4Z60A

The 2.5-angstrom of crystal structure of zn(2+)-bound pqqb from pseudomonas putida
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z60A00
2GFKA 4YSBA 3SRXA 4O98A 2I7XA 3ADRA 5AEBA 5LCAA 2P97A 1K07A 1YCHA 3IOGA 2BFLA 3I13A 2QEDA 2Y87A 5KILA 5LS3A 1X8GA 2FM6A 2FHXA 3PG4A 4BP0A 4GYUA 3DHAA 4PVOA 2YZ3A 5ACSA 4D1TA 4TZ9A 3IELA 2ZZIA 2FU6A 5KIKA 3QH8A 4EFZA 2OHIA 3RKKA 2P1EA 4ZNBA 4Z6XA 1KO2A 1QH3A 5EW0A 4RBSA 5K0WA 1VJNA 2Y8AA 3VQZA 2GCUA 4NQ5A 1ZKPA 4PVTA 1XTOA 1YCGA 5ACPA 4EYFA 1WUPA 3P2UA 1BMCA 1DXKA 5A0TA 2WRSA 4EY2A 4YSLA 4XUKA 2OHHA 2QINA 3RPCA 5DPXA 1VMEA 2ZNBA 2VW8A 3BK2A 2BG8A 5FQBA 2R2DA 1QH5A 2WYLA 5K4MA 1P9EA 4TYFA 3T3OA 5HH5A 4GYQA 3X30A 2YNTA 5B15A 2BC2A 4B87A 4P62A 2H6AA 2DOOA 3T3NA 4Z60A 3AF6A 5FQCA 4EYLA 4XWWA 4C09A 3BV6A 4UWSB 2I7TA 2A7MA 3IE2A 4NQ4A 2Q0IA 4Z5ZA 3BC2A 2AIOA 1ZNBA 5LCHA 4AWYB 4KEPA 4HL2A 3A4YA 4RM5A 2GKLA 4ZEJA 1X8HA 2BR6A 4AX0B 3KNSA 4FSBA 3I11A 1VGNA 3X2ZA 5EWAA 2M5CA 4Z67A 3SW3A 2FHXB 5AHRA 3IEMA 3X2YA 3KNRA 5EV6A 4DILA 2BG2A 2NZEA 4CHLA 4EYBA 2Q42A 5EV8A 4RAWA 4EXSA 3ESHA 2DKFA 3FCZA 4C1HA 3S0ZA 1A8TA 1Y44A 4GCWA 3H3EA 5LE1A 4J5FA 2QDSA 4KEQA 4YSKA 1WUOA 5EVKA 5ACUA 2Y8BA 3IE1A 1YCFA 3X2XA 3L6NA 4U4LA 3TP9A 3WXCA 2BFZA 2M5DA 5LCFA 5A87A 2XR1A 2Q9UA 3ZR9A 4TYTA 4HKYA 4D1VA 5HIOA 1WRAA 5AHOA 5HISA 5IQKA 2BG8B 5ACVA 5FQAA 1KO3A 1DDKA 2BIBA 5LMCA 4UAMA 5HH6A 2WYMC 2ZWRA 4C1CA 4WD6A 1KR3A 1BC2A 5A5ZA 4C1GA 5EVDA 2YNTB 4ZO3A 4C1EA 5AXOA 3IDZA 3ZQ4A 2BG6A 2P4ZA 5ACQA 3SBLA 2BTNA 3SPUA 5ACTA 3IEKA 4Z7RA 3KL7A 1E5DA 2Q0JA 5HH4A 3DHBA 1MQOA 5EHTA 1HLKA 5LM6A 3Q6VA 4EXYA 4FR7A 4TZBA 2YNVB 2OHJA 2FU9A 2CBNA 4JO0A 4DIKA 1L9YA 2P18A 4FEKA 2WYMA 2QJSA 4UWPB 1DD6A 4RAMA 4UWOB 1M2XA 4C1DA 3ZWFA 2HB9A 4HL1A 2I7VA 1BVTA 3I14A 3SFPA 3AJ3A 3MD7A 3PY6A 3F9OA 4UWRB 3I0VA 3IE0A 3SD9A 4UA4A 3RKJA 2YCBA 4NQ6A 1JT1A 2NYPA 2AZ4A 4TZFA 4V0HA 5ACRA 5HIPA 2ZO4A 2WHGA 2YNUA 2BFZB 1WW1A 4RL0A 3T9MA 2NXAA 4NQ2A 4AWZA 5EVBA 3I15A 2XF4A 3ZNBA 2FU8A 2GFJA 5HIQA 3PY5A 3G1PA 2YNWA 1X8IA 2BMIA 3AF5A 5A0VA 1SMLA 3BK1A 4BZ3A 1JJEA 5AXRA 5AYAA 3IOFA 4D1UA 3DHCA 4AX1B 2BGAA 3R2UA 4RL2A 2BG7A 5ACWA 5B1UA 5K4NA 4LE6A 1ZTCA 5LSCA 2BFKA 4ZO2A 4F6HA 4XWTA 2FU7A 5LLDA 1XM8A 2QDTA 4UBQA 5ACXA 2FK6A 4H0DA 5B3RA 5K4KA 4D02A 4Z5YA 4C1FA 4D1WA 4AD9A 5EH9A 2UYXA 2GMNA 2NZFA 3VPEA 3DH8A 3JXPA 4F6ZA 4J5HA 1JJTA 2E7YA 3FAIA 3LVZA 2YNVA 1A7TA 4TZEA
chains in the Genus database with same CATH superfamily
2GFKA 4YSBA 3SRXA 4O98A 2I7XA 3ADRA 5AEBA 5LCAA 2P97A 1K07A 1YCHA 3IOGA 2BFLA 3I13A 2QEDA 2Y87A 5KILA 5LS3A 1X8GA 2FM6A 2FHXA 3PG4A 4BP0A 4GYUA 3DHAA 4PVOA 2YZ3A 2CG3A 5ACSA 4D1TA 4TZ9A 3IELA 2ZZIA 2FU6A 5KIKA 3QH8A 4EFZA 2OHIA 3RKKA 2P1EA 4ZNBA 4Z6XA 1KO2A 1QH3A 5EW0A 4RBSA 5K0WA 1VJNA 2Y8AA 3VQZA 2GCUA 4NQ5A 1ZKPA 4PVTA 1XTOA 1YCGA 5ACPA 4EYFA 4AV7A 1WUPA 3P2UA 1BMCA 1DXKA 5A0TA 2WRSA 4EY2A 4YSLA 4XUKA 2OHHA 2QINA 3RPCA 5DPXA 1VMEA 2ZNBA 2VW8A 3BK2A 2BG8A 5FQBA 2R2DA 1QH5A 2WYLA 5K4MA 1P9EA 4TYFA 3T3OA 5HH5A 4GYQA 3X30A 2YNTA 5B15A 2BC2A 4B87A 4P62A 2H6AA 2DOOA 3T3NA 4Z60A 3AF6A 5FQCA 4EYLA 4XWWA 4C09A 3BV6A 4UWSB 2I7TA 2A7MA 3IE2A 4NQ4A 2Q0IA 4Z5ZA 3BC2A 2AIOA 1ZNBA 5LCHA 4AWYB 4KEPA 4HL2A 3A4YA 4RM5A 2GKLA 4ZEJA 4NURA 1X8HA 2BR6A 4AX0B 3KNSA 4FSBA 3I11A 1VGNA 3X2ZA 5EWAA 2M5CA 4Z67A 3SW3A 2FHXB 5AHRA 3IEMA 3X2YA 3KNRA 5EV6A 4DILA 2BG2A 2NZEA 4CHLA 4EYBA 2Q42A 5EV8A 4RAWA 4EXSA 3ESHA 2DKFA 3FCZA 4PDXA 4C1HA 3S0ZA 1A8TA 5AIJA 1Y44A 4GCWA 3H3EA 5LE1A 4J5FA 2QDSA 4KEQA 4YSKA 1WUOA 5EVKA 5ACUA 2Y8BA 3IE1A 1YCFA 3X2XA 3L6NA 4U4LA 3TP9A 3WXCA 2BFZA 2M5DA 5LCFA 5A87A 2XR1A 2Q9UA 3ZR9A 4TYTA 4HKYA 4D1VA 5HIOA 1WRAA 5AHOA 5HISA 5IQKA 2BG8B 5ACVA 5FQAA 1KO3A 1DDKA 2BIBA 2CG2A 5LMCA 4UAMA 5HH6A 2WYMC 2ZWRA 4C1CA 4WD6A 1KR3A 1BC2A 5A5ZA 4C1GA 2YHEA 5EVDA 2YNTB 4ZO3A 4C1EA 5AXOA 3IDZA 3ZQ4A 2BG6A 2P4ZA 5ACQA 3SBLA 2BTNA 3SPUA 5ACTA 3IEKA 4Z7RA 3KL7A 1E5DA 2Q0JA 5HH4A 3DHBA 1MQOA 5EHTA 1HLKA 5LM6A 3Q6VA 4EXYA 4FR7A 4TZBA 2YNVB 2OHJA 2FU9A 2CBNA 4JO0A 2CFUA 4DIKA 1L9YA 2P18A 4FEKA 2WYMA 2QJSA 4UWPB 1DD6A 4RAMA 4UWOB 1M2XA 4C1DA 3ZWFA 2HB9A 4HL1A 2I7VA 1BVTA 3I14A 3SFPA 4AXHA 3AJ3A 3MD7A 3PY6A 3F9OA 4UWRB 3I0VA 3IE0A 3SD9A 4UA4A 3RKJA 2YCBA 4NQ6A 5A23A 1JT1A 2NYPA 2AZ4A 4TZFA 4V0HA 5ACRA 5HIPA 2ZO4A 2WHGA 2YNUA 2BFZB 1WW1A 4RL0A 2CFZA 3T9MA 2NXAA 4NQ2A 4AWZA 5EVBA 3I15A 2XF4A 3ZNBA 2FU8A 2GFJA 5HIQA 3PY5A 3G1PA 2YNWA 1X8IA 2BMIA 3AF5A 5A0VA 1SMLA 3BK1A 4BZ3A 1JJEA 5AXRA 5AYAA 3IOFA 4D1UA 3DHCA 4AX1B 2BGAA 3R2UA 4RL2A 2BG7A 5ACWA 5B1UA 5K4NA 4LE6A 1ZTCA 5LSCA 2BFKA 4ZO2A 4F6HA 4XWTA 2FU7A 5LLDA 1XM8A 2QDTA 4UBQA 5ACXA 2FK6A 4H0DA 5B3RA 5K4KA 4D02A 4Z5YA 4C1FA 4D1WA 4AD9A 5EH9A 2UYXA 2GMNA 2NZFA 3VPEA 3DH8A 5AJLA 3JXPA 4F6ZA 4J5HA 1JJTA 2E7YA 3FAIA 3LVZA 2YNVA 1A7TA 4TZEA
chains in the Genus database with same CATH topology
2GFKA 4YSBA 3SRXA 4O98A 2I7XA 3ADRA 5AEBA 5LCAA 2P97A 1K07A 1YCHA 3IOGA 2BFLA 3I13A 2QEDA 2Y87A 5KILA 5LS3A 1X8GA 2FM6A 2FHXA 3PG4A 4BP0A 4GYUA 3DHAA 4PVOA 2YZ3A 5ACSA 4D1TA 4TZ9A 3IELA 2ZZIA 2FU6A 5KIKA 3QH8A 4EFZA 2OHIA 3RKKA 2P1EA 4ZNBA 4Z6XA 1KO2A 1QH3A 5EW0A 4RBSA 5K0WA 1VJNA 2Y8AA 3VQZA 2GCUA 4NQ5A 1ZKPA 4PVTA 1XTOA 1YCGA 5ACPA 4EYFA 1WUPA 3P2UA 1BMCA 1DXKA 5A0TA 2WRSA 4EY2A 4YSLA 4XUKA 2OHHA 2QINA 3RPCA 5DPXA 1VMEA 2ZNBA 2VW8A 3BK2A 2BG8A 5FQBA 2R2DA 1QH5A 2WYLA 5K4MA 1P9EA 4TYFA 3T3OA 5HH5A 4GYQA 3X30A 2YNTA 5B15A 2BC2A 4B87A 4P62A 2H6AA 2DOOA 3T3NA 4Z60A 3AF6A 5FQCA 4EYLA 4XWWA 4C09A 3BV6A 4UWSB 2I7TA 2A7MA 3IE2A 4NQ4A 2Q0IA 4Z5ZA 3BC2A 2AIOA 1ZNBA 5LCHA 4AWYB 4KEPA 4HL2A 3A4YA 4RM5A 2GKLA 4ZEJA 1X8HA 2BR6A 4AX0B 3KNSA 4FSBA 3I11A 1VGNA 3X2ZA 5EWAA 2M5CA 4Z67A 3SW3A 2FHXB 5AHRA 3IEMA 3X2YA 3KNRA 5EV6A 4DILA 2BG2A 2NZEA 4CHLA 4EYBA 2Q42A 5EV8A 4RAWA 4EXSA 3ESHA 2DKFA 3FCZA 4C1HA 3S0ZA 1A8TA 1Y44A 4GCWA 3H3EA 5LE1A 4J5FA 2QDSA 4KEQA 4YSKA 1WUOA 5EVKA 5ACUA 2Y8BA 3IE1A 1YCFA 3X2XA 3L6NA 4U4LA 3TP9A 3WXCA 2BFZA 2M5DA 5LCFA 5A87A 2XR1A 2Q9UA 3ZR9A 4TYTA 4HKYA 4D1VA 5HIOA 1WRAA 5AHOA 5HISA 5IQKA 2BG8B 5ACVA 5FQAA 1KO3A 1DDKA 2BIBA 5LMCA 4UAMA 5HH6A 2WYMC 2ZWRA 4C1CA 4WD6A 1KR3A 1BC2A 5A5ZA 4C1GA 5EVDA 2YNTB 4ZO3A 4C1EA 5AXOA 3IDZA 3ZQ4A 2BG6A 2P4ZA 5ACQA 3SBLA 2BTNA 3SPUA 5ACTA 3IEKA 4Z7RA 3KL7A 1E5DA 2Q0JA 5HH4A 3DHBA 1MQOA 5EHTA 1HLKA 5LM6A 3Q6VA 4EXYA 4FR7A 4TZBA 2YNVB 2OHJA 2FU9A 2CBNA 4JO0A 4DIKA 1L9YA 2P18A 4FEKA 2WYMA 2QJSA 4UWPB 1DD6A 4RAMA 4UWOB 1M2XA 4C1DA 3ZWFA 2HB9A 4HL1A 2I7VA 1BVTA 3I14A 3SFPA 3AJ3A 3MD7A 3PY6A 3F9OA 4UWRB 3I0VA 3IE0A 3SD9A 4UA4A 3RKJA 2YCBA 4NQ6A 1JT1A 2NYPA 2AZ4A 4TZFA 4V0HA 5ACRA 5HIPA 2ZO4A 2WHGA 2YNUA 2BFZB 1WW1A 4RL0A 3T9MA 2NXAA 4NQ2A 4AWZA 5EVBA 3I15A 2XF4A 3ZNBA 2FU8A 2GFJA 5HIQA 3PY5A 3G1PA 2YNWA 1X8IA 2BMIA 3AF5A 5A0VA 1SMLA 3BK1A 4BZ3A 1JJEA 5AXRA 5AYAA 3IOFA 4D1UA 3DHCA 4AX1B 2BGAA 3R2UA 4RL2A 2BG7A 5ACWA 5B1UA 5K4NA 4LE6A 1ZTCA 5LSCA 2BFKA 4ZO2A 4F6HA 4XWTA 2FU7A 5LLDA 1XM8A 2QDTA 4UBQA 5ACXA 2FK6A 4H0DA 5B3RA 5K4KA 4D02A 4Z5YA 4C1FA 4D1WA 4AD9A 5EH9A 2UYXA 2GMNA 2NZFA 3VPEA 3DH8A 3JXPA 4F6ZA 4J5HA 1JJTA 2E7YA 3FAIA 3LVZA 2YNVA 1A7TA 4TZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFK A;  4YSB A;  3SRX A;  4O98 A;  2I7X A;  3ADR A;  5AEB A;  5LCA A;  2P97 A;  1K07 A;  1YCH A;  3IOG A;  2BFL A;  3I13 A;  2QED A;  2Y87 A;  5KIL A;  5LS3 A;  1X8G A;  2FM6 A;  2FHX A;  3PG4 A;  4BP0 A;  4GYU A;  3DHA A;  4PVO A;  2YZ3 A;  5ACS A;  4D1T A;  4TZ9 A;  3IEL A;  2ZZI A;  2FU6 A;  5KIK A;  3QH8 A;  4EFZ A;  2OHI A;  3RKK A;  2P1E A;  4ZNB A;  4Z6X A;  1KO2 A;  1QH3 A;  5EW0 A;  4RBS A;  5K0W A;  1VJN A;  2Y8A A;  3VQZ A;  2GCU A;  4NQ5 A;  1ZKP A;  4PVT A;  1XTO A;  1YCG A;  5ACP A;  4EYF A;  1WUP A;  3P2U A;  1BMC A;  1DXK A;  5A0T A;  2WRS A;  4EY2 A;  4YSL A;  4XUK A;  2OHH A;  2QIN A;  3RPC A;  5DPX A;  1VME A;  2ZNB A;  2VW8 A;  3BK2 A;  2BG8 A;  5FQB A;  2R2D A;  1QH5 A;  2WYL A;  5K4M A;  1P9E A;  4TYF A;  3T3O A;  5HH5 A;  4GYQ A;  3X30 A;  2YNT A;  5B15 A;  2BC2 A;  4B87 A;  4P62 A;  2H6A A;  2DOO A;  3T3N A;  4Z60 A;  3AF6 A;  5FQC A;  4EYL A;  4XWW A;  4C09 A;  3BV6 A;  4UWS B;  2I7T A;  2A7M A;  3IE2 A;  4NQ4 A;  2Q0I A;  4Z5Z A;  3BC2 A;  2AIO A;  1ZNB A;  5LCH A;  4AWY B;  4KEP A;  4HL2 A;  3A4Y A;  4RM5 A;  2GKL A;  4ZEJ A;  1X8H A;  2BR6 A;  4AX0 B;  3KNS A;  4FSB A;  3I11 A;  1VGN A;  3X2Z A;  5EWA A;  2M5C A;  4Z67 A;  3SW3 A;  2FHX B;  5AHR A;  3IEM A;  3X2Y A;  3KNR A;  5EV6 A;  4DIL A;  2BG2 A;  2NZE A;  4CHL A;  4EYB A;  2Q42 A;  5EV8 A;  4RAW A;  4EXS A;  3ESH A;  2DKF A;  3FCZ A;  4C1H A;  3S0Z A;  1A8T A;  1Y44 A;  4GCW A;  3H3E A;  5LE1 A;  4J5F A;  2QDS A;  4KEQ A;  4YSK A;  1WUO A;  5EVK A;  5ACU A;  2Y8B A;  3IE1 A;  1YCF A;  3X2X A;  3L6N A;  4U4L A;  3TP9 A;  3WXC A;  2BFZ A;  2M5D A;  5LCF A;  5A87 A;  2XR1 A;  2Q9U A;  3ZR9 A;  4TYT A;  4HKY A;  4D1V A;  5HIO A;  1WRA A;  5AHO A;  5HIS A;  5IQK A;  2BG8 B;  5ACV A;  5FQA A;  1KO3 A;  1DDK A;  2BIB A;  5LMC A;  4UAM A;  5HH6 A;  2WYM C;  2ZWR A;  4C1C A;  4WD6 A;  1KR3 A;  1BC2 A;  5A5Z A;  4C1G A;  5EVD A;  2YNT B;  4ZO3 A;  4C1E A;  5AXO A;  3IDZ A;  3ZQ4 A;  2BG6 A;  2P4Z A;  5ACQ A;  3SBL A;  2BTN A;  3SPU A;  5ACT A;  3IEK A;  4Z7R A;  3KL7 A;  1E5D A;  2Q0J A;  5HH4 A;  3DHB A;  1MQO A;  5EHT A;  1HLK A;  5LM6 A;  3Q6V A;  4EXY A;  4FR7 A;  4TZB A;  2YNV B;  2OHJ A;  2FU9 A;  2CBN A;  4JO0 A;  4DIK A;  1L9Y A;  2P18 A;  4FEK A;  2WYM A;  2QJS A;  4UWP B;  1DD6 A;  4RAM A;  4UWO B;  1M2X A;  4C1D A;  3ZWF A;  2HB9 A;  4HL1 A;  2I7V A;  1BVT A;  3I14 A;  3SFP A;  3AJ3 A;  3MD7 A;  3PY6 A;  3F9O A;  4UWR B;  3I0V A;  3IE0 A;  3SD9 A;  4UA4 A;  3RKJ A;  2YCB A;  4NQ6 A;  1JT1 A;  2NYP A;  2AZ4 A;  4TZF A;  4V0H A;  5ACR A;  5HIP A;  2ZO4 A;  2WHG A;  2YNU A;  2BFZ B;  1WW1 A;  4RL0 A;  3T9M A;  2NXA A;  4NQ2 A;  4AWZ A;  5EVB A;  3I15 A;  2XF4 A;  3ZNB A;  2FU8 A;  2GFJ A;  5HIQ A;  3PY5 A;  3G1P A;  2YNW A;  1X8I A;  2BMI A;  3AF5 A;  5A0V A;  1SML A;  3BK1 A;  4BZ3 A;  1JJE A;  5AXR A;  5AYA A;  3IOF A;  4D1U A;  3DHC A;  4AX1 B;  2BGA A;  3R2U A;  4RL2 A;  2BG7 A;  5ACW A;  5B1U A;  5K4N A;  4LE6 A;  1ZTC A;  5LSC A;  2BFK A;  4ZO2 A;  4F6H A;  4XWT A;  2FU7 A;  5LLD A;  1XM8 A;  2QDT A;  4UBQ A;  5ACX A;  2FK6 A;  4H0D A;  5B3R A;  5K4K A;  4D02 A;  4Z5Y A;  4C1F A;  4D1W A;  4AD9 A;  5EH9 A;  2UYX A;  2GMN A;  2NZF A;  3VPE A;  3DH8 A;  3JXP A;  4F6Z A;  4J5H A;  1JJT A;  2E7Y A;  3FAI A;  3LVZ A;  2YNV A;  1A7T A;  4TZE A; 
#chains in the Genus database with same CATH topology
 2GFK A;  4YSB A;  3SRX A;  4O98 A;  2I7X A;  3ADR A;  5AEB A;  5LCA A;  2P97 A;  1K07 A;  1YCH A;  3IOG A;  2BFL A;  3I13 A;  2QED A;  2Y87 A;  5KIL A;  5LS3 A;  1X8G A;  2FM6 A;  2FHX A;  3PG4 A;  4BP0 A;  4GYU A;  3DHA A;  4PVO A;  2YZ3 A;  2CG3 A;  5ACS A;  4D1T A;  4TZ9 A;  3IEL A;  2ZZI A;  2FU6 A;  5KIK A;  3QH8 A;  4EFZ A;  2OHI A;  3RKK A;  2P1E A;  4ZNB A;  4Z6X A;  1KO2 A;  1QH3 A;  5EW0 A;  4RBS A;  5K0W A;  1VJN A;  2Y8A A;  3VQZ A;  2GCU A;  4NQ5 A;  1ZKP A;  4PVT A;  1XTO A;  1YCG A;  5ACP A;  4EYF A;  4AV7 A;  1WUP A;  3P2U A;  1BMC A;  1DXK A;  5A0T A;  2WRS A;  4EY2 A;  4YSL A;  4XUK A;  2OHH A;  2QIN A;  3RPC A;  5DPX A;  1VME A;  2ZNB A;  2VW8 A;  3BK2 A;  2BG8 A;  5FQB A;  2R2D A;  1QH5 A;  2WYL A;  5K4M A;  1P9E A;  4TYF A;  3T3O A;  5HH5 A;  4GYQ A;  3X30 A;  2YNT A;  5B15 A;  2BC2 A;  4B87 A;  4P62 A;  2H6A A;  2DOO A;  3T3N A;  4Z60 A;  3AF6 A;  5FQC A;  4EYL A;  4XWW A;  4C09 A;  3BV6 A;  4UWS B;  2I7T A;  2A7M A;  3IE2 A;  4NQ4 A;  2Q0I A;  4Z5Z A;  3BC2 A;  2AIO A;  1ZNB A;  5LCH A;  4AWY B;  4KEP A;  4HL2 A;  3A4Y A;  4RM5 A;  2GKL A;  4ZEJ A;  4NUR A;  1X8H A;  2BR6 A;  4AX0 B;  3KNS A;  4FSB A;  3I11 A;  1VGN A;  3X2Z A;  5EWA A;  2M5C A;  4Z67 A;  3SW3 A;  2FHX B;  5AHR A;  3IEM A;  3X2Y A;  3KNR A;  5EV6 A;  4DIL A;  2BG2 A;  2NZE A;  4CHL A;  4EYB A;  2Q42 A;  5EV8 A;  4RAW A;  4EXS A;  3ESH A;  2DKF A;  3FCZ A;  4PDX A;  4C1H A;  3S0Z A;  1A8T A;  5AIJ A;  1Y44 A;  4GCW A;  3H3E A;  5LE1 A;  4J5F A;  2QDS A;  4KEQ A;  4YSK A;  1WUO A;  5EVK A;  5ACU A;  2Y8B A;  3IE1 A;  1YCF A;  3X2X A;  3L6N A;  4U4L A;  3TP9 A;  3WXC A;  2BFZ A;  2M5D A;  5LCF A;  5A87 A;  2XR1 A;  2Q9U A;  3ZR9 A;  4TYT A;  4HKY A;  4D1V A;  5HIO A;  1WRA A;  5AHO A;  5HIS A;  5IQK A;  2BG8 B;  5ACV A;  5FQA A;  1KO3 A;  1DDK A;  2BIB A;  2CG2 A;  5LMC A;  4UAM A;  5HH6 A;  2WYM C;  2ZWR A;  4C1C A;  4WD6 A;  1KR3 A;  1BC2 A;  5A5Z A;  4C1G A;  2YHE A;  5EVD A;  2YNT B;  4ZO3 A;  4C1E A;  5AXO A;  3IDZ A;  3ZQ4 A;  2BG6 A;  2P4Z A;  5ACQ A;  3SBL A;  2BTN A;  3SPU A;  5ACT A;  3IEK A;  4Z7R A;  3KL7 A;  1E5D A;  2Q0J A;  5HH4 A;  3DHB A;  1MQO A;  5EHT A;  1HLK A;  5LM6 A;  3Q6V A;  4EXY A;  4FR7 A;  4TZB A;  2YNV B;  2OHJ A;  2FU9 A;  2CBN A;  4JO0 A;  2CFU A;  4DIK A;  1L9Y A;  2P18 A;  4FEK A;  2WYM A;  2QJS A;  4UWP B;  1DD6 A;  4RAM A;  4UWO B;  1M2X A;  4C1D A;  3ZWF A;  2HB9 A;  4HL1 A;  2I7V A;  1BVT A;  3I14 A;  3SFP A;  4AXH A;  3AJ3 A;  3MD7 A;  3PY6 A;  3F9O A;  4UWR B;  3I0V A;  3IE0 A;  3SD9 A;  4UA4 A;  3RKJ A;  2YCB A;  4NQ6 A;  5A23 A;  1JT1 A;  2NYP A;  2AZ4 A;  4TZF A;  4V0H A;  5ACR A;  5HIP A;  2ZO4 A;  2WHG A;  2YNU A;  2BFZ B;  1WW1 A;  4RL0 A;  2CFZ A;  3T9M A;  2NXA A;  4NQ2 A;  4AWZ A;  5EVB A;  3I15 A;  2XF4 A;  3ZNB A;  2FU8 A;  2GFJ A;  5HIQ A;  3PY5 A;  3G1P A;  2YNW A;  1X8I A;  2BMI A;  3AF5 A;  5A0V A;  1SML A;  3BK1 A;  4BZ3 A;  1JJE A;  5AXR A;  5AYA A;  3IOF A;  4D1U A;  3DHC A;  4AX1 B;  2BGA A;  3R2U A;  4RL2 A;  2BG7 A;  5ACW A;  5B1U A;  5K4N A;  4LE6 A;  1ZTC A;  5LSC A;  2BFK A;  4ZO2 A;  4F6H A;  4XWT A;  2FU7 A;  5LLD A;  1XM8 A;  2QDT A;  4UBQ A;  5ACX A;  2FK6 A;  4H0D A;  5B3R A;  5K4K A;  4D02 A;  4Z5Y A;  4C1F A;  4D1W A;  4AD9 A;  5EH9 A;  2UYX A;  2GMN A;  2NZF A;  3VPE A;  3DH8 A;  5AJL A;  3JXP A;  4F6Z A;  4J5H A;  1JJT A;  2E7Y A;  3FAI A;  3LVZ A;  2YNV A;  1A7T A;  4TZE A; 
#chains in the Genus database with same CATH homology
 2GFK A;  4YSB A;  3SRX A;  4O98 A;  2I7X A;  3ADR A;  5AEB A;  5LCA A;  2P97 A;  1K07 A;  1YCH A;  3IOG A;  2BFL A;  3I13 A;  2QED A;  2Y87 A;  5KIL A;  5LS3 A;  1X8G A;  2FM6 A;  2FHX A;  3PG4 A;  4BP0 A;  4GYU A;  3DHA A;  4PVO A;  2YZ3 A;  5ACS A;  4D1T A;  4TZ9 A;  3IEL A;  2ZZI A;  2FU6 A;  5KIK A;  3QH8 A;  4EFZ A;  2OHI A;  3RKK A;  2P1E A;  4ZNB A;  4Z6X A;  1KO2 A;  1QH3 A;  5EW0 A;  4RBS A;  5K0W A;  1VJN A;  2Y8A A;  3VQZ A;  2GCU A;  4NQ5 A;  1ZKP A;  4PVT A;  1XTO A;  1YCG A;  5ACP A;  4EYF A;  1WUP A;  3P2U A;  1BMC A;  1DXK A;  5A0T A;  2WRS A;  4EY2 A;  4YSL A;  4XUK A;  2OHH A;  2QIN A;  3RPC A;  5DPX A;  1VME A;  2ZNB A;  2VW8 A;  3BK2 A;  2BG8 A;  5FQB A;  2R2D A;  1QH5 A;  2WYL A;  5K4M A;  1P9E A;  4TYF A;  3T3O A;  5HH5 A;  4GYQ A;  3X30 A;  2YNT A;  5B15 A;  2BC2 A;  4B87 A;  4P62 A;  2H6A A;  2DOO A;  3T3N A;  4Z60 A;  3AF6 A;  5FQC A;  4EYL A;  4XWW A;  4C09 A;  3BV6 A;  4UWS B;  2I7T A;  2A7M A;  3IE2 A;  4NQ4 A;  2Q0I A;  4Z5Z A;  3BC2 A;  2AIO A;  1ZNB A;  5LCH A;  4AWY B;  4KEP A;  4HL2 A;  3A4Y A;  4RM5 A;  2GKL A;  4ZEJ A;  1X8H A;  2BR6 A;  4AX0 B;  3KNS A;  4FSB A;  3I11 A;  1VGN A;  3X2Z A;  5EWA A;  2M5C A;  4Z67 A;  3SW3 A;  2FHX B;  5AHR A;  3IEM A;  3X2Y A;  3KNR A;  5EV6 A;  4DIL A;  2BG2 A;  2NZE A;  4CHL A;  4EYB A;  2Q42 A;  5EV8 A;  4RAW A;  4EXS A;  3ESH A;  2DKF A;  3FCZ A;  4C1H A;  3S0Z A;  1A8T A;  1Y44 A;  4GCW A;  3H3E A;  5LE1 A;  4J5F A;  2QDS A;  4KEQ A;  4YSK A;  1WUO A;  5EVK A;  5ACU A;  2Y8B A;  3IE1 A;  1YCF A;  3X2X A;  3L6N A;  4U4L A;  3TP9 A;  3WXC A;  2BFZ A;  2M5D A;  5LCF A;  5A87 A;  2XR1 A;  2Q9U A;  3ZR9 A;  4TYT A;  4HKY A;  4D1V A;  5HIO A;  1WRA A;  5AHO A;  5HIS A;  5IQK A;  2BG8 B;  5ACV A;  5FQA A;  1KO3 A;  1DDK A;  2BIB A;  5LMC A;  4UAM A;  5HH6 A;  2WYM C;  2ZWR A;  4C1C A;  4WD6 A;  1KR3 A;  1BC2 A;  5A5Z A;  4C1G A;  5EVD A;  2YNT B;  4ZO3 A;  4C1E A;  5AXO A;  3IDZ A;  3ZQ4 A;  2BG6 A;  2P4Z A;  5ACQ A;  3SBL A;  2BTN A;  3SPU A;  5ACT A;  3IEK A;  4Z7R A;  3KL7 A;  1E5D A;  2Q0J A;  5HH4 A;  3DHB A;  1MQO A;  5EHT A;  1HLK A;  5LM6 A;  3Q6V A;  4EXY A;  4FR7 A;  4TZB A;  2YNV B;  2OHJ A;  2FU9 A;  2CBN A;  4JO0 A;  4DIK A;  1L9Y A;  2P18 A;  4FEK A;  2WYM A;  2QJS A;  4UWP B;  1DD6 A;  4RAM A;  4UWO B;  1M2X A;  4C1D A;  3ZWF A;  2HB9 A;  4HL1 A;  2I7V A;  1BVT A;  3I14 A;  3SFP A;  3AJ3 A;  3MD7 A;  3PY6 A;  3F9O A;  4UWR B;  3I0V A;  3IE0 A;  3SD9 A;  4UA4 A;  3RKJ A;  2YCB A;  4NQ6 A;  1JT1 A;  2NYP A;  2AZ4 A;  4TZF A;  4V0H A;  5ACR A;  5HIP A;  2ZO4 A;  2WHG A;  2YNU A;  2BFZ B;  1WW1 A;  4RL0 A;  3T9M A;  2NXA A;  4NQ2 A;  4AWZ A;  5EVB A;  3I15 A;  2XF4 A;  3ZNB A;  2FU8 A;  2GFJ A;  5HIQ A;  3PY5 A;  3G1P A;  2YNW A;  1X8I A;  2BMI A;  3AF5 A;  5A0V A;  1SML A;  3BK1 A;  4BZ3 A;  1JJE A;  5AXR A;  5AYA A;  3IOF A;  4D1U A;  3DHC A;  4AX1 B;  2BGA A;  3R2U A;  4RL2 A;  2BG7 A;  5ACW A;  5B1U A;  5K4N A;  4LE6 A;  1ZTC A;  5LSC A;  2BFK A;  4ZO2 A;  4F6H A;  4XWT A;  2FU7 A;  5LLD A;  1XM8 A;  2QDT A;  4UBQ A;  5ACX A;  2FK6 A;  4H0D A;  5B3R A;  5K4K A;  4D02 A;  4Z5Y A;  4C1F A;  4D1W A;  4AD9 A;  5EH9 A;  2UYX A;  2GMN A;  2NZF A;  3VPE A;  3DH8 A;  3JXP A;  4F6Z A;  4J5H A;  1JJT A;  2E7Y A;  3FAI A;  3LVZ A;  2YNV A;  1A7T A;  4TZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...