4F6ZA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
232
structure length
221
Chain Sequence
b'PDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNEHPQFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 60
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6zA00
1YCFA 2R2DA 4YSKA 1QH3A 2Y87A 2E7YA 4ZO3A 4C1DA 3T3OA 3AJ3A 2FK6A 3PY5A 5HIPA 4RL0A 4D02A 3SPUA 3FAIA 3VPEA 4EYBA 2P97A 4Z7RA 1P9EA 1DD6A 2YNVB 4RL2A 4TZBA 1JT1A 5ACTA 5B15A 4Z5YA 5IQKA 2BTNA 4EXYA 2BFKA 5HIOA 5AYAA 2ZNBA 5ACWA 4UBQA 2P1EA 2GMNA 2YZ3A 4AWYB 1WUPA 1ZNBA 2A7MA 4EYLA 5AEBA 4PVTA 4C1HA 2H6AA 2WHGA 5LCAA 4Z6XA 3RPCA 4DIKA 4ZNBA 3X2YA 4AX1B 2QDTA 2Q0IA 2GKLA 2FU6A 5FQBA 4HL1A 4XWWA 2BIBA 5AHOA 2FM6A 4P62A 3H3EA 3DHCA 3ESHA 4F6HA 2DOOA 5LE1A 1DXKA 1YCHA 3ZNBA 3RKKA 2QINA 4D1UA 5AHRA 5HH6A 5ACUA 3ADRA 3IE2A 4TYFA 5FQAA 4RAMA 1A8TA 3TP9A 2YNUA 3SBLA 5B3RA 2YNWA 2NXAA 2YNTB 1A7TA 5B1UA 3PG4A 3SRXA 4EY2A 4Z5ZA 4O98A 1BMCA 3ZWFA 2ZO4A 2YNTA 4ZEJA 2BFZB 1HLKA 2XF4A 2WRSA 3PY6A 2P4ZA 4EYFA 1KO2A 4EFZA 2FU7A 4B87A 1M2XA 4RAWA 1VGNA 3DHAA 5K4MA 2VW8A 5AXOA 1X8GA 5EV8A 1E5DA 3T9MA 2GFJA 5LS3A 5LCFA 1ZKPA 3ZR9A 5EV6A 2GFKA 3FCZA 4YSBA 4J5HA 4KEQA 5EVKA 3KNRA 5EH9A 2UYXA 4GCWA 1XM8A 3P2UA 2BC2A 2OHIA 1VJNA 3X2XA 4C1CA 5EHTA 5KIKA 4RM5A 5ACQA 3A4YA 4XUKA 1XTOA 3KL7A 4UWPB 5EW0A 5ACVA 4JO0A 4UWOB 5K4NA 2WYMC 1WUOA 1QH5A 2BG6A 2HB9A 3IEMA 3I14A 2I7VA 5LLDA 4Z67A 2QJSA 2BG8A 4FEKA 2XR1A 4TZ9A 3ZQ4A 2BMIA 5FQCA 4D1TA 5K4KA 4YSLA 3IE0A 1DDKA 5K0WA 4TYTA 4UWSB 5EVBA 4KEPA 5EVDA 5LSCA 2ZZIA 2I7TA 5ACXA 5ACPA 5LCHA 2BGAA 5HIQA 5ACRA 1KO3A 5LM6A 3BK1A 3SD9A 5A0TA 4GYQA 3DHBA 4TZEA 3KNSA 3BV6A 2GCUA 4DILA 3SFPA 3IEKA 4C1FA 2AZ4A 2FU8A 3IOFA 2FU9A 4NQ5A 3AF6A 2ZWRA 3X2ZA 1SMLA 1YCGA 4AX0B 2QDSA 3IELA 3X30A 1K07A 1ZTCA 3LVZA 2AIOA 5DPXA 1WW1A 2M5DA 1WRAA 4C09A 1KR3A 4TZFA 2WYMA 2OHJA 2QEDA 2Y8AA 4ZO2A 4CHLA 4D1VA 2Y8BA 5A0VA 4NQ4A 4FR7A 5HH5A 1BC2A 4C1EA 4UAMA 2OHHA 3MD7A 3I15A 4V0HA 4HKYA 1X8HA 2YNVA 2Q9UA 5EWAA 1BVTA 4UWRB 5ACSA 3IE1A 3S0ZA 5HISA 2BG8B 3I11A 3F9OA 1VMEA 4C1GA 2M5CA 3SW3A 5AXRA 2NZFA 3VQZA 4EXSA 4AD9A 2BG7A 3L6NA 3G1PA 4HL2A 3I0VA 4NQ6A 3BC2A 4RBSA 1MQOA 1JJEA 2NZEA 1JJTA 2WYLA 3T3NA 3IOGA 4Z60A 3Q6VA 4H0DA 5KILA 2BFLA 4LE6A 4FSBA 2P18A 4XWTA 4GYUA 4U4LA 4PVOA 3BK2A 4AWZA 4WD6A 2Q0JA 1L9YA 2CBNA 4UA4A 3QH8A 2BG2A 5LMCA 3I13A 1X8IA 3R2UA 3WXCA 1Y44A 3DH8A 2FHXB 5A5ZA 4NQ2A 3JXPA 2YCBA 2BR6A 2I7XA 2FHXA 2NYPA 2Q42A 4BZ3A 4F6ZA 5HH4A 3RKJA 4BP0A 5A87A 4J5FA 3AF5A 2BFZA 4D1WA 3IDZA 2DKFA
chains in the Genus database with same CATH superfamily
1YCFA 2R2DA 4YSKA 1QH3A 2Y87A 2E7YA 4ZO3A 4C1DA 3T3OA 3AJ3A 2FK6A 3PY5A 5HIPA 4RL0A 4D02A 3SPUA 3FAIA 3VPEA 4EYBA 2P97A 4Z7RA 1P9EA 1DD6A 2YNVB 4RL2A 4TZBA 1JT1A 5ACTA 5B15A 4Z5YA 5IQKA 2BTNA 4EXYA 4AXHA 2BFKA 5HIOA 5AYAA 2ZNBA 5ACWA 4UBQA 2P1EA 2GMNA 2YZ3A 4AWYB 1WUPA 1ZNBA 2A7MA 4EYLA 5AEBA 4PVTA 4C1HA 2H6AA 2WHGA 5LCAA 4Z6XA 3RPCA 4DIKA 4ZNBA 3X2YA 4AX1B 2QDTA 2Q0IA 2GKLA 2FU6A 5FQBA 4HL1A 4XWWA 2BIBA 5AHOA 2FM6A 4P62A 3H3EA 3DHCA 3ESHA 4F6HA 2DOOA 5LE1A 1DXKA 1YCHA 3ZNBA 3RKKA 2QINA 4D1UA 5AHRA 5HH6A 5ACUA 3ADRA 3IE2A 4TYFA 5FQAA 4RAMA 1A8TA 3TP9A 2YNUA 3SBLA 5B3RA 2YNWA 2NXAA 2YNTB 1A7TA 5B1UA 3PG4A 3SRXA 4EY2A 4Z5ZA 4O98A 1BMCA 3ZWFA 2ZO4A 2YNTA 2YHEA 4ZEJA 2BFZB 1HLKA 2XF4A 2WRSA 3PY6A 2P4ZA 4EYFA 1KO2A 4EFZA 2FU7A 4B87A 1M2XA 4RAWA 1VGNA 3DHAA 5K4MA 2VW8A 5AXOA 1X8GA 5EV8A 1E5DA 3T9MA 2GFJA 5LS3A 5LCFA 1ZKPA 3ZR9A 5EV6A 2GFKA 3FCZA 4YSBA 4J5HA 4KEQA 4PDXA 5EVKA 3KNRA 5EH9A 2UYXA 4GCWA 1XM8A 3P2UA 2BC2A 2OHIA 4AV7A 1VJNA 3X2XA 4C1CA 5EHTA 5KIKA 4RM5A 5ACQA 3A4YA 4XUKA 1XTOA 3KL7A 4UWPB 5EW0A 5ACVA 4JO0A 4UWOB 5K4NA 2WYMC 1WUOA 4NURA 1QH5A 2BG6A 2HB9A 5AIJA 3IEMA 3I14A 2I7VA 5LLDA 4Z67A 2QJSA 2BG8A 4FEKA 2XR1A 4TZ9A 3ZQ4A 2BMIA 5FQCA 4D1TA 5K4KA 4YSLA 3IE0A 1DDKA 5K0WA 4TYTA 4UWSB 5EVBA 4KEPA 5EVDA 5LSCA 2ZZIA 2I7TA 5ACXA 5ACPA 5LCHA 2BGAA 5HIQA 5ACRA 1KO3A 5LM6A 3BK1A 3SD9A 5A23A 5A0TA 4GYQA 3DHBA 4TZEA 3KNSA 3BV6A 2GCUA 2CG3A 4DILA 3SFPA 3IEKA 4C1FA 2AZ4A 2FU8A 3IOFA 2FU9A 4NQ5A 3AF6A 2ZWRA 3X2ZA 1SMLA 1YCGA 4AX0B 2QDSA 3IELA 3X30A 1K07A 1ZTCA 3LVZA 2AIOA 5DPXA 1WW1A 2M5DA 1WRAA 4C09A 1KR3A 4TZFA 2WYMA 2OHJA 2QEDA 2Y8AA 5AJLA 4ZO2A 4CHLA 4D1VA 2Y8BA 5A0VA 4NQ4A 4FR7A 5HH5A 1BC2A 4C1EA 4UAMA 2OHHA 3MD7A 3I15A 4V0HA 4HKYA 1X8HA 2YNVA 2Q9UA 5EWAA 1BVTA 4UWRB 5ACSA 3IE1A 3S0ZA 5HISA 2CG2A 2BG8B 3I11A 3F9OA 1VMEA 4C1GA 2M5CA 3SW3A 5AXRA 2NZFA 3VQZA 4EXSA 4AD9A 2BG7A 3L6NA 3G1PA 4HL2A 3I0VA 4NQ6A 3BC2A 2CFUA 4RBSA 1MQOA 1JJEA 2NZEA 1JJTA 2WYLA 3T3NA 3IOGA 4Z60A 3Q6VA 4H0DA 5KILA 2BFLA 4LE6A 4FSBA 2P18A 4XWTA 4GYUA 4U4LA 4PVOA 3BK2A 4AWZA 4WD6A 2Q0JA 1L9YA 2CBNA 2CFZA 4UA4A 3QH8A 2BG2A 5LMCA 3I13A 1X8IA 3R2UA 3WXCA 1Y44A 3DH8A 2FHXB 5A5ZA 4NQ2A 3JXPA 2YCBA 2BR6A 2I7XA 2FHXA 2NYPA 2Q42A 4BZ3A 4F6ZA 5HH4A 3RKJA 4BP0A 5A87A 4J5FA 3AF5A 2BFZA 4D1WA 3IDZA 2DKFA
chains in the Genus database with same CATH topology
1YCFA 2R2DA 4YSKA 1QH3A 2Y87A 2E7YA 4ZO3A 4C1DA 3T3OA 3AJ3A 2FK6A 3PY5A 5HIPA 4RL0A 4D02A 3SPUA 3FAIA 3VPEA 4EYBA 2P97A 4Z7RA 1P9EA 1DD6A 2YNVB 4RL2A 4TZBA 1JT1A 5ACTA 5B15A 4Z5YA 5IQKA 2BTNA 4EXYA 2BFKA 5HIOA 5AYAA 2ZNBA 5ACWA 4UBQA 2P1EA 2GMNA 2YZ3A 4AWYB 1WUPA 1ZNBA 2A7MA 4EYLA 5AEBA 4PVTA 4C1HA 2H6AA 2WHGA 5LCAA 4Z6XA 3RPCA 4DIKA 4ZNBA 3X2YA 4AX1B 2QDTA 2Q0IA 2GKLA 2FU6A 5FQBA 4HL1A 4XWWA 2BIBA 5AHOA 2FM6A 4P62A 3H3EA 3DHCA 3ESHA 4F6HA 2DOOA 5LE1A 1DXKA 1YCHA 3ZNBA 3RKKA 2QINA 4D1UA 5AHRA 5HH6A 5ACUA 3ADRA 3IE2A 4TYFA 5FQAA 4RAMA 1A8TA 3TP9A 2YNUA 3SBLA 5B3RA 2YNWA 2NXAA 2YNTB 1A7TA 5B1UA 3PG4A 3SRXA 4EY2A 4Z5ZA 4O98A 1BMCA 3ZWFA 2ZO4A 2YNTA 4ZEJA 2BFZB 1HLKA 2XF4A 2WRSA 3PY6A 2P4ZA 4EYFA 1KO2A 4EFZA 2FU7A 4B87A 1M2XA 4RAWA 1VGNA 3DHAA 5K4MA 2VW8A 5AXOA 1X8GA 5EV8A 1E5DA 3T9MA 2GFJA 5LS3A 5LCFA 1ZKPA 3ZR9A 5EV6A 2GFKA 3FCZA 4YSBA 4J5HA 4KEQA 5EVKA 3KNRA 5EH9A 2UYXA 4GCWA 1XM8A 3P2UA 2BC2A 2OHIA 1VJNA 3X2XA 4C1CA 5EHTA 5KIKA 4RM5A 5ACQA 3A4YA 4XUKA 1XTOA 3KL7A 4UWPB 5EW0A 5ACVA 4JO0A 4UWOB 5K4NA 2WYMC 1WUOA 1QH5A 2BG6A 2HB9A 3IEMA 3I14A 2I7VA 5LLDA 4Z67A 2QJSA 2BG8A 4FEKA 2XR1A 4TZ9A 3ZQ4A 2BMIA 5FQCA 4D1TA 5K4KA 4YSLA 3IE0A 1DDKA 5K0WA 4TYTA 4UWSB 5EVBA 4KEPA 5EVDA 5LSCA 2ZZIA 2I7TA 5ACXA 5ACPA 5LCHA 2BGAA 5HIQA 5ACRA 1KO3A 5LM6A 3BK1A 3SD9A 5A0TA 4GYQA 3DHBA 4TZEA 3KNSA 3BV6A 2GCUA 4DILA 3SFPA 3IEKA 4C1FA 2AZ4A 2FU8A 3IOFA 2FU9A 4NQ5A 3AF6A 2ZWRA 3X2ZA 1SMLA 1YCGA 4AX0B 2QDSA 3IELA 3X30A 1K07A 1ZTCA 3LVZA 2AIOA 5DPXA 1WW1A 2M5DA 1WRAA 4C09A 1KR3A 4TZFA 2WYMA 2OHJA 2QEDA 2Y8AA 4ZO2A 4CHLA 4D1VA 2Y8BA 5A0VA 4NQ4A 4FR7A 5HH5A 1BC2A 4C1EA 4UAMA 2OHHA 3MD7A 3I15A 4V0HA 4HKYA 1X8HA 2YNVA 2Q9UA 5EWAA 1BVTA 4UWRB 5ACSA 3IE1A 3S0ZA 5HISA 2BG8B 3I11A 3F9OA 1VMEA 4C1GA 2M5CA 3SW3A 5AXRA 2NZFA 3VQZA 4EXSA 4AD9A 2BG7A 3L6NA 3G1PA 4HL2A 3I0VA 4NQ6A 3BC2A 4RBSA 1MQOA 1JJEA 2NZEA 1JJTA 2WYLA 3T3NA 3IOGA 4Z60A 3Q6VA 4H0DA 5KILA 2BFLA 4LE6A 4FSBA 2P18A 4XWTA 4GYUA 4U4LA 4PVOA 3BK2A 4AWZA 4WD6A 2Q0JA 1L9YA 2CBNA 4UA4A 3QH8A 2BG2A 5LMCA 3I13A 1X8IA 3R2UA 3WXCA 1Y44A 3DH8A 2FHXB 5A5ZA 4NQ2A 3JXPA 2YCBA 2BR6A 2I7XA 2FHXA 2NYPA 2Q42A 4BZ3A 4F6ZA 5HH4A 3RKJA 4BP0A 5A87A 4J5FA 3AF5A 2BFZA 4D1WA 3IDZA 2DKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCF A;  2R2D A;  4YSK A;  1QH3 A;  2Y87 A;  2E7Y A;  4ZO3 A;  4C1D A;  3T3O A;  3AJ3 A;  2FK6 A;  3PY5 A;  5HIP A;  4RL0 A;  4D02 A;  3SPU A;  3FAI A;  3VPE A;  4EYB A;  2P97 A;  4Z7R A;  1P9E A;  1DD6 A;  2YNV B;  4RL2 A;  4TZB A;  1JT1 A;  5ACT A;  5B15 A;  4Z5Y A;  5IQK A;  2BTN A;  4EXY A;  2BFK A;  5HIO A;  5AYA A;  2ZNB A;  5ACW A;  4UBQ A;  2P1E A;  2GMN A;  2YZ3 A;  4AWY B;  1WUP A;  1ZNB A;  2A7M A;  4EYL A;  5AEB A;  4PVT A;  4C1H A;  2H6A A;  2WHG A;  5LCA A;  4Z6X A;  3RPC A;  4DIK A;  4ZNB A;  3X2Y A;  4AX1 B;  2QDT A;  2Q0I A;  2GKL A;  2FU6 A;  5FQB A;  4HL1 A;  4XWW A;  2BIB A;  5AHO A;  2FM6 A;  4P62 A;  3H3E A;  3DHC A;  3ESH A;  4F6H A;  2DOO A;  5LE1 A;  1DXK A;  1YCH A;  3ZNB A;  3RKK A;  2QIN A;  4D1U A;  5AHR A;  5HH6 A;  5ACU A;  3ADR A;  3IE2 A;  4TYF A;  5FQA A;  4RAM A;  1A8T A;  3TP9 A;  2YNU A;  3SBL A;  5B3R A;  2YNW A;  2NXA A;  2YNT B;  1A7T A;  5B1U A;  3PG4 A;  3SRX A;  4EY2 A;  4Z5Z A;  4O98 A;  1BMC A;  3ZWF A;  2ZO4 A;  2YNT A;  4ZEJ A;  2BFZ B;  1HLK A;  2XF4 A;  2WRS A;  3PY6 A;  2P4Z A;  4EYF A;  1KO2 A;  4EFZ A;  2FU7 A;  4B87 A;  1M2X A;  4RAW A;  1VGN A;  3DHA A;  5K4M A;  2VW8 A;  5AXO A;  1X8G A;  5EV8 A;  1E5D A;  3T9M A;  2GFJ A;  5LS3 A;  5LCF A;  1ZKP A;  3ZR9 A;  5EV6 A;  2GFK A;  3FCZ A;  4YSB A;  4J5H A;  4KEQ A;  5EVK A;  3KNR A;  5EH9 A;  2UYX A;  4GCW A;  1XM8 A;  3P2U A;  2BC2 A;  2OHI A;  1VJN A;  3X2X A;  4C1C A;  5EHT A;  5KIK A;  4RM5 A;  5ACQ A;  3A4Y A;  4XUK A;  1XTO A;  3KL7 A;  4UWP B;  5EW0 A;  5ACV A;  4JO0 A;  4UWO B;  5K4N A;  2WYM C;  1WUO A;  1QH5 A;  2BG6 A;  2HB9 A;  3IEM A;  3I14 A;  2I7V A;  5LLD A;  4Z67 A;  2QJS A;  2BG8 A;  4FEK A;  2XR1 A;  4TZ9 A;  3ZQ4 A;  2BMI A;  5FQC A;  4D1T A;  5K4K A;  4YSL A;  3IE0 A;  1DDK A;  5K0W A;  4TYT A;  4UWS B;  5EVB A;  4KEP A;  5EVD A;  5LSC A;  2ZZI A;  2I7T A;  5ACX A;  5ACP A;  5LCH A;  2BGA A;  5HIQ A;  5ACR A;  1KO3 A;  5LM6 A;  3BK1 A;  3SD9 A;  5A0T A;  4GYQ A;  3DHB A;  4TZE A;  3KNS A;  3BV6 A;  2GCU A;  4DIL A;  3SFP A;  3IEK A;  4C1F A;  2AZ4 A;  2FU8 A;  3IOF A;  2FU9 A;  4NQ5 A;  3AF6 A;  2ZWR A;  3X2Z A;  1SML A;  1YCG A;  4AX0 B;  2QDS A;  3IEL A;  3X30 A;  1K07 A;  1ZTC A;  3LVZ A;  2AIO A;  5DPX A;  1WW1 A;  2M5D A;  1WRA A;  4C09 A;  1KR3 A;  4TZF A;  2WYM A;  2OHJ A;  2QED A;  2Y8A A;  4ZO2 A;  4CHL A;  4D1V A;  2Y8B A;  5A0V A;  4NQ4 A;  4FR7 A;  5HH5 A;  1BC2 A;  4C1E A;  4UAM A;  2OHH A;  3MD7 A;  3I15 A;  4V0H A;  4HKY A;  1X8H A;  2YNV A;  2Q9U A;  5EWA A;  1BVT A;  4UWR B;  5ACS A;  3IE1 A;  3S0Z A;  5HIS A;  2BG8 B;  3I11 A;  3F9O A;  1VME A;  4C1G A;  2M5C A;  3SW3 A;  5AXR A;  2NZF A;  3VQZ A;  4EXS A;  4AD9 A;  2BG7 A;  3L6N A;  3G1P A;  4HL2 A;  3I0V A;  4NQ6 A;  3BC2 A;  4RBS A;  1MQO A;  1JJE A;  2NZE A;  1JJT A;  2WYL A;  3T3N A;  3IOG A;  4Z60 A;  3Q6V A;  4H0D A;  5KIL A;  2BFL A;  4LE6 A;  4FSB A;  2P18 A;  4XWT A;  4GYU A;  4U4L A;  4PVO A;  3BK2 A;  4AWZ A;  4WD6 A;  2Q0J A;  1L9Y A;  2CBN A;  4UA4 A;  3QH8 A;  2BG2 A;  5LMC A;  3I13 A;  1X8I A;  3R2U A;  3WXC A;  1Y44 A;  3DH8 A;  2FHX B;  5A5Z A;  4NQ2 A;  3JXP A;  2YCB A;  2BR6 A;  2I7X A;  2FHX A;  2NYP A;  2Q42 A;  4BZ3 A;  4F6Z A;  5HH4 A;  3RKJ A;  4BP0 A;  5A87 A;  4J5F A;  3AF5 A;  2BFZ A;  4D1W A;  3IDZ A;  2DKF A; 
#chains in the Genus database with same CATH topology
 1YCF A;  2R2D A;  4YSK A;  1QH3 A;  2Y87 A;  2E7Y A;  4ZO3 A;  4C1D A;  3T3O A;  3AJ3 A;  2FK6 A;  3PY5 A;  5HIP A;  4RL0 A;  4D02 A;  3SPU A;  3FAI A;  3VPE A;  4EYB A;  2P97 A;  4Z7R A;  1P9E A;  1DD6 A;  2YNV B;  4RL2 A;  4TZB A;  1JT1 A;  5ACT A;  5B15 A;  4Z5Y A;  5IQK A;  2BTN A;  4EXY A;  4AXH A;  2BFK A;  5HIO A;  5AYA A;  2ZNB A;  5ACW A;  4UBQ A;  2P1E A;  2GMN A;  2YZ3 A;  4AWY B;  1WUP A;  1ZNB A;  2A7M A;  4EYL A;  5AEB A;  4PVT A;  4C1H A;  2H6A A;  2WHG A;  5LCA A;  4Z6X A;  3RPC A;  4DIK A;  4ZNB A;  3X2Y A;  4AX1 B;  2QDT A;  2Q0I A;  2GKL A;  2FU6 A;  5FQB A;  4HL1 A;  4XWW A;  2BIB A;  5AHO A;  2FM6 A;  4P62 A;  3H3E A;  3DHC A;  3ESH A;  4F6H A;  2DOO A;  5LE1 A;  1DXK A;  1YCH A;  3ZNB A;  3RKK A;  2QIN A;  4D1U A;  5AHR A;  5HH6 A;  5ACU A;  3ADR A;  3IE2 A;  4TYF A;  5FQA A;  4RAM A;  1A8T A;  3TP9 A;  2YNU A;  3SBL A;  5B3R A;  2YNW A;  2NXA A;  2YNT B;  1A7T A;  5B1U A;  3PG4 A;  3SRX A;  4EY2 A;  4Z5Z A;  4O98 A;  1BMC A;  3ZWF A;  2ZO4 A;  2YNT A;  2YHE A;  4ZEJ A;  2BFZ B;  1HLK A;  2XF4 A;  2WRS A;  3PY6 A;  2P4Z A;  4EYF A;  1KO2 A;  4EFZ A;  2FU7 A;  4B87 A;  1M2X A;  4RAW A;  1VGN A;  3DHA A;  5K4M A;  2VW8 A;  5AXO A;  1X8G A;  5EV8 A;  1E5D A;  3T9M A;  2GFJ A;  5LS3 A;  5LCF A;  1ZKP A;  3ZR9 A;  5EV6 A;  2GFK A;  3FCZ A;  4YSB A;  4J5H A;  4KEQ A;  4PDX A;  5EVK A;  3KNR A;  5EH9 A;  2UYX A;  4GCW A;  1XM8 A;  3P2U A;  2BC2 A;  2OHI A;  4AV7 A;  1VJN A;  3X2X A;  4C1C A;  5EHT A;  5KIK A;  4RM5 A;  5ACQ A;  3A4Y A;  4XUK A;  1XTO A;  3KL7 A;  4UWP B;  5EW0 A;  5ACV A;  4JO0 A;  4UWO B;  5K4N A;  2WYM C;  1WUO A;  4NUR A;  1QH5 A;  2BG6 A;  2HB9 A;  5AIJ A;  3IEM A;  3I14 A;  2I7V A;  5LLD A;  4Z67 A;  2QJS A;  2BG8 A;  4FEK A;  2XR1 A;  4TZ9 A;  3ZQ4 A;  2BMI A;  5FQC A;  4D1T A;  5K4K A;  4YSL A;  3IE0 A;  1DDK A;  5K0W A;  4TYT A;  4UWS B;  5EVB A;  4KEP A;  5EVD A;  5LSC A;  2ZZI A;  2I7T A;  5ACX A;  5ACP A;  5LCH A;  2BGA A;  5HIQ A;  5ACR A;  1KO3 A;  5LM6 A;  3BK1 A;  3SD9 A;  5A23 A;  5A0T A;  4GYQ A;  3DHB A;  4TZE A;  3KNS A;  3BV6 A;  2GCU A;  2CG3 A;  4DIL A;  3SFP A;  3IEK A;  4C1F A;  2AZ4 A;  2FU8 A;  3IOF A;  2FU9 A;  4NQ5 A;  3AF6 A;  2ZWR A;  3X2Z A;  1SML A;  1YCG A;  4AX0 B;  2QDS A;  3IEL A;  3X30 A;  1K07 A;  1ZTC A;  3LVZ A;  2AIO A;  5DPX A;  1WW1 A;  2M5D A;  1WRA A;  4C09 A;  1KR3 A;  4TZF A;  2WYM A;  2OHJ A;  2QED A;  2Y8A A;  5AJL A;  4ZO2 A;  4CHL A;  4D1V A;  2Y8B A;  5A0V A;  4NQ4 A;  4FR7 A;  5HH5 A;  1BC2 A;  4C1E A;  4UAM A;  2OHH A;  3MD7 A;  3I15 A;  4V0H A;  4HKY A;  1X8H A;  2YNV A;  2Q9U A;  5EWA A;  1BVT A;  4UWR B;  5ACS A;  3IE1 A;  3S0Z A;  5HIS A;  2CG2 A;  2BG8 B;  3I11 A;  3F9O A;  1VME A;  4C1G A;  2M5C A;  3SW3 A;  5AXR A;  2NZF A;  3VQZ A;  4EXS A;  4AD9 A;  2BG7 A;  3L6N A;  3G1P A;  4HL2 A;  3I0V A;  4NQ6 A;  3BC2 A;  2CFU A;  4RBS A;  1MQO A;  1JJE A;  2NZE A;  1JJT A;  2WYL A;  3T3N A;  3IOG A;  4Z60 A;  3Q6V A;  4H0D A;  5KIL A;  2BFL A;  4LE6 A;  4FSB A;  2P18 A;  4XWT A;  4GYU A;  4U4L A;  4PVO A;  3BK2 A;  4AWZ A;  4WD6 A;  2Q0J A;  1L9Y A;  2CBN A;  2CFZ A;  4UA4 A;  3QH8 A;  2BG2 A;  5LMC A;  3I13 A;  1X8I A;  3R2U A;  3WXC A;  1Y44 A;  3DH8 A;  2FHX B;  5A5Z A;  4NQ2 A;  3JXP A;  2YCB A;  2BR6 A;  2I7X A;  2FHX A;  2NYP A;  2Q42 A;  4BZ3 A;  4F6Z A;  5HH4 A;  3RKJ A;  4BP0 A;  5A87 A;  4J5F A;  3AF5 A;  2BFZ A;  4D1W A;  3IDZ A;  2DKF A; 
#chains in the Genus database with same CATH homology
 1YCF A;  2R2D A;  4YSK A;  1QH3 A;  2Y87 A;  2E7Y A;  4ZO3 A;  4C1D A;  3T3O A;  3AJ3 A;  2FK6 A;  3PY5 A;  5HIP A;  4RL0 A;  4D02 A;  3SPU A;  3FAI A;  3VPE A;  4EYB A;  2P97 A;  4Z7R A;  1P9E A;  1DD6 A;  2YNV B;  4RL2 A;  4TZB A;  1JT1 A;  5ACT A;  5B15 A;  4Z5Y A;  5IQK A;  2BTN A;  4EXY A;  2BFK A;  5HIO A;  5AYA A;  2ZNB A;  5ACW A;  4UBQ A;  2P1E A;  2GMN A;  2YZ3 A;  4AWY B;  1WUP A;  1ZNB A;  2A7M A;  4EYL A;  5AEB A;  4PVT A;  4C1H A;  2H6A A;  2WHG A;  5LCA A;  4Z6X A;  3RPC A;  4DIK A;  4ZNB A;  3X2Y A;  4AX1 B;  2QDT A;  2Q0I A;  2GKL A;  2FU6 A;  5FQB A;  4HL1 A;  4XWW A;  2BIB A;  5AHO A;  2FM6 A;  4P62 A;  3H3E A;  3DHC A;  3ESH A;  4F6H A;  2DOO A;  5LE1 A;  1DXK A;  1YCH A;  3ZNB A;  3RKK A;  2QIN A;  4D1U A;  5AHR A;  5HH6 A;  5ACU A;  3ADR A;  3IE2 A;  4TYF A;  5FQA A;  4RAM A;  1A8T A;  3TP9 A;  2YNU A;  3SBL A;  5B3R A;  2YNW A;  2NXA A;  2YNT B;  1A7T A;  5B1U A;  3PG4 A;  3SRX A;  4EY2 A;  4Z5Z A;  4O98 A;  1BMC A;  3ZWF A;  2ZO4 A;  2YNT A;  4ZEJ A;  2BFZ B;  1HLK A;  2XF4 A;  2WRS A;  3PY6 A;  2P4Z A;  4EYF A;  1KO2 A;  4EFZ A;  2FU7 A;  4B87 A;  1M2X A;  4RAW A;  1VGN A;  3DHA A;  5K4M A;  2VW8 A;  5AXO A;  1X8G A;  5EV8 A;  1E5D A;  3T9M A;  2GFJ A;  5LS3 A;  5LCF A;  1ZKP A;  3ZR9 A;  5EV6 A;  2GFK A;  3FCZ A;  4YSB A;  4J5H A;  4KEQ A;  5EVK A;  3KNR A;  5EH9 A;  2UYX A;  4GCW A;  1XM8 A;  3P2U A;  2BC2 A;  2OHI A;  1VJN A;  3X2X A;  4C1C A;  5EHT A;  5KIK A;  4RM5 A;  5ACQ A;  3A4Y A;  4XUK A;  1XTO A;  3KL7 A;  4UWP B;  5EW0 A;  5ACV A;  4JO0 A;  4UWO B;  5K4N A;  2WYM C;  1WUO A;  1QH5 A;  2BG6 A;  2HB9 A;  3IEM A;  3I14 A;  2I7V A;  5LLD A;  4Z67 A;  2QJS A;  2BG8 A;  4FEK A;  2XR1 A;  4TZ9 A;  3ZQ4 A;  2BMI A;  5FQC A;  4D1T A;  5K4K A;  4YSL A;  3IE0 A;  1DDK A;  5K0W A;  4TYT A;  4UWS B;  5EVB A;  4KEP A;  5EVD A;  5LSC A;  2ZZI A;  2I7T A;  5ACX A;  5ACP A;  5LCH A;  2BGA A;  5HIQ A;  5ACR A;  1KO3 A;  5LM6 A;  3BK1 A;  3SD9 A;  5A0T A;  4GYQ A;  3DHB A;  4TZE A;  3KNS A;  3BV6 A;  2GCU A;  4DIL A;  3SFP A;  3IEK A;  4C1F A;  2AZ4 A;  2FU8 A;  3IOF A;  2FU9 A;  4NQ5 A;  3AF6 A;  2ZWR A;  3X2Z A;  1SML A;  1YCG A;  4AX0 B;  2QDS A;  3IEL A;  3X30 A;  1K07 A;  1ZTC A;  3LVZ A;  2AIO A;  5DPX A;  1WW1 A;  2M5D A;  1WRA A;  4C09 A;  1KR3 A;  4TZF A;  2WYM A;  2OHJ A;  2QED A;  2Y8A A;  4ZO2 A;  4CHL A;  4D1V A;  2Y8B A;  5A0V A;  4NQ4 A;  4FR7 A;  5HH5 A;  1BC2 A;  4C1E A;  4UAM A;  2OHH A;  3MD7 A;  3I15 A;  4V0H A;  4HKY A;  1X8H A;  2YNV A;  2Q9U A;  5EWA A;  1BVT A;  4UWR B;  5ACS A;  3IE1 A;  3S0Z A;  5HIS A;  2BG8 B;  3I11 A;  3F9O A;  1VME A;  4C1G A;  2M5C A;  3SW3 A;  5AXR A;  2NZF A;  3VQZ A;  4EXS A;  4AD9 A;  2BG7 A;  3L6N A;  3G1P A;  4HL2 A;  3I0V A;  4NQ6 A;  3BC2 A;  4RBS A;  1MQO A;  1JJE A;  2NZE A;  1JJT A;  2WYL A;  3T3N A;  3IOG A;  4Z60 A;  3Q6V A;  4H0D A;  5KIL A;  2BFL A;  4LE6 A;  4FSB A;  2P18 A;  4XWT A;  4GYU A;  4U4L A;  4PVO A;  3BK2 A;  4AWZ A;  4WD6 A;  2Q0J A;  1L9Y A;  2CBN A;  4UA4 A;  3QH8 A;  2BG2 A;  5LMC A;  3I13 A;  1X8I A;  3R2U A;  3WXC A;  1Y44 A;  3DH8 A;  2FHX B;  5A5Z A;  4NQ2 A;  3JXP A;  2YCB A;  2BR6 A;  2I7X A;  2FHX A;  2NYP A;  2Q42 A;  4BZ3 A;  4F6Z A;  5HH4 A;  3RKJ A;  4BP0 A;  5A87 A;  4J5F A;  3AF5 A;  2BFZ A;  4D1W A;  3IDZ A;  2DKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...