4Z60A

The 2.5-angstrom of crystal structure of zn(2+)-bound pqqb from pseudomonas putida
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
b'MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z60A00
5LE1A 4P62A 2OHHA 1JJTA 1E5DA 5EV8A 4H0DA 2QEDA 2ZO4A 2I7TA 3G1PA 1QH3A 1XM8A 4KEQA 2M5CA 4EXSA 4HKYA 3T3OA 2GMNA 3IE0A 5ACTA 4HL2A 3IELA 4RAMA 2QDTA 1WW1A 1WUPA 2R2DA 2UYXA 2Q9UA 4UWRB 2BFKA 3SRXA 3ESHA 1Y44A 1K07A 2YZ3A 2WYMA 1M2XA 2ZNBA 3RPCA 4FEKA 4UAMA 4AWZA 2BC2A 2YNUA 2Q0JA 1VJNA 4UA4A 4FSBA 5AHOA 5A0VA 4XWTA 2YNVA 5AEBA 3ADRA 5EVBA 3H3EA 4Z5YA 5ACWA 3RKKA 2ZWRA 1A8TA 2YNTB 4B87A 2P4ZA 2DKFA 2WYLA 5LLDA 3I11A 4WD6A 2FHXA 4Z6XA 5B1UA 4CHLA 2FU7A 3IEMA 5LCHA 4JO0A 2YNTA 3VQZA 2VW8A 3ZR9A 3I14A 3IEKA 4TZFA 4C1GA 2WHGA 2Y8AA 2FU6A 5A0TA 3R2UA 2BFZA 4EY2A 3I15A 1QH5A 3IOGA 4NQ2A 1VMEA 4RAWA 1KR3A 4UWOB 3KNSA 2E7YA 4TZBA 5FQBA 5EV6A 4J5FA 5K0WA 3SPUA 3PY6A 4C1FA 1YCHA 4Z7RA 4ZO2A 1BC2A 4C1HA 5B15A 3IOFA 3JXPA 2P18A 4D1WA 2BG2A 3VPEA 5EH9A 2WRSA 3PY5A 5ACUA 4TYTA 5K4MA 5IQKA 4TZEA 4NQ5A 5K4KA 3BC2A 2NYPA 4GYQA 3TP9A 3X2YA 1A7TA 5KILA 3KL7A 4J5HA 2BTNA 4UWPB 3SBLA 4LE6A 5ACSA 3A4YA 5EW0A 3DHCA 3DHBA 1JT1A 3KNRA 1WRAA 2XF4A 5LM6A 4ZNBA 4ZO3A 2P97A 2BG8B 4AWYB 2BR6A 3AF6A 5AYAA 2OHIA 1SMLA 2Q42A 1WUOA 4RM5A 2QDSA 4C09A 4D1TA 2BG7A 3ZWFA 2WYMC 4BZ3A 5HIPA 2I7VA 2XR1A 5B3RA 3WXCA 3T9MA 4HL1A 3SFPA 2NXAA 5LS3A 4TYFA 2BFLA 2FK6A 1BMCA 4UWSB 4AX0B 4DIKA 2FU8A 1ZTCA 5EVKA 5LCFA 3IE1A 5A87A 4KEPA 4EFZA 4F6HA 4EYFA 1BVTA 2M5DA 3X30A 1MQOA 5ACQA 1YCFA 1YCGA 5EVDA 2GFKA 2NZEA 4RL2A 1KO3A 2QINA 1XTOA 4FR7A 5LCAA 4YSLA 2BGAA 4AX1B 5FQCA 2P1EA 5ACPA 2YNWA 3IE2A 1ZKPA 3SW3A 5HISA 3MD7A 4UBQA 3F9OA 4PVTA 2Y8BA 4XUKA 2AZ4A 2GCUA 3SD9A 1X8GA 3I13A 2GFJA 3X2XA 2OHJA 2H6AA 5A5ZA 3FCZA 3DH8A 1X8IA 4RL0A 5HIOA 4C1DA 5HH6A 1DD6A 4O98A 5ACVA 5EWAA 5DPXA 1JJEA 5ACXA 3QH8A 4D1UA 1L9YA 1P9EA 4D02A 4U4LA 3DHAA 2I7XA 1ZNBA 2BMIA 1KO2A 3I0VA 3RKJA 2YNVB 2AIOA 3AJ3A 4TZ9A 4NQ6A 4EXYA 3Q6VA 2BIBA 4YSKA 2BG8A 5HH4A 2A7MA 2Q0IA 4Z67A 4EYLA 4C1EA 2Y87A 3AF5A 4PVOA 3ZNBA 1HLKA 2FHXB 1DXKA 4GCWA 2GKLA 3X2ZA 4GYUA 3P2UA 5FQAA 2QJSA 4DILA 1DDKA 5AHRA 5HIQA 5HH5A 2ZZIA 2BFZB 4ZEJA 3BV6A 4EYBA 4XWWA 1X8HA 3FAIA 2YCBA 4Z5ZA 3PG4A 3BK1A 2NZFA 4BP0A 3T3NA 3ZQ4A 2BG6A 5AXOA 4NQ4A 4D1VA 4RBSA 5LMCA 3L6NA 2FU9A 2CBNA 2DOOA 2HB9A 3BK2A 5KIKA 3IDZA 5K4NA 4V0HA 5AXRA 1VGNA 4C1CA 4F6ZA 4YSBA 3LVZA 5EHTA 4AD9A 2FM6A 4Z60A 3S0ZA 5ACRA 5LSCA
chains in the Genus database with same CATH superfamily
5LE1A 4P62A 2OHHA 1JJTA 1E5DA 5EV8A 4H0DA 2QEDA 2ZO4A 2I7TA 3G1PA 1QH3A 1XM8A 4KEQA 2M5CA 4EXSA 4HKYA 3T3OA 2GMNA 3IE0A 5ACTA 4HL2A 3IELA 4RAMA 2QDTA 1WW1A 1WUPA 2R2DA 2UYXA 2Q9UA 4UWRB 2BFKA 3SRXA 3ESHA 1Y44A 1K07A 2YZ3A 2WYMA 1M2XA 2ZNBA 3RPCA 4FEKA 4UAMA 4AWZA 2BC2A 2YNUA 2Q0JA 1VJNA 4UA4A 4FSBA 5AHOA 5A0VA 4XWTA 2YNVA 5AEBA 3ADRA 5EVBA 3H3EA 4Z5YA 5ACWA 3RKKA 2ZWRA 1A8TA 2YNTB 4B87A 2P4ZA 2DKFA 2WYLA 5LLDA 2CFZA 3I11A 4WD6A 2FHXA 4Z6XA 5B1UA 4CHLA 2FU7A 4NURA 3IEMA 5LCHA 4JO0A 2YNTA 3VQZA 2VW8A 3ZR9A 3I14A 3IEKA 4TZFA 4C1GA 2WHGA 2Y8AA 2FU6A 5A0TA 3R2UA 2BFZA 4EY2A 3I15A 1QH5A 3IOGA 4NQ2A 1VMEA 4AV7A 4RAWA 1KR3A 4UWOB 2CG2A 3KNSA 2E7YA 4TZBA 5FQBA 5EV6A 4J5FA 5K0WA 3SPUA 3PY6A 4C1FA 1YCHA 4Z7RA 4ZO2A 1BC2A 4C1HA 5B15A 3IOFA 3JXPA 2P18A 4D1WA 2BG2A 3VPEA 5EH9A 2WRSA 3PY5A 5ACUA 4TYTA 5K4MA 5IQKA 4TZEA 4NQ5A 5K4KA 3BC2A 2NYPA 4GYQA 3TP9A 3X2YA 1A7TA 5KILA 3KL7A 4J5HA 2BTNA 4UWPB 3SBLA 4LE6A 5ACSA 3A4YA 5EW0A 3DHCA 3DHBA 1JT1A 3KNRA 1WRAA 2XF4A 5LM6A 4ZNBA 4ZO3A 2P97A 2BG8B 4AWYB 2BR6A 3AF6A 5AYAA 2OHIA 1SMLA 2Q42A 1WUOA 4RM5A 2QDSA 4C09A 4D1TA 2BG7A 3ZWFA 2WYMC 4BZ3A 5HIPA 2I7VA 2XR1A 5B3RA 4PDXA 3WXCA 3T9MA 4HL1A 3SFPA 2NXAA 5LS3A 4TYFA 2BFLA 2FK6A 1BMCA 2YHEA 4UWSB 4AX0B 4DIKA 2FU8A 1ZTCA 5EVKA 5LCFA 3IE1A 5A87A 4KEPA 4AXHA 4EFZA 4F6HA 4EYFA 1BVTA 2M5DA 3X30A 1MQOA 5ACQA 1YCFA 1YCGA 5EVDA 2GFKA 2NZEA 4RL2A 1KO3A 2QINA 1XTOA 4FR7A 5LCAA 4YSLA 2BGAA 4AX1B 5FQCA 2P1EA 5ACPA 2YNWA 3IE2A 1ZKPA 3SW3A 5HISA 3MD7A 4UBQA 3F9OA 4PVTA 2Y8BA 4XUKA 2AZ4A 2GCUA 3SD9A 1X8GA 3I13A 2GFJA 3X2XA 2OHJA 2H6AA 5AJLA 5A5ZA 3FCZA 3DH8A 1X8IA 4RL0A 5HIOA 4C1DA 5HH6A 1DD6A 4O98A 5ACVA 5EWAA 5DPXA 1JJEA 5ACXA 3QH8A 4D1UA 1L9YA 1P9EA 4D02A 4U4LA 3DHAA 2CG3A 2I7XA 1ZNBA 2BMIA 1KO2A 3I0VA 3RKJA 2YNVB 5A23A 2AIOA 2CFUA 3AJ3A 4TZ9A 4NQ6A 4EXYA 3Q6VA 2BIBA 4YSKA 2BG8A 5HH4A 2A7MA 2Q0IA 4Z67A 4EYLA 4C1EA 2Y87A 3AF5A 4PVOA 3ZNBA 1HLKA 2FHXB 1DXKA 4GCWA 2GKLA 3X2ZA 4GYUA 3P2UA 5FQAA 2QJSA 4DILA 1DDKA 5AHRA 5HIQA 5HH5A 2ZZIA 2BFZB 5AIJA 4ZEJA 3BV6A 4EYBA 4XWWA 1X8HA 3FAIA 2YCBA 4Z5ZA 3PG4A 3BK1A 2NZFA 4BP0A 3T3NA 3ZQ4A 2BG6A 5AXOA 4NQ4A 4D1VA 4RBSA 5LMCA 3L6NA 2FU9A 2DOOA 2CBNA 2HB9A 3BK2A 5KIKA 3IDZA 5K4NA 4V0HA 5AXRA 1VGNA 4C1CA 4F6ZA 4YSBA 3LVZA 5EHTA 4AD9A 2FM6A 4Z60A 3S0ZA 5ACRA 5LSCA
chains in the Genus database with same CATH topology
5LE1A 4P62A 2OHHA 1JJTA 1E5DA 5EV8A 4H0DA 2QEDA 2ZO4A 2I7TA 3G1PA 1QH3A 1XM8A 4KEQA 2M5CA 4EXSA 4HKYA 3T3OA 2GMNA 3IE0A 5ACTA 4HL2A 3IELA 4RAMA 2QDTA 1WW1A 1WUPA 2R2DA 2UYXA 2Q9UA 4UWRB 2BFKA 3SRXA 3ESHA 1Y44A 1K07A 2YZ3A 2WYMA 1M2XA 2ZNBA 3RPCA 4FEKA 4UAMA 4AWZA 2BC2A 2YNUA 2Q0JA 1VJNA 4UA4A 4FSBA 5AHOA 5A0VA 4XWTA 2YNVA 5AEBA 3ADRA 5EVBA 3H3EA 4Z5YA 5ACWA 3RKKA 2ZWRA 1A8TA 2YNTB 4B87A 2P4ZA 2DKFA 2WYLA 5LLDA 3I11A 4WD6A 2FHXA 4Z6XA 5B1UA 4CHLA 2FU7A 3IEMA 5LCHA 4JO0A 2YNTA 3VQZA 2VW8A 3ZR9A 3I14A 3IEKA 4TZFA 4C1GA 2WHGA 2Y8AA 2FU6A 5A0TA 3R2UA 2BFZA 4EY2A 3I15A 1QH5A 3IOGA 4NQ2A 1VMEA 4RAWA 1KR3A 4UWOB 3KNSA 2E7YA 4TZBA 5FQBA 5EV6A 4J5FA 5K0WA 3SPUA 3PY6A 4C1FA 1YCHA 4Z7RA 4ZO2A 1BC2A 4C1HA 5B15A 3IOFA 3JXPA 2P18A 4D1WA 2BG2A 3VPEA 5EH9A 2WRSA 3PY5A 5ACUA 4TYTA 5K4MA 5IQKA 4TZEA 4NQ5A 5K4KA 3BC2A 2NYPA 4GYQA 3TP9A 3X2YA 1A7TA 5KILA 3KL7A 4J5HA 2BTNA 4UWPB 3SBLA 4LE6A 5ACSA 3A4YA 5EW0A 3DHCA 3DHBA 1JT1A 3KNRA 1WRAA 2XF4A 5LM6A 4ZNBA 4ZO3A 2P97A 2BG8B 4AWYB 2BR6A 3AF6A 5AYAA 2OHIA 1SMLA 2Q42A 1WUOA 4RM5A 2QDSA 4C09A 4D1TA 2BG7A 3ZWFA 2WYMC 4BZ3A 5HIPA 2I7VA 2XR1A 5B3RA 3WXCA 3T9MA 4HL1A 3SFPA 2NXAA 5LS3A 4TYFA 2BFLA 2FK6A 1BMCA 4UWSB 4AX0B 4DIKA 2FU8A 1ZTCA 5EVKA 5LCFA 3IE1A 5A87A 4KEPA 4EFZA 4F6HA 4EYFA 1BVTA 2M5DA 3X30A 1MQOA 5ACQA 1YCFA 1YCGA 5EVDA 2GFKA 2NZEA 4RL2A 1KO3A 2QINA 1XTOA 4FR7A 5LCAA 4YSLA 2BGAA 4AX1B 5FQCA 2P1EA 5ACPA 2YNWA 3IE2A 1ZKPA 3SW3A 5HISA 3MD7A 4UBQA 3F9OA 4PVTA 2Y8BA 4XUKA 2AZ4A 2GCUA 3SD9A 1X8GA 3I13A 2GFJA 3X2XA 2OHJA 2H6AA 5A5ZA 3FCZA 3DH8A 1X8IA 4RL0A 5HIOA 4C1DA 5HH6A 1DD6A 4O98A 5ACVA 5EWAA 5DPXA 1JJEA 5ACXA 3QH8A 4D1UA 1L9YA 1P9EA 4D02A 4U4LA 3DHAA 2I7XA 1ZNBA 2BMIA 1KO2A 3I0VA 3RKJA 2YNVB 2AIOA 3AJ3A 4TZ9A 4NQ6A 4EXYA 3Q6VA 2BIBA 4YSKA 2BG8A 5HH4A 2A7MA 2Q0IA 4Z67A 4EYLA 4C1EA 2Y87A 3AF5A 4PVOA 3ZNBA 1HLKA 2FHXB 1DXKA 4GCWA 2GKLA 3X2ZA 4GYUA 3P2UA 5FQAA 2QJSA 4DILA 1DDKA 5AHRA 5HIQA 5HH5A 2ZZIA 2BFZB 4ZEJA 3BV6A 4EYBA 4XWWA 1X8HA 3FAIA 2YCBA 4Z5ZA 3PG4A 3BK1A 2NZFA 4BP0A 3T3NA 3ZQ4A 2BG6A 5AXOA 4NQ4A 4D1VA 4RBSA 5LMCA 3L6NA 2FU9A 2CBNA 2DOOA 2HB9A 3BK2A 5KIKA 3IDZA 5K4NA 4V0HA 5AXRA 1VGNA 4C1CA 4F6ZA 4YSBA 3LVZA 5EHTA 4AD9A 2FM6A 4Z60A 3S0ZA 5ACRA 5LSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LE1 A;  4P62 A;  2OHH A;  1JJT A;  1E5D A;  5EV8 A;  4H0D A;  2QED A;  2ZO4 A;  2I7T A;  3G1P A;  1QH3 A;  1XM8 A;  4KEQ A;  2M5C A;  4EXS A;  4HKY A;  3T3O A;  2GMN A;  3IE0 A;  5ACT A;  4HL2 A;  3IEL A;  4RAM A;  2QDT A;  1WW1 A;  1WUP A;  2R2D A;  2UYX A;  2Q9U A;  4UWR B;  2BFK A;  3SRX A;  3ESH A;  1Y44 A;  1K07 A;  2YZ3 A;  2WYM A;  1M2X A;  2ZNB A;  3RPC A;  4FEK A;  4UAM A;  4AWZ A;  2BC2 A;  2YNU A;  2Q0J A;  1VJN A;  4UA4 A;  4FSB A;  5AHO A;  5A0V A;  4XWT A;  2YNV A;  5AEB A;  3ADR A;  5EVB A;  3H3E A;  4Z5Y A;  5ACW A;  3RKK A;  2ZWR A;  1A8T A;  2YNT B;  4B87 A;  2P4Z A;  2DKF A;  2WYL A;  5LLD A;  3I11 A;  4WD6 A;  2FHX A;  4Z6X A;  5B1U A;  4CHL A;  2FU7 A;  3IEM A;  5LCH A;  4JO0 A;  2YNT A;  3VQZ A;  2VW8 A;  3ZR9 A;  3I14 A;  3IEK A;  4TZF A;  4C1G A;  2WHG A;  2Y8A A;  2FU6 A;  5A0T A;  3R2U A;  2BFZ A;  4EY2 A;  3I15 A;  1QH5 A;  3IOG A;  4NQ2 A;  1VME A;  4RAW A;  1KR3 A;  4UWO B;  3KNS A;  2E7Y A;  4TZB A;  5FQB A;  5EV6 A;  4J5F A;  5K0W A;  3SPU A;  3PY6 A;  4C1F A;  1YCH A;  4Z7R A;  4ZO2 A;  1BC2 A;  4C1H A;  5B15 A;  3IOF A;  3JXP A;  2P18 A;  4D1W A;  2BG2 A;  3VPE A;  5EH9 A;  2WRS A;  3PY5 A;  5ACU A;  4TYT A;  5K4M A;  5IQK A;  4TZE A;  4NQ5 A;  5K4K A;  3BC2 A;  2NYP A;  4GYQ A;  3TP9 A;  3X2Y A;  1A7T A;  5KIL A;  3KL7 A;  4J5H A;  2BTN A;  4UWP B;  3SBL A;  4LE6 A;  5ACS A;  3A4Y A;  5EW0 A;  3DHC A;  3DHB A;  1JT1 A;  3KNR A;  1WRA A;  2XF4 A;  5LM6 A;  4ZNB A;  4ZO3 A;  2P97 A;  2BG8 B;  4AWY B;  2BR6 A;  3AF6 A;  5AYA A;  2OHI A;  1SML A;  2Q42 A;  1WUO A;  4RM5 A;  2QDS A;  4C09 A;  4D1T A;  2BG7 A;  3ZWF A;  2WYM C;  4BZ3 A;  5HIP A;  2I7V A;  2XR1 A;  5B3R A;  3WXC A;  3T9M A;  4HL1 A;  3SFP A;  2NXA A;  5LS3 A;  4TYF A;  2BFL A;  2FK6 A;  1BMC A;  4UWS B;  4AX0 B;  4DIK A;  2FU8 A;  1ZTC A;  5EVK A;  5LCF A;  3IE1 A;  5A87 A;  4KEP A;  4EFZ A;  4F6H A;  4EYF A;  1BVT A;  2M5D A;  3X30 A;  1MQO A;  5ACQ A;  1YCF A;  1YCG A;  5EVD A;  2GFK A;  2NZE A;  4RL2 A;  1KO3 A;  2QIN A;  1XTO A;  4FR7 A;  5LCA A;  4YSL A;  2BGA A;  4AX1 B;  5FQC A;  2P1E A;  5ACP A;  2YNW A;  3IE2 A;  1ZKP A;  3SW3 A;  5HIS A;  3MD7 A;  4UBQ A;  3F9O A;  4PVT A;  2Y8B A;  4XUK A;  2AZ4 A;  2GCU A;  3SD9 A;  1X8G A;  3I13 A;  2GFJ A;  3X2X A;  2OHJ A;  2H6A A;  5A5Z A;  3FCZ A;  3DH8 A;  1X8I A;  4RL0 A;  5HIO A;  4C1D A;  5HH6 A;  1DD6 A;  4O98 A;  5ACV A;  5EWA A;  5DPX A;  1JJE A;  5ACX A;  3QH8 A;  4D1U A;  1L9Y A;  1P9E A;  4D02 A;  4U4L A;  3DHA A;  2I7X A;  1ZNB A;  2BMI A;  1KO2 A;  3I0V A;  3RKJ A;  2YNV B;  2AIO A;  3AJ3 A;  4TZ9 A;  4NQ6 A;  4EXY A;  3Q6V A;  2BIB A;  4YSK A;  2BG8 A;  5HH4 A;  2A7M A;  2Q0I A;  4Z67 A;  4EYL A;  4C1E A;  2Y87 A;  3AF5 A;  4PVO A;  3ZNB A;  1HLK A;  2FHX B;  1DXK A;  4GCW A;  2GKL A;  3X2Z A;  4GYU A;  3P2U A;  5FQA A;  2QJS A;  4DIL A;  1DDK A;  5AHR A;  5HIQ A;  5HH5 A;  2ZZI A;  2BFZ B;  4ZEJ A;  3BV6 A;  4EYB A;  4XWW A;  1X8H A;  3FAI A;  2YCB A;  4Z5Z A;  3PG4 A;  3BK1 A;  2NZF A;  4BP0 A;  3T3N A;  3ZQ4 A;  2BG6 A;  5AXO A;  4NQ4 A;  4D1V A;  4RBS A;  5LMC A;  3L6N A;  2FU9 A;  2CBN A;  2DOO A;  2HB9 A;  3BK2 A;  5KIK A;  3IDZ A;  5K4N A;  4V0H A;  5AXR A;  1VGN A;  4C1C A;  4F6Z A;  4YSB A;  3LVZ A;  5EHT A;  4AD9 A;  2FM6 A;  4Z60 A;  3S0Z A;  5ACR A;  5LSC A; 
#chains in the Genus database with same CATH topology
 5LE1 A;  4P62 A;  2OHH A;  1JJT A;  1E5D A;  5EV8 A;  4H0D A;  2QED A;  2ZO4 A;  2I7T A;  3G1P A;  1QH3 A;  1XM8 A;  4KEQ A;  2M5C A;  4EXS A;  4HKY A;  3T3O A;  2GMN A;  3IE0 A;  5ACT A;  4HL2 A;  3IEL A;  4RAM A;  2QDT A;  1WW1 A;  1WUP A;  2R2D A;  2UYX A;  2Q9U A;  4UWR B;  2BFK A;  3SRX A;  3ESH A;  1Y44 A;  1K07 A;  2YZ3 A;  2WYM A;  1M2X A;  2ZNB A;  3RPC A;  4FEK A;  4UAM A;  4AWZ A;  2BC2 A;  2YNU A;  2Q0J A;  1VJN A;  4UA4 A;  4FSB A;  5AHO A;  5A0V A;  4XWT A;  2YNV A;  5AEB A;  3ADR A;  5EVB A;  3H3E A;  4Z5Y A;  5ACW A;  3RKK A;  2ZWR A;  1A8T A;  2YNT B;  4B87 A;  2P4Z A;  2DKF A;  2WYL A;  5LLD A;  2CFZ A;  3I11 A;  4WD6 A;  2FHX A;  4Z6X A;  5B1U A;  4CHL A;  2FU7 A;  4NUR A;  3IEM A;  5LCH A;  4JO0 A;  2YNT A;  3VQZ A;  2VW8 A;  3ZR9 A;  3I14 A;  3IEK A;  4TZF A;  4C1G A;  2WHG A;  2Y8A A;  2FU6 A;  5A0T A;  3R2U A;  2BFZ A;  4EY2 A;  3I15 A;  1QH5 A;  3IOG A;  4NQ2 A;  1VME A;  4AV7 A;  4RAW A;  1KR3 A;  4UWO B;  2CG2 A;  3KNS A;  2E7Y A;  4TZB A;  5FQB A;  5EV6 A;  4J5F A;  5K0W A;  3SPU A;  3PY6 A;  4C1F A;  1YCH A;  4Z7R A;  4ZO2 A;  1BC2 A;  4C1H A;  5B15 A;  3IOF A;  3JXP A;  2P18 A;  4D1W A;  2BG2 A;  3VPE A;  5EH9 A;  2WRS A;  3PY5 A;  5ACU A;  4TYT A;  5K4M A;  5IQK A;  4TZE A;  4NQ5 A;  5K4K A;  3BC2 A;  2NYP A;  4GYQ A;  3TP9 A;  3X2Y A;  1A7T A;  5KIL A;  3KL7 A;  4J5H A;  2BTN A;  4UWP B;  3SBL A;  4LE6 A;  5ACS A;  3A4Y A;  5EW0 A;  3DHC A;  3DHB A;  1JT1 A;  3KNR A;  1WRA A;  2XF4 A;  5LM6 A;  4ZNB A;  4ZO3 A;  2P97 A;  2BG8 B;  4AWY B;  2BR6 A;  3AF6 A;  5AYA A;  2OHI A;  1SML A;  2Q42 A;  1WUO A;  4RM5 A;  2QDS A;  4C09 A;  4D1T A;  2BG7 A;  3ZWF A;  2WYM C;  4BZ3 A;  5HIP A;  2I7V A;  2XR1 A;  5B3R A;  4PDX A;  3WXC A;  3T9M A;  4HL1 A;  3SFP A;  2NXA A;  5LS3 A;  4TYF A;  2BFL A;  2FK6 A;  1BMC A;  2YHE A;  4UWS B;  4AX0 B;  4DIK A;  2FU8 A;  1ZTC A;  5EVK A;  5LCF A;  3IE1 A;  5A87 A;  4KEP A;  4AXH A;  4EFZ A;  4F6H A;  4EYF A;  1BVT A;  2M5D A;  3X30 A;  1MQO A;  5ACQ A;  1YCF A;  1YCG A;  5EVD A;  2GFK A;  2NZE A;  4RL2 A;  1KO3 A;  2QIN A;  1XTO A;  4FR7 A;  5LCA A;  4YSL A;  2BGA A;  4AX1 B;  5FQC A;  2P1E A;  5ACP A;  2YNW A;  3IE2 A;  1ZKP A;  3SW3 A;  5HIS A;  3MD7 A;  4UBQ A;  3F9O A;  4PVT A;  2Y8B A;  4XUK A;  2AZ4 A;  2GCU A;  3SD9 A;  1X8G A;  3I13 A;  2GFJ A;  3X2X A;  2OHJ A;  2H6A A;  5AJL A;  5A5Z A;  3FCZ A;  3DH8 A;  1X8I A;  4RL0 A;  5HIO A;  4C1D A;  5HH6 A;  1DD6 A;  4O98 A;  5ACV A;  5EWA A;  5DPX A;  1JJE A;  5ACX A;  3QH8 A;  4D1U A;  1L9Y A;  1P9E A;  4D02 A;  4U4L A;  3DHA A;  2CG3 A;  2I7X A;  1ZNB A;  2BMI A;  1KO2 A;  3I0V A;  3RKJ A;  2YNV B;  5A23 A;  2AIO A;  2CFU A;  3AJ3 A;  4TZ9 A;  4NQ6 A;  4EXY A;  3Q6V A;  2BIB A;  4YSK A;  2BG8 A;  5HH4 A;  2A7M A;  2Q0I A;  4Z67 A;  4EYL A;  4C1E A;  2Y87 A;  3AF5 A;  4PVO A;  3ZNB A;  1HLK A;  2FHX B;  1DXK A;  4GCW A;  2GKL A;  3X2Z A;  4GYU A;  3P2U A;  5FQA A;  2QJS A;  4DIL A;  1DDK A;  5AHR A;  5HIQ A;  5HH5 A;  2ZZI A;  2BFZ B;  5AIJ A;  4ZEJ A;  3BV6 A;  4EYB A;  4XWW A;  1X8H A;  3FAI A;  2YCB A;  4Z5Z A;  3PG4 A;  3BK1 A;  2NZF A;  4BP0 A;  3T3N A;  3ZQ4 A;  2BG6 A;  5AXO A;  4NQ4 A;  4D1V A;  4RBS A;  5LMC A;  3L6N A;  2FU9 A;  2DOO A;  2CBN A;  2HB9 A;  3BK2 A;  5KIK A;  3IDZ A;  5K4N A;  4V0H A;  5AXR A;  1VGN A;  4C1C A;  4F6Z A;  4YSB A;  3LVZ A;  5EHT A;  4AD9 A;  2FM6 A;  4Z60 A;  3S0Z A;  5ACR A;  5LSC A; 
#chains in the Genus database with same CATH homology
 5LE1 A;  4P62 A;  2OHH A;  1JJT A;  1E5D A;  5EV8 A;  4H0D A;  2QED A;  2ZO4 A;  2I7T A;  3G1P A;  1QH3 A;  1XM8 A;  4KEQ A;  2M5C A;  4EXS A;  4HKY A;  3T3O A;  2GMN A;  3IE0 A;  5ACT A;  4HL2 A;  3IEL A;  4RAM A;  2QDT A;  1WW1 A;  1WUP A;  2R2D A;  2UYX A;  2Q9U A;  4UWR B;  2BFK A;  3SRX A;  3ESH A;  1Y44 A;  1K07 A;  2YZ3 A;  2WYM A;  1M2X A;  2ZNB A;  3RPC A;  4FEK A;  4UAM A;  4AWZ A;  2BC2 A;  2YNU A;  2Q0J A;  1VJN A;  4UA4 A;  4FSB A;  5AHO A;  5A0V A;  4XWT A;  2YNV A;  5AEB A;  3ADR A;  5EVB A;  3H3E A;  4Z5Y A;  5ACW A;  3RKK A;  2ZWR A;  1A8T A;  2YNT B;  4B87 A;  2P4Z A;  2DKF A;  2WYL A;  5LLD A;  3I11 A;  4WD6 A;  2FHX A;  4Z6X A;  5B1U A;  4CHL A;  2FU7 A;  3IEM A;  5LCH A;  4JO0 A;  2YNT A;  3VQZ A;  2VW8 A;  3ZR9 A;  3I14 A;  3IEK A;  4TZF A;  4C1G A;  2WHG A;  2Y8A A;  2FU6 A;  5A0T A;  3R2U A;  2BFZ A;  4EY2 A;  3I15 A;  1QH5 A;  3IOG A;  4NQ2 A;  1VME A;  4RAW A;  1KR3 A;  4UWO B;  3KNS A;  2E7Y A;  4TZB A;  5FQB A;  5EV6 A;  4J5F A;  5K0W A;  3SPU A;  3PY6 A;  4C1F A;  1YCH A;  4Z7R A;  4ZO2 A;  1BC2 A;  4C1H A;  5B15 A;  3IOF A;  3JXP A;  2P18 A;  4D1W A;  2BG2 A;  3VPE A;  5EH9 A;  2WRS A;  3PY5 A;  5ACU A;  4TYT A;  5K4M A;  5IQK A;  4TZE A;  4NQ5 A;  5K4K A;  3BC2 A;  2NYP A;  4GYQ A;  3TP9 A;  3X2Y A;  1A7T A;  5KIL A;  3KL7 A;  4J5H A;  2BTN A;  4UWP B;  3SBL A;  4LE6 A;  5ACS A;  3A4Y A;  5EW0 A;  3DHC A;  3DHB A;  1JT1 A;  3KNR A;  1WRA A;  2XF4 A;  5LM6 A;  4ZNB A;  4ZO3 A;  2P97 A;  2BG8 B;  4AWY B;  2BR6 A;  3AF6 A;  5AYA A;  2OHI A;  1SML A;  2Q42 A;  1WUO A;  4RM5 A;  2QDS A;  4C09 A;  4D1T A;  2BG7 A;  3ZWF A;  2WYM C;  4BZ3 A;  5HIP A;  2I7V A;  2XR1 A;  5B3R A;  3WXC A;  3T9M A;  4HL1 A;  3SFP A;  2NXA A;  5LS3 A;  4TYF A;  2BFL A;  2FK6 A;  1BMC A;  4UWS B;  4AX0 B;  4DIK A;  2FU8 A;  1ZTC A;  5EVK A;  5LCF A;  3IE1 A;  5A87 A;  4KEP A;  4EFZ A;  4F6H A;  4EYF A;  1BVT A;  2M5D A;  3X30 A;  1MQO A;  5ACQ A;  1YCF A;  1YCG A;  5EVD A;  2GFK A;  2NZE A;  4RL2 A;  1KO3 A;  2QIN A;  1XTO A;  4FR7 A;  5LCA A;  4YSL A;  2BGA A;  4AX1 B;  5FQC A;  2P1E A;  5ACP A;  2YNW A;  3IE2 A;  1ZKP A;  3SW3 A;  5HIS A;  3MD7 A;  4UBQ A;  3F9O A;  4PVT A;  2Y8B A;  4XUK A;  2AZ4 A;  2GCU A;  3SD9 A;  1X8G A;  3I13 A;  2GFJ A;  3X2X A;  2OHJ A;  2H6A A;  5A5Z A;  3FCZ A;  3DH8 A;  1X8I A;  4RL0 A;  5HIO A;  4C1D A;  5HH6 A;  1DD6 A;  4O98 A;  5ACV A;  5EWA A;  5DPX A;  1JJE A;  5ACX A;  3QH8 A;  4D1U A;  1L9Y A;  1P9E A;  4D02 A;  4U4L A;  3DHA A;  2I7X A;  1ZNB A;  2BMI A;  1KO2 A;  3I0V A;  3RKJ A;  2YNV B;  2AIO A;  3AJ3 A;  4TZ9 A;  4NQ6 A;  4EXY A;  3Q6V A;  2BIB A;  4YSK A;  2BG8 A;  5HH4 A;  2A7M A;  2Q0I A;  4Z67 A;  4EYL A;  4C1E A;  2Y87 A;  3AF5 A;  4PVO A;  3ZNB A;  1HLK A;  2FHX B;  1DXK A;  4GCW A;  2GKL A;  3X2Z A;  4GYU A;  3P2U A;  5FQA A;  2QJS A;  4DIL A;  1DDK A;  5AHR A;  5HIQ A;  5HH5 A;  2ZZI A;  2BFZ B;  4ZEJ A;  3BV6 A;  4EYB A;  4XWW A;  1X8H A;  3FAI A;  2YCB A;  4Z5Z A;  3PG4 A;  3BK1 A;  2NZF A;  4BP0 A;  3T3N A;  3ZQ4 A;  2BG6 A;  5AXO A;  4NQ4 A;  4D1V A;  4RBS A;  5LMC A;  3L6N A;  2FU9 A;  2CBN A;  2DOO A;  2HB9 A;  3BK2 A;  5KIK A;  3IDZ A;  5K4N A;  4V0H A;  5AXR A;  1VGN A;  4C1C A;  4F6Z A;  4YSB A;  3LVZ A;  5EHT A;  4AD9 A;  2FM6 A;  4Z60 A;  3S0Z A;  5ACR A;  5LSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...