWA 5HH5A 5ACVA 2YNVB 4Z5YA 2FU7A 4AWYB 4TYTA 4TZEA 3H3EA 4FR7A 4Z67A 3SFPA 3VPEA 4PVTA 4C1CA 4XWWA 4EYBA 4EYLA 2OHIA 3BC2A 4D02A 1DD6A 1ZTCA 2AZ4A 3KL7A 1VMEA 2BGAA 4YSLA 3A4YA 3ADRA 5AHOA 1VGNA 5HH4A 2WYLA 2FHXA 3X2XA 3TP9A 3DHCA 2I7TA 4AX1B 1ZNBA 2Y8BA 2Q9UA 2YNTA 4TYFA 1HLKA 4EY2A 4CHLA 2FU6A 3IE1A 2NXAA 3SW3A 3SRXA 3F9OA 1L9YA 4C1EA 2NZFA 3RKJA 4UWOB 4DILA 4C1GA 3X30A 5EVKA 5LCFA 4ZEJA 1X8IA 5FQBA 3IOFA 2FU8A 5ACRA 1WW1A 2WHGA 2QJSA 5EHTA 2ZWRA 2AIOA 2ZNBA 5LM6A 4XWTA 4H0DA 3KNRA 1DXKA 2QDSA 5LS3A 5A87A 1K07A 2GCUA 2DKFA 5K4MA 4HL1A 3Q6VA 1XTOA 3BV6A 2P4ZA 2BG6A 4WD6A 5HH6A 3IELA 4HL2A 4GCWA 2FHXB 4D1VA 2Q0JA 4RBSA 4UWPB 3ZQ4A 3IE2A 5EW0A 2YNTB 5FQAA 3IEMA 4KEQA 2BG8B 3FAIA 4Z5ZA 4AX0B 5LCAA 1JJEA 4RL0A 1A7TA 4TZ9A 3VQZA 1QH3A 5AEBA 5B15A 4UAMA 1BVTA 2BR6A 4J5FA 5KILA 4ZO2A 5AXRA 4RL2A 5EVBA 5EWAA 2FK6A 5A0TA 3DH8A 5K0WA 3DHAA 4D1WA 5LE1A 1BMCA 3AF5A 2H6AA 3T3NA 2BFZA 3X2YA 1SMLA 3SBLA 1ZKPA 1QH5A 5K4KA 4C1DA 3I0VA 5ACUA 4FSBA 2BG8A 4Z60A 1JJTA 4Z6XA 2M5CA 3JXPA 5AYAA 4ZNBA 1X8GA 5LLDA 3SD9A 4Z7RA 5K4NA 2FM6A 2Y87A 4J5HA 4RM5A 5A0VA 2GFJA 2GMNA 4BZ3A 3I14A 2OHHA 2OHJA 3IDZA 4TZFA 3S0ZA 5AXOA 3ZWFA 2HB9A 2WYMA 2BIBA 1BC2A 5ACXA 3RPCA 4UWSB 2CBNA 3P2UA 2QDTA 1KO3A 1MQOA 4EYFA 1VJNA 2ZO4A 3L6NA 4C1HA 3PG4A 5ACPA 2WYMC 3QH8A 2I7XA 5LSCA 4NQ6A 1YCFA 4ZO3A 2BFZB 2NYPA 2A7MA 4KEPA 1Y44A 4NQ5A 2YNWA 3RKKA 3IOGA 4YSKA 2Q42A 3T9MA 5EV8A 5ACSA 4UBQA 2GKLA 5HIPA 4XUKA 2XR1A 4D1UA 1KR3A 2YCBA 2M5DA 4V0HA 5KIKA 1WRAA 5AHRA 4F6ZA 4DIKA 2FU9A 5EH9A 3DHBA 2BMIA 3ESHA 4D1TA 4YSBA 2BC2A 4C09A 1A8TA 4UWRB 3ZR9A 1P9EA 1X8HA 3AF6A 5HIOA 2P18A 4BP0A 2BFKA 2P1EA 4U4LA 3BK1A 3SPUA 2UYXA 4O98A 5HISA 3ZNBA 2DOOA 2GFKA 1XM8A 4UA4A 4HKYA 5HIQA 5IQKA 2NZEA 1JT1A 4F6HA 2ZZIA 4AD9A 2BFLA 5ACTA 2VW8A 3LVZA 1M2XA 2YZ3A 2WRSA 4RAMA 3R2UA 4LE6A 4JO0A 3I11A 1WUOA 5LCHA 2YNVA 5A5ZA 4GYQA 2BTNA 2XF4A 4NQ2A 3MD7A 5ACWA 5FQCA 2BG2A 3G1PA 3PY5A 4FEKA 3IE0A 5B1UA
chains in the Genus database with same CATH superfamily
5DPXA 2R2DA 2Y8AA 3X2ZA 2P97A 2YHEA 3IEKA 3WXCA 4GYUA 2Q0IA 3T3OA 5EVDA 2YNUA 3AJ3A 4TZBA 4PVOA 5B3RA 3I15A 2QEDA 4P62A 2QINA 4EXSA 2E7YA 1DDKA 5LMCA 5EV6A 1KO2A 4B87A 2BG7A 3FCZA 2I7VA 5ACQA 4EXYA 1YCGA 5AIJA 4EFZA 3BK2A 4AWZA 1YCHA 3PY6A 4NQ4A 3I13A 2CFZA 1WUPA 3KNSA 4C1FA 1E5DA 4RAWA 5HH5A 5ACVA 2YNVB 4Z5YA 2FU7A 4AWYB 4TYTA 4TZEA 3H3EA 4FR7A 4Z67A 3SFPA 3VPEA 4PVTA 4C1CA 4XWWA 4EYBA 4EYLA 2OHIA 3BC2A 4D02A 1DD6A 1ZTCA 2AZ4A 3KL7A 1VMEA 2BGAA 4YSLA 3A4YA 3ADRA 5AHOA 1VGNA 5HH4A 2WYLA 2FHXA 3X2XA 3TP9A 3DHCA 2I7TA 4AX1B 1ZNBA 2Y8BA 2Q9UA 2YNTA 4TYFA 1HLKA 4EY2A 4CHLA 2FU6A 3IE1A 2NXAA 3SW3A 3SRXA 3F9OA 1L9YA 4C1EA 2NZFA 3RKJA 4UWOB 4DILA 4C1GA 3X30A 5EVKA 5LCFA 4ZEJA 1X8IA 5FQBA 3IOFA 2FU8A 5ACRA 1WW1A 2WHGA 2QJSA 5EHTA 2ZWRA 2AIOA 2ZNBA 5LM6A 4XWTA 4H0DA 3KNRA 1DXKA 2QDSA 5LS3A 5A87A 1K07A 2GCUA 2DKFA 5K4MA 4HL1A 3Q6VA 1XTOA 3BV6A 2P4ZA 4AXHA 2CG2A 2BG6A 4WD6A 5HH6A 3IELA 4HL2A 2CG3A 4GCWA 2FHXB 4D1VA 2Q0JA 4RBSA 4UWPB 3ZQ4A 4AV7A 3IE2A 5EW0A 2YNTB 5FQAA 3IEMA 4KEQA 2BG8B 3FAIA 4Z5ZA 4AX0B 5LCAA 1JJEA 4RL0A 1A7TA 4TZ9A 3VQZA 1QH3A 5AEBA 5B15A 4UAMA 1BVTA 2BR6A 4J5FA 5KILA 4ZO2A 5A23A 5AXRA 4RL2A 5EVBA 5EWAA 2FK6A 5A0TA 3DH8A 5K0WA 3DHAA 4D1WA 5LE1A 1BMCA 3AF5A 5AJLA 2H6AA 3T3NA 2BFZA 3X2YA 1SMLA 3SBLA 1ZKPA 1QH5A 5K4KA 4C1DA 3I0VA 5ACUA 4FSBA 2BG8A 4Z60A 1JJTA 4Z6XA 2M5CA 3JXPA 5AYAA 4ZNBA 1X8GA 5LLDA 3SD9A 4Z7RA 5K4NA 2FM6A 2Y87A 4J5HA 4RM5A 5A0VA 2GFJA 2GMNA 4BZ3A 3I14A 2OHHA 2OHJA 3IDZA 4TZFA 3S0ZA 5AXOA 3ZWFA 2HB9A 2WYMA 2BIBA 1BC2A 5ACXA 3RPCA 4UWSB 2CBNA 3P2UA 2QDTA 1KO3A 4PDXA 1MQOA 4EYFA 1VJNA 2ZO4A 3L6NA 4C1HA 3PG4A 5ACPA 2WYMC 3QH8A 2I7XA 5LSCA 4NQ6A 1YCFA 4ZO3A 2BFZB 2NYPA 2A7MA 2CFUA 4KEPA 1Y44A 4NQ5A 2YNWA 3RKKA 3IOGA 4YSKA 2Q42A 3T9MA 5EV8A 5ACSA 4UBQA 2GKLA 5HIPA 4XUKA 2XR1A 4D1UA 1KR3A 2YCBA 2M5DA 4V0HA 5KIKA 1WRAA 5AHRA 4F6ZA 4DIKA 2FU9A 5EH9A 3DHBA 2BMIA 3ESHA 4D1TA 4YSBA 2BC2A 4C09A 1A8TA 4UWRB 3ZR9A 1P9EA 1X8HA 3AF6A 5HIOA 2P18A 4NURA 4BP0A 2BFKA 2P1EA 4U4LA 3BK1A 3SPUA 2UYXA 4O98A 5HISA 3ZNBA 2DOOA 2GFKA 1XM8A 4UA4A 4HKYA 5HIQA 5IQKA 2NZEA 1JT1A 4F6HA 2ZZIA 4AD9A 2BFLA 5ACTA 2VW8A 3LVZA 1M2XA 2YZ3A 2WRSA 4RAMA 3R2UA 4LE6A 4JO0A 3I11A 1WUOA 5LCHA 2YNVA 5A5ZA 4GYQA 2BTNA 2XF4A 4NQ2A 3MD7A 5ACWA 5FQCA 2BG2A 3G1PA 3PY5A 4FEKA 3IE0A 5B1UA
chains in the Genus database with same CATH topology
5DPXA 2R2DA 2Y8AA 3X2ZA 2P97A 3IEKA 3WXCA 4GYUA 2Q0IA 3T3OA 5EVDA 2YNUA 3AJ3A 4TZBA 4PVOA 5B3RA 3I15A 2QEDA 4P62A 2QINA 4EXSA 2E7YA 1DDKA 5LMCA 5EV6A 1KO2A 4B87A 2BG7A 3FCZA 2I7VA 5ACQA 4EXYA 1YCGA 4EFZA 3BK2A 4AWZA 1YCHA 3PY6A 4NQ4A 3I13A 1WUPA 3KNSA 4C1FA 1E5DA 4RAWA 5HH5A 5ACVA 2YNVB 4Z5YA 2FU7A 4AWYB 4TYTA 4TZEA 3H3EA 4FR7A 4Z67A 3SFPA 3VPEA 4PVTA 4C1CA 4XWWA 4EYBA 4EYLA 2OHIA 3BC2A 4D02A 1DD6A 1ZTCA 2AZ4A 3KL7A 1VMEA 2BGAA 4YSLA 3A4YA 3ADRA 5AHOA 1VGNA 5HH4A 2WYLA 2FHXA 3X2XA 3TP9A 3DHCA 2I7TA 4AX1B 1ZNBA 2Y8BA 2Q9UA 2YNTA 4TYFA 1HLKA 4EY2A 4CHLA 2FU6A 3IE1A 2NXAA 3SW3A 3SRXA 3F9OA 1L9YA 4C1EA 2NZFA 3RKJA 4UWOB 4DILA 4C1GA 3X30A 5EVKA 5LCFA 4ZEJA 1X8IA 5FQBA 3IOFA 2FU8A 5ACRA 1WW1A 2WHGA 2QJSA 5EHTA 2ZWRA 2AIOA 2ZNBA 5LM6A 4XWTA 4H0DA 3KNRA 1DXKA 2QDSA 5LS3A 5A87A 1K07A 2GCUA 2DKFA 5K4MA 4HL1A 3Q6VA 1XTOA 3BV6A 2P4ZA 2BG6A 4WD6A 5HH6A 3IELA 4HL2A 4GCWA 2FHXB 4D1VA 2Q0JA 4RBSA 4UWPB 3ZQ4A 3IE2A 5EW0A 2YNTB 5FQAA 3IEMA 4KEQA 2BG8B 3FAIA 4Z5ZA 4AX0B 5LCAA 1JJEA 4RL0A 1A7TA 4TZ9A 3VQZA 1QH3A 5AEBA 5B15A 4UAMA 1BVTA 2BR6A 4J5FA 5KILA 4ZO2A 5AXRA 4RL2A 5EVBA 5EWAA 2FK6A 5A0TA 3DH8A 5K0WA 3DHAA 4D1WA 5LE1A 1BMCA 3AF5A 2H6AA 3T3NA 2BFZA 3X2YA 1SMLA 3SBLA 1ZKPA 1QH5A 5K4KA 4C1DA 3I0VA 5ACUA 4FSBA 2BG8A 4Z60A 1JJTA 4Z6XA 2M5CA 3JXPA 5AYAA 4ZNBA 1X8GA 5LLDA 3SD9A 4Z7RA 5K4NA 2FM6A 2Y87A 4J5HA 4RM5A 5A0VA 2GFJA 2GMNA 4BZ3A 3I14A 2OHHA 2OHJA 3IDZA 4TZFA 3S0ZA 5AXOA 3ZWFA 2HB9A 2WYMA 2BIBA 1BC2A 5ACXA 3RPCA 4UWSB 2CBNA 3P2UA 2QDTA 1KO3A 1MQOA 4EYFA 1VJNA 2ZO4A 3L6NA 4C1HA 3PG4A 5ACPA 2WYMC 3QH8A 2I7XA 5LSCA 4NQ6A 1YCFA 4ZO3A 2BFZB 2NYPA 2A7MA 4KEPA 1Y44A 4NQ5A 2YNWA 3RKKA 3IOGA 4YSKA 2Q42A 3T9MA 5EV8A 5ACSA 4UBQA 2GKLA 5HIPA 4XUKA 2XR1A 4D1UA 1KR3A 2YCBA 2M5DA 4V0HA 5KIKA 1WRAA 5AHRA 4F6ZA 4DIKA 2FU9A 5EH9A 3DHBA 2BMIA 3ESHA 4D1TA 4YSBA 2BC2A 4C09A 1A8TA 4UWRB 3ZR9A 1P9EA 1X8HA 3AF6A 5HIOA 2P18A 4BP0A 2BFKA 2P1EA 4U4LA 3BK1A 3SPUA 2UYXA 4O98A 5HISA 3ZNBA 2DOOA 2GFKA 1XM8A 4UA4A 4HKYA 5HIQA 5IQKA 2NZEA 1JT1A 4F6HA 2ZZIA 4AD9A 2BFLA 5ACTA 2VW8A 3LVZA 1M2XA 2YZ3A 2WRSA 4RAMA 3R2UA 4LE6A 4JO0A 3I11A 1WUOA 5LCHA 2YNVA 5A5ZA 4GYQA 2BTNA 2XF4A 4NQ2A 3MD7A 5ACWA 5FQCA 2BG2A 3G1PA 3PY5A 4FEKA 3IE0A 5B1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DPX A;  2R2D A;  2Y8A A;  3X2Z A;  2P97 A;  3IEK A;  3WXC A;  4GYU A;  2Q0I A;  3T3O A;  5EVD A;  2YNU A;  3AJ3 A;  4TZB A;  4PVO A;  5B3R A;  3I15 A;  2QED A;  4P62 A;  2QIN A;  4EXS A;  2E7Y A;  1DDK A;  5LMC A;  5EV6 A;  1KO2 A;  4B87 A;  2BG7 A;  3FCZ A;  2I7V A;  5ACQ A;  4EXY A;  1YCG A;  4EFZ A;  3BK2 A;  4AWZ A;  1YCH A;  3PY6 A;  4NQ4 A;  3I13 A;  1WUP A;  3KNS A;  4C1F A;  1E5D A;  4RAW A;  5HH5 A;  5ACV A;  2YNV B;  4Z5Y A;  2FU7 A;  4AWY B;  4TYT A;  4TZE A;  3H3E A;  4FR7 A;  4Z67 A;  3SFP A;  3VPE A;  4PVT A;  4C1C A;  4XWW A;  4EYB A;  4EYL A;  2OHI A;  3BC2 A;  4D02 A;  1DD6 A;  1ZTC A;  2AZ4 A;  3KL7 A;  1VME A;  2BGA A;  4YSL A;  3A4Y A;  3ADR A;  5AHO A;  1VGN A;  5HH4 A;  2WYL A;  2FHX A;  3X2X A;  3TP9 A;  3DHC A;  2I7T A;  4AX1 B;  1ZNB A;  2Y8B A;  2Q9U A;  2YNT A;  4TYF A;  1HLK A;  4EY2 A;  4CHL A;  2FU6 A;  3IE1 A;  2NXA A;  3SW3 A;  3SRX A;  3F9O A;  1L9Y A;  4C1E A;  2NZF A;  3RKJ A;  4UWO B;  4DIL A;  4C1G A;  3X30 A;  5EVK A;  5LCF A;  4ZEJ A;  1X8I A;  5FQB A;  3IOF A;  2FU8 A;  5ACR A;  1WW1 A;  2WHG A;  2QJS A;  5EHT A;  2ZWR A;  2AIO A;  2ZNB A;  5LM6 A;  4XWT A;  4H0D A;  3KNR A;  1DXK A;  2QDS A;  5LS3 A;  5A87 A;  1K07 A;  2GCU A;  2DKF A;  5K4M A;  4HL1 A;  3Q6V A;  1XTO A;  3BV6 A;  2P4Z A;  2BG6 A;  4WD6 A;  5HH6 A;  3IEL A;  4HL2 A;  4GCW A;  2FHX B;  4D1V A;  2Q0J A;  4RBS A;  4UWP B;  3ZQ4 A;  3IE2 A;  5EW0 A;  2YNT B;  5FQA A;  3IEM A;  4KEQ A;  2BG8 B;  3FAI A;  4Z5Z A;  4AX0 B;  5LCA A;  1JJE A;  4RL0 A;  1A7T A;  4TZ9 A;  3VQZ A;  1QH3 A;  5AEB A;  5B15 A;  4UAM A;  1BVT A;  2BR6 A;  4J5F A;  5KIL A;  4ZO2 A;  5AXR A;  4RL2 A;  5EVB A;  5EWA A;  2FK6 A;  5A0T A;  3DH8 A;  5K0W A;  3DHA A;  4D1W A;  5LE1 A;  1BMC A;  3AF5 A;  2H6A A;  3T3N A;  2BFZ A;  3X2Y A;  1SML A;  3SBL A;  1ZKP A;  1QH5 A;  5K4K A;  4C1D A;  3I0V A;  5ACU A;  4FSB A;  2BG8 A;  4Z60 A;  1JJT A;  4Z6X A;  2M5C A;  3JXP A;  5AYA A;  4ZNB A;  1X8G A;  5LLD A;  3SD9 A;  4Z7R A;  5K4N A;  2FM6 A;  2Y87 A;  4J5H A;  4RM5 A;  5A0V A;  2GFJ A;  2GMN A;  4BZ3 A;  3I14 A;  2OHH A;  2OHJ A;  3IDZ A;  4TZF A;  3S0Z A;  5AXO A;  3ZWF A;  2HB9 A;  2WYM A;  2BIB A;  1BC2 A;  5ACX A;  3RPC A;  4UWS B;  2CBN A;  3P2U A;  2QDT A;  1KO3 A;  1MQO A;  4EYF A;  1VJN A;  2ZO4 A;  3L6N A;  4C1H A;  3PG4 A;  5ACP A;  2WYM C;  3QH8 A;  2I7X A;  5LSC A;  4NQ6 A;  1YCF A;  4ZO3 A;  2BFZ B;  2NYP A;  2A7M A;  4KEP A;  1Y44 A;  4NQ5 A;  2YNW A;  3RKK A;  3IOG A;  4YSK A;  2Q42 A;  3T9M A;  5EV8 A;  5ACS A;  4UBQ A;  2GKL A;  5HIP A;  4XUK A;  2XR1 A;  4D1U A;  1KR3 A;  2YCB A;  2M5D A;  4V0H A;  5KIK A;  1WRA A;  5AHR A;  4F6Z A;  4DIK A;  2FU9 A;  5EH9 A;  3DHB A;  2BMI A;  3ESH A;  4D1T A;  4YSB A;  2BC2 A;  4C09 A;  1A8T A;  4UWR B;  3ZR9 A;  1P9E A;  1X8H A;  3AF6 A;  5HIO A;  2P18 A;  4BP0 A;  2BFK A;  2P1E A;  4U4L A;  3BK1 A;  3SPU A;  2UYX A;  4O98 A;  5HIS A;  3ZNB A;  2DOO A;  2GFK A;  1XM8 A;  4UA4 A;  4HKY A;  5HIQ A;  5IQK A;  2NZE A;  1JT1 A;  4F6H A;  2ZZI A;  4AD9 A;  2BFL A;  5ACT A;  2VW8 A;  3LVZ A;  1M2X A;  2YZ3 A;  2WRS A;  4RAM A;  3R2U A;  4LE6 A;  4JO0 A;  3I11 A;  1WUO A;  5LCH A;  2YNV A;  5A5Z A;  4GYQ A;  2BTN A;  2XF4 A;  4NQ2 A;  3MD7 A;  5ACW A;  5FQC A;  2BG2 A;  3G1P A;  3PY5 A;  4FEK A;  3IE0 A;  5B1U A; 
#chains in the Genus database with same CATH topology
 5DPX A;  2R2D A;  2Y8A A;  3X2Z A;  2P97 A;  2YHE A;  3IEK A;  3WXC A;  4GYU A;  2Q0I A;  3T3O A;  5EVD A;  2YNU A;  3AJ3 A;  4TZB A;  4PVO A;  5B3R A;  3I15 A;  2QED A;  4P62 A;  2QIN A;  4EXS A;  2E7Y A;  1DDK A;  5LMC A;  5EV6 A;  1KO2 A;  4B87 A;  2BG7 A;  3FCZ A;  2I7V A;  5ACQ A;  4EXY A;  1YCG A;  5AIJ A;  4EFZ A;  3BK2 A;  4AWZ A;  1YCH A;  3PY6 A;  4NQ4 A;  3I13 A;  2CFZ A;  1WUP A;  3KNS A;  4C1F A;  1E5D A;  4RAW A;  5HH5 A;  5ACV A;  2YNV B;  4Z5Y A;  2FU7 A;  4AWY B;  4TYT A;  4TZE A;  3H3E A;  4FR7 A;  4Z67 A;  3SFP A;  3VPE A;  4PVT A;  4C1C A;  4XWW A;  4EYB A;  4EYL A;  2OHI A;  3BC2 A;  4D02 A;  1DD6 A;  1ZTC A;  2AZ4 A;  3KL7 A;  1VME A;  2BGA A;  4YSL A;  3A4Y A;  3ADR A;  5AHO A;  1VGN A;  5HH4 A;  2WYL A;  2FHX A;  3X2X A;  3TP9 A;  3DHC A;  2I7T A;  4AX1 B;  1ZNB A;  2Y8B A;  2Q9U A;  2YNT A;  4TYF A;  1HLK A;  4EY2 A;  4CHL A;  2FU6 A;  3IE1 A;  2NXA A;  3SW3 A;  3SRX A;  3F9O A;  1L9Y A;  4C1E A;  2NZF A;  3RKJ A;  4UWO B;  4DIL A;  4C1G A;  3X30 A;  5EVK A;  5LCF A;  4ZEJ A;  1X8I A;  5FQB A;  3IOF A;  2FU8 A;  5ACR A;  1WW1 A;  2WHG A;  2QJS A;  5EHT A;  2ZWR A;  2AIO A;  2ZNB A;  5LM6 A;  4XWT A;  4H0D A;  3KNR A;  1DXK A;  2QDS A;  5LS3 A;  5A87 A;  1K07 A;  2GCU A;  2DKF A;  5K4M A;  4HL1 A;  3Q6V A;  1XTO A;  3BV6 A;  2P4Z A;  4AXH A;  2CG2 A;  2BG6 A;  4WD6 A;  5HH6 A;  3IEL A;  4HL2 A;  2CG3 A;  4GCW A;  2FHX B;  4D1V A;  2Q0J A;  4RBS A;  4UWP B;  3ZQ4 A;  4AV7 A;  3IE2 A;  5EW0 A;  2YNT B;  5FQA A;  3IEM A;  4KEQ A;  2BG8 B;  3FAI A;  4Z5Z A;  4AX0 B;  5LCA A;  1JJE A;  4RL0 A;  1A7T A;  4TZ9 A;  3VQZ A;  1QH3 A;  5AEB A;  5B15 A;  4UAM A;  1BVT A;  2BR6 A;  4J5F A;  5KIL A;  4ZO2 A;  5A23 A;  5AXR A;  4RL2 A;  5EVB A;  5EWA A;  2FK6 A;  5A0T A;  3DH8 A;  5K0W A;  3DHA A;  4D1W A;  5LE1 A;  1BMC A;  3AF5 A;  5AJL A;  2H6A A;  3T3N A;  2BFZ A;  3X2Y A;  1SML A;  3SBL A;  1ZKP A;  1QH5 A;  5K4K A;  4C1D A;  3I0V A;  5ACU A;  4FSB A;  2BG8 A;  4Z60 A;  1JJT A;  4Z6X A;  2M5C A;  3JXP A;  5AYA A;  4ZNB A;  1X8G A;  5LLD A;  3SD9 A;  4Z7R A;  5K4N A;  2FM6 A;  2Y87 A;  4J5H A;  4RM5 A;  5A0V A;  2GFJ A;  2GMN A;  4BZ3 A;  3I14 A;  2OHH A;  2OHJ A;  3IDZ A;  4TZF A;  3S0Z A;  5AXO A;  3ZWF A;  2HB9 A;  2WYM A;  2BIB A;  1BC2 A;  5ACX A;  3RPC A;  4UWS B;  2CBN A;  3P2U A;  2QDT A;  1KO3 A;  4PDX A;  1MQO A;  4EYF A;  1VJN A;  2ZO4 A;  3L6N A;  4C1H A;  3PG4 A;  5ACP A;  2WYM C;  3QH8 A;  2I7X A;  5LSC A;  4NQ6 A;  1YCF A;  4ZO3 A;  2BFZ B;  2NYP A;  2A7M A;  2CFU A;  4KEP A;  1Y44 A;  4NQ5 A;  2YNW A;  3RKK A;  3IOG A;  4YSK A;  2Q42 A;  3T9M A;  5EV8 A;  5ACS A;  4UBQ A;  2GKL A;  5HIP A;  4XUK A;  2XR1 A;  4D1U A;  1KR3 A;  2YCB A;  2M5D A;  4V0H A;  5KIK A;  1WRA A;  5AHR A;  4F6Z A;  4DIK A;  2FU9 A;  5EH9 A;  3DHB A;  2BMI A;  3ESH A;  4D1T A;  4YSB A;  2BC2 A;  4C09 A;  1A8T A;  4UWR B;  3ZR9 A;  1P9E A;  1X8H A;  3AF6 A;  5HIO A;  2P18 A;  4NUR A;  4BP0 A;  2BFK A;  2P1E A;  4U4L A;  3BK1 A;  3SPU A;  2UYX A;  4O98 A;  5HIS A;  3ZNB A;  2DOO A;  2GFK A;  1XM8 A;  4UA4 A;  4HKY A;  5HIQ A;  5IQK A;  2NZE A;  1JT1 A;  4F6H A;  2ZZI A;  4AD9 A;  2BFL A;  5ACT A;  2VW8 A;  3LVZ A;  1M2X A;  2YZ3 A;  2WRS A;  4RAM A;  3R2U A;  4LE6 A;  4JO0 A;  3I11 A;  1WUO A;  5LCH A;  2YNV A;  5A5Z A;  4GYQ A;  2BTN A;  2XF4 A;  4NQ2 A;  3MD7 A;  5ACW A;  5FQC A;  2BG2 A;  3G1P A;  3PY5 A;  4FEK A;  3IE0 A;  5B1U A; 
#chains in the Genus database with same CATH homology
 5DPX A;  2R2D A;  2Y8A A;  3X2Z A;  2P97 A;  3IEK A;  3WXC A;  4GYU A;  2Q0I A;  3T3O A;  5EVD A;  2YNU A;  3AJ3 A;  4TZB A;  4PVO A;  5B3R A;  3I15 A;  2QED A;  4P62 A;  2QIN A;  4EXS A;  2E7Y A;  1DDK A;  5LMC A;  5EV6 A;  1KO2 A;  4B87 A;  2BG7 A;  3FCZ A;  2I7V A;  5ACQ A;  4EXY A;  1YCG A;  4EFZ A;  3BK2 A;  4AWZ A;  1YCH A;  3PY6 A;  4NQ4 A;  3I13 A;  1WUP A;  3KNS A;  4C1F A;  1E5D A;  4RAW A;  5HH5 A;  5ACV A;  2YNV B;  4Z5Y A;  2FU7 A;  4AWY B;  4TYT A;  4TZE A;  3H3E A;  4FR7 A;  4Z67 A;  3SFP A;  3VPE A;  4PVT A;  4C1C A;  4XWW A;  4EYB A;  4EYL A;  2OHI A;  3BC2 A;  4D02 A;  1DD6 A;  1ZTC A;  2AZ4 A;  3KL7 A;  1VME A;  2BGA A;  4YSL A;  3A4Y A;  3ADR A;  5AHO A;  1VGN A;  5HH4 A;  2WYL A;  2FHX A;  3X2X A;  3TP9 A;  3DHC A;  2I7T A;  4AX1 B;  1ZNB A;  2Y8B A;  2Q9U A;  2YNT A;  4TYF A;  1HLK A;  4EY2 A;  4CHL A;  2FU6 A;  3IE1 A;  2NXA A;  3SW3 A;  3SRX A;  3F9O A;  1L9Y A;  4C1E A;  2NZF A;  3RKJ A;  4UWO B;  4DIL A;  4C1G A;  3X30 A;  5EVK A;  5LCF A;  4ZEJ A;  1X8I A;  5FQB A;  3IOF A;  2FU8 A;  5ACR A;  1WW1 A;  2WHG A;  2QJS A;  5EHT A;  2ZWR A;  2AIO A;  2ZNB A;  5LM6 A;  4XWT A;  4H0D A;  3KNR A;  1DXK A;  2QDS A;  5LS3 A;  5A87 A;  1K07 A;  2GCU A;  2DKF A;  5K4M A;  4HL1 A;  3Q6V A;  1XTO A;  3BV6 A;  2P4Z A;  2BG6 A;  4WD6 A;  5HH6 A;  3IEL A;  4HL2 A;  4GCW A;  2FHX B;  4D1V A;  2Q0J A;  4RBS A;  4UWP B;  3ZQ4 A;  3IE2 A;  5EW0 A;  2YNT B;  5FQA A;  3IEM A;  4KEQ A;  2BG8 B;  3FAI A;  4Z5Z A;  4AX0 B;  5LCA A;  1JJE A;  4RL0 A;  1A7T A;  4TZ9 A;  3VQZ A;  1QH3 A;  5AEB A;  5B15 A;  4UAM A;  1BVT A;  2BR6 A;  4J5F A;  5KIL A;  4ZO2 A;  5AXR A;  4RL2 A;  5EVB A;  5EWA A;  2FK6 A;  5A0T A;  3DH8 A;  5K0W A;  3DHA A;  4D1W A;  5LE1 A;  1BMC A;  3AF5 A;  2H6A A;  3T3N A;  2BFZ A;  3X2Y A;  1SML A;  3SBL A;  1ZKP A;  1QH5 A;  5K4K A;  4C1D A;  3I0V A;  5ACU A;  4FSB A;  2BG8 A;  4Z60 A;  1JJT A;  4Z6X A;  2M5C A;  3JXP A;  5AYA A;  4ZNB A;  1X8G A;  5LLD A;  3SD9 A;  4Z7R A;  5K4N A;  2FM6 A;  2Y87 A;  4J5H A;  4RM5 A;  5A0V A;  2GFJ A;  2GMN A;  4BZ3 A;  3I14 A;  2OHH A;  2OHJ A;  3IDZ A;  4TZF A;  3S0Z A;  5AXO A;  3ZWF A;  2HB9 A;  2WYM A;  2BIB A;  1BC2 A;  5ACX A;  3RPC A;  4UWS B;  2CBN A;  3P2U A;  2QDT A;  1KO3 A;  1MQO A;  4EYF A;  1VJN A;  2ZO4 A;  3L6N A;  4C1H A;  3PG4 A;  5ACP A;  2WYM C;  3QH8 A;  2I7X A;  5LSC A;  4NQ6 A;  1YCF A;  4ZO3 A;  2BFZ B;  2NYP A;  2A7M A;  4KEP A;  1Y44 A;  4NQ5 A;  2YNW A;  3RKK A;  3IOG A;  4YSK A;  2Q42 A;  3T9M A;  5EV8 A;  5ACS A;  4UBQ A;  2GKL A;  5HIP A;  4XUK A;  2XR1 A;  4D1U A;  1KR3 A;  2YCB A;  2M5D A;  4V0H A;  5KIK A;  1WRA A;  5AHR A;  4F6Z A;  4DIK A;  2FU9 A;  5EH9 A;  3DHB A;  2BMI A;  3ESH A;  4D1T A;  4YSB A;  2BC2 A;  4C09 A;  1A8T A;  4UWR B;  3ZR9 A;  1P9E A;  1X8H A;  3AF6 A;  5HIO A;  2P18 A;  4BP0 A;  2BFK A;  2P1E A;  4U4L A;  3BK1 A;  3SPU A;  2UYX A;  4O98 A;  5HIS A;  3ZNB A;  2DOO A;  2GFK A;  1XM8 A;  4UA4 A;  4HKY A;  5HIQ A;  5IQK A;  2NZE A;  1JT1 A;  4F6H A;  2ZZI A;  4AD9 A;  2BFL A;  5ACT A;  2VW8 A;  3LVZ A;  1M2X A;  2YZ3 A;  2WRS A;  4RAM A;  3R2U A;  4LE6 A;  4JO0 A;  3I11 A;  1WUO A;  5LCH A;  2YNV A;  5A5Z A;  4GYQ A;  2BTN A;  2XF4 A;  4NQ2 A;  3MD7 A;  5ACW A;  5FQC A;  2BG2 A;  3G1P A;  3PY5 A;  4FEK A;  3IE0 A;  5B1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...