3JXPA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
304
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGRMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structure of PqqB from Pseudomonas putida at 2.2 A resolution
doi rcsb
source organism Pseudomonas putida
molecule tags Biosynthetic protein
total genus 101
structure length 304
sequence length 305
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3jxpA00
5HIPA 4WD6A 1WUPA 4XWTA 2ZO4A 2QDSA 2BR6A 5LCFA 4EYFA 5LSCA 4C1CA 1YCHA 4V0HA 4NQ6A 2NXAA 4DILA 4RAWA 4EY2A 2BIBA 2NZFA 3DHCA 3SBLA 4J5FA 2BFKA 3LVZA 3I13A 1X8IA 4YSLA 4RL2A 4KEPA 5KIKA 3BV6A 5EHTA 3P2UA 5EVBA 2GFKA 3IOFA 3T9MA 1DXKA 1JJEA 3S0ZA 4UAMA 1DD6A 5A0VA 4TZFA 2M5DA 4NQ4A 2GFJA 1WRAA 5K4NA 4YSBA 3X2XA 4D1UA 5ACWA 1Y44A 4D1VA 5EV8A 2I7XA 4AWYB 3RKJA 4FSBA 4O98A 3KNSA 4JO0A 5HH6A 4GYQA 5B3RA 4C09A 3IELA 3JXPA 3ZNBA 5K4KA 3VPEA 5A0TA 5ACQA 4HKYA 5HH4A 5A5ZA 2FM6A 4RBSA 5AHRA 5EH9A 2YNVB 3I0VA 4YSKA 4UWRB 1P9EA 4XUKA 1QH5A 5FQAA 4J5HA 4P62A 2QDTA 4AX1B 3SD9A 2FHXA 4NQ2A 4RM5A 5LE1A 5ACVA 5HISA 1WW1A 2FK6A 2BMIA 2YZ3A 2DKFA 5AEBA 1HLKA 2ZZIA 5K4MA 4NQ5A 2WHGA 4BZ3A 5ACSA 2CBNA 1YCGA 5LMCA 3RKKA 1XM8A 5LM6A 2NYPA 2WRSA 4XWWA 1X8GA 5EVDA 3IE1A 2I7TA 1JT1A 2P97A 4Z5ZA 2Y8BA 4PVOA 4C1EA 3ZQ4A 5EVKA 3ESHA 5KILA 4UWPB 3BK1A 5ACRA 5LCHA 1SMLA 2YNTA 5HH5A 2Q0JA 2HB9A 2A7MA 3PY5A 4F6ZA 2BFZA 4TZBA 1VMEA 3FAIA 4UA4A 3IDZA 3DHAA 1JJTA 1DDKA 1BMCA 5K0WA 1A7TA 1X8HA 5EWAA 1WUOA 5ACTA 2Y87A 2Q0IA 5AHOA 4GCWA 3BC2A 3ZR9A 3F9OA 2BGAA 4RL0A 4ZO2A 3R2UA 5DPXA 2GKLA 3KNRA 3AF5A 4D02A 5IQKA 4UWOB 2H6AA 4EXYA 3T3NA 2QEDA 2FU6A 3DHBA 4Z60A 4CHLA 2BFLA 1K07A 2XF4A 2BFZB 2OHHA 3I11A 3VQZA 5LLDA 2AIOA 3G1PA 3WXCA 4Z67A 2R2DA 4PVTA 2BC2A 1VGNA 4AX0B 5EW0A 3IEKA 2ZNBA 2ZWRA 3SFPA 2NZEA 1ZKPA 2VW8A 4Z7RA 4EFZA 1KO3A 4C1DA 2P4ZA 4ZO3A 3ADRA 3TP9A 3X30A 1XTOA 3ZWFA 2GMNA 4HL1A 2OHIA 2Y8AA 4EYLA 4C1FA 5ACXA 5LS3A 5AXOA 3SW3A 5AYAA 4HL2A 4H0DA 2I7VA 3RPCA 3SPUA 3X2ZA 3I14A 2FHXB 2P18A 4TZ9A 4ZEJA 3L6NA 2YNWA 1QH3A 4UWSB 2FU9A 2WYLA 3SRXA 1KO2A 5B15A 2BG2A 5FQCA 2OHJA 2Q9UA 5ACPA 3BK2A 2GCUA 2UYXA 4F6HA 3DH8A 2QINA 5EV6A 1E5DA 2E7YA 4EXSA 2M5CA 5FQBA 4D1TA 1M2XA 3T3OA 2YNVA 2AZ4A 1L9YA 5B1UA 3IE2A 4C1HA 4C1GA 4GYUA 2YNTB 3QH8A 3I15A 2BTNA 2P1EA 4KEQA 1MQOA 4DIKA 2WYMA 3KL7A 2BG8A 5LCAA 1VJNA 4AD9A 4BP0A 2DOOA 3Q6VA 1BC2A 4FR7A 1A8TA 3PG4A 2Q42A 2BG7A 1YCFA 2QJSA 2FU8A 3FCZA 2YCBA 4EYBA 5A87A 3IOGA 3X2YA 3AJ3A 3IEMA 4TYFA 4TYTA 5HIOA 4D1WA 1ZNBA 2WYMC 3H3EA 3AF6A 4U4LA 4AWZA 3MD7A 2YNUA 2XR1A 5AXRA 2BG8B 3IE0A 4B87A 4UBQA 4FEKA 1KR3A 4LE6A 4RAMA 5HIQA 1BVTA 5ACUA 2BG6A 2FU7A 4Z6XA 3A4YA 4TZEA 3PY6A 4ZNBA 4Z5YA 1ZTCA
chains in the Genus database with same CATH superfamily
5HIPA 4WD6A 1WUPA 4XWTA 2ZO4A 2QDSA 2BR6A 5LCFA 4EYFA 5LSCA 4C1CA 1YCHA 4V0HA 4NQ6A 2NXAA 4DILA 4RAWA 4EY2A 2BIBA 2NZFA 3DHCA 3SBLA 4J5FA 2BFKA 3LVZA 3I13A 1X8IA 4YSLA 4RL2A 4KEPA 5KIKA 3BV6A 5EHTA 3P2UA 5EVBA 2GFKA 3IOFA 3T9MA 1DXKA 1JJEA 3S0ZA 4UAMA 1DD6A 2CFUA 5A0VA 4TZFA 2M5DA 4NQ4A 2GFJA 1WRAA 5K4NA 4YSBA 3X2XA 4D1UA 5ACWA 1Y44A 4D1VA 5EV8A 2I7XA 4AWYB 3RKJA 4FSBA 4O98A 4PDXA 3KNSA 4JO0A 5HH6A 4GYQA 5B3RA 4C09A 3IELA 3JXPA 3ZNBA 5K4KA 3VPEA 5A0TA 5ACQA 4HKYA 5HH4A 5A5ZA 2FM6A 4RBSA 5AHRA 5EH9A 2YNVB 3I0VA 4YSKA 4UWRB 1P9EA 2CG3A 4XUKA 1QH5A 5FQAA 4J5HA 4P62A 2QDTA 4AX1B 3SD9A 2FHXA 4NQ2A 4RM5A 5LE1A 5ACVA 5HISA 1WW1A 2FK6A 2BMIA 2YZ3A 2DKFA 5AEBA 1HLKA 2ZZIA 5K4MA 4NQ5A 2WHGA 4AV7A 4BZ3A 5ACSA 2CBNA 1YCGA 5LMCA 3RKKA 1XM8A 5LM6A 2NYPA 2WRSA 4XWWA 1X8GA 5EVDA 3IE1A 2I7TA 1JT1A 2P97A 4Z5ZA 2Y8BA 4PVOA 4C1EA 3ZQ4A 5EVKA 3ESHA 5KILA 4UWPB 3BK1A 5ACRA 5LCHA 1SMLA 2YNTA 5HH5A 2Q0JA 2HB9A 2A7MA 3PY5A 4F6ZA 2BFZA 4TZBA 1VMEA 3FAIA 4UA4A 3IDZA 3DHAA 1JJTA 1DDKA 1BMCA 5K0WA 1A7TA 1X8HA 5EWAA 1WUOA 5ACTA 2CG2A 2Y87A 2Q0IA 5AHOA 4GCWA 3BC2A 4AXHA 3ZR9A 3F9OA 2BGAA 4RL0A 4ZO2A 3R2UA 5DPXA 2GKLA 3KNRA 3AF5A 4D02A 5IQKA 4UWOB 2H6AA 4EXYA 3T3NA 2QEDA 2FU6A 3DHBA 4Z60A 4CHLA 5AIJA 2BFLA 1K07A 2XF4A 2BFZB 2OHHA 3I11A 3VQZA 5LLDA 2AIOA 3G1PA 3WXCA 4Z67A 2R2DA 4PVTA 2BC2A 1VGNA 4AX0B 5EW0A 3IEKA 2ZNBA 2ZWRA 3SFPA 2NZEA 1ZKPA 2VW8A 4Z7RA 4EFZA 5AJLA 1KO3A 4C1DA 2P4ZA 4ZO3A 3ADRA 3TP9A 3X30A 1XTOA 3ZWFA 2GMNA 4HL1A 2OHIA 2Y8AA 4EYLA 4C1FA 5ACXA 5LS3A 5AXOA 3SW3A 5AYAA 2CFZA 4HL2A 2YHEA 4H0DA 2I7VA 3RPCA 3SPUA 3X2ZA 3I14A 2FHXB 2P18A 4TZ9A 4ZEJA 3L6NA 2YNWA 1QH3A 4UWSB 2FU9A 2WYLA 3SRXA 5A23A 1KO2A 5B15A 2BG2A 5FQCA 2OHJA 2Q9UA 5ACPA 3BK2A 2GCUA 2UYXA 4F6HA 3DH8A 2QINA 5EV6A 1E5DA 2E7YA 4EXSA 2M5CA 5FQBA 4D1TA 1M2XA 3T3OA 2YNVA 2AZ4A 1L9YA 5B1UA 3IE2A 4C1HA 4C1GA 4GYUA 2YNTB 3QH8A 3I15A 2BTNA 2P1EA 4KEQA 1MQOA 4DIKA 2WYMA 3KL7A 2BG8A 5LCAA 1VJNA 4AD9A 4BP0A 2DOOA 3Q6VA 1BC2A 4FR7A 1A8TA 3PG4A 2Q42A 2BG7A 1YCFA 2QJSA 2FU8A 3FCZA 2YCBA 4EYBA 5A87A 3X2YA 3IOGA 3AJ3A 3IEMA 4NURA 4TYFA 4TYTA 5HIOA 4D1WA 1ZNBA 2WYMC 3H3EA 3AF6A 4U4LA 4AWZA 3MD7A 2YNUA 2XR1A 5AXRA 2BG8B 3IE0A 4B87A 4UBQA 4FEKA 1KR3A 4LE6A 4RAMA 5HIQA 1BVTA 5ACUA 2BG6A 2FU7A 4Z6XA 3A4YA 4TZEA 3PY6A 4ZNBA 4Z5YA 1ZTCA
chains in the Genus database with same CATH topology
5HIPA 4WD6A 1WUPA 4XWTA 2ZO4A 2QDSA 2BR6A 5LCFA 4EYFA 5LSCA 4C1CA 1YCHA 4V0HA 4NQ6A 2NXAA 4DILA 4RAWA 4EY2A 2BIBA 2NZFA 3DHCA 3SBLA 4J5FA 2BFKA 3LVZA 3I13A 1X8IA 4YSLA 4RL2A 4KEPA 5KIKA 3BV6A 5EHTA 3P2UA 5EVBA 2GFKA 3IOFA 3T9MA 1DXKA 1JJEA 3S0ZA 4UAMA 1DD6A 5A0VA 4TZFA 2M5DA 4NQ4A 2GFJA 1WRAA 5K4NA 4YSBA 3X2XA 4D1UA 5ACWA 1Y44A 4D1VA 5EV8A 2I7XA 4AWYB 3RKJA 4FSBA 4O98A 3KNSA 4JO0A 5HH6A 4GYQA 5B3RA 4C09A 3IELA 3JXPA 3ZNBA 5K4KA 3VPEA 5A0TA 5ACQA 4HKYA 5HH4A 5A5ZA 2FM6A 4RBSA 5AHRA 5EH9A 2YNVB 3I0VA 4YSKA 4UWRB 1P9EA 4XUKA 1QH5A 5FQAA 4J5HA 4P62A 2QDTA 4AX1B 3SD9A 2FHXA 4NQ2A 4RM5A 5LE1A 5ACVA 5HISA 1WW1A 2FK6A 2BMIA 2YZ3A 2DKFA 5AEBA 1HLKA 2ZZIA 5K4MA 4NQ5A 2WHGA 4BZ3A 5ACSA 2CBNA 1YCGA 5LMCA 3RKKA 1XM8A 5LM6A 2NYPA 2WRSA 4XWWA 1X8GA 5EVDA 3IE1A 2I7TA 1JT1A 2P97A 4Z5ZA 2Y8BA 4PVOA 4C1EA 3ZQ4A 5EVKA 3ESHA 5KILA 4UWPB 3BK1A 5ACRA 5LCHA 1SMLA 2YNTA 5HH5A 2Q0JA 2HB9A 2A7MA 3PY5A 4F6ZA 2BFZA 4TZBA 1VMEA 3FAIA 4UA4A 3IDZA 3DHAA 1JJTA 1DDKA 1BMCA 5K0WA 1A7TA 1X8HA 5EWAA 1WUOA 5ACTA 2Y87A 2Q0IA 5AHOA 4GCWA 3BC2A 3ZR9A 3F9OA 2BGAA 4RL0A 4ZO2A 3R2UA 5DPXA 2GKLA 3KNRA 3AF5A 4D02A 5IQKA 4UWOB 2H6AA 4EXYA 3T3NA 2QEDA 2FU6A 3DHBA 4Z60A 4CHLA 2BFLA 1K07A 2XF4A 2BFZB 2OHHA 3I11A 3VQZA 5LLDA 2AIOA 3G1PA 3WXCA 4Z67A 2R2DA 4PVTA 2BC2A 1VGNA 4AX0B 5EW0A 3IEKA 2ZNBA 2ZWRA 3SFPA 2NZEA 1ZKPA 2VW8A 4Z7RA 4EFZA 1KO3A 4C1DA 2P4ZA 4ZO3A 3ADRA 3TP9A 3X30A 1XTOA 3ZWFA 2GMNA 4HL1A 2OHIA 2Y8AA 4EYLA 4C1FA 5ACXA 5LS3A 5AXOA 3SW3A 5AYAA 4HL2A 4H0DA 2I7VA 3RPCA 3SPUA 3X2ZA 3I14A 2FHXB 2P18A 4TZ9A 4ZEJA 3L6NA 2YNWA 1QH3A 4UWSB 2FU9A 2WYLA 3SRXA 1KO2A 5B15A 2BG2A 5FQCA 2OHJA 2Q9UA 5ACPA 3BK2A 2GCUA 2UYXA 4F6HA 3DH8A 2QINA 5EV6A 1E5DA 2E7YA 4EXSA 2M5CA 5FQBA 4D1TA 1M2XA 3T3OA 2YNVA 2AZ4A 1L9YA 5B1UA 3IE2A 4C1HA 4C1GA 4GYUA 2YNTB 3QH8A 3I15A 2BTNA 2P1EA 4KEQA 1MQOA 4DIKA 2WYMA 3KL7A 2BG8A 5LCAA 1VJNA 4AD9A 4BP0A 2DOOA 3Q6VA 1BC2A 4FR7A 1A8TA 3PG4A 2Q42A 2BG7A 1YCFA 2QJSA 2FU8A 3FCZA 2YCBA 4EYBA 5A87A 3IOGA 3X2YA 3AJ3A 3IEMA 4TYFA 4TYTA 5HIOA 4D1WA 1ZNBA 2WYMC 3H3EA 3AF6A 4U4LA 4AWZA 3MD7A 2YNUA 2XR1A 5AXRA 2BG8B 3IE0A 4B87A 4UBQA 4FEKA 1KR3A 4LE6A 4RAMA 5HIQA 1BVTA 5ACUA 2BG6A 2FU7A 4Z6XA 3A4YA 4TZEA 3PY6A 4ZNBA 4Z5YA 1ZTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HIP A;  4WD6 A;  1WUP A;  4XWT A;  2ZO4 A;  2QDS A;  2BR6 A;  5LCF A;  4EYF A;  5LSC A;  4C1C A;  1YCH A;  4V0H A;  4NQ6 A;  2NXA A;  4DIL A;  4RAW A;  4EY2 A;  2BIB A;  2NZF A;  3DHC A;  3SBL A;  4J5F A;  2BFK A;  3LVZ A;  3I13 A;  1X8I A;  4YSL A;  4RL2 A;  4KEP A;  5KIK A;  3BV6 A;  5EHT A;  3P2U A;  5EVB A;  2GFK A;  3IOF A;  3T9M A;  1DXK A;  1JJE A;  3S0Z A;  4UAM A;  1DD6 A;  5A0V A;  4TZF A;  2M5D A;  4NQ4 A;  2GFJ A;  1WRA A;  5K4N A;  4YSB A;  3X2X A;  4D1U A;  5ACW A;  1Y44 A;  4D1V A;  5EV8 A;  2I7X A;  4AWY B;  3RKJ A;  4FSB A;  4O98 A;  3KNS A;  4JO0 A;  5HH6 A;  4GYQ A;  5B3R A;  4C09 A;  3IEL A;  3JXP A;  3ZNB A;  5K4K A;  3VPE A;  5A0T A;  5ACQ A;  4HKY A;  5HH4 A;  5A5Z A;  2FM6 A;  4RBS A;  5AHR A;  5EH9 A;  2YNV B;  3I0V A;  4YSK A;  4UWR B;  1P9E A;  4XUK A;  1QH5 A;  5FQA A;  4J5H A;  4P62 A;  2QDT A;  4AX1 B;  3SD9 A;  2FHX A;  4NQ2 A;  4RM5 A;  5LE1 A;  5ACV A;  5HIS A;  1WW1 A;  2FK6 A;  2BMI A;  2YZ3 A;  2DKF A;  5AEB A;  1HLK A;  2ZZI A;  5K4M A;  4NQ5 A;  2WHG A;  4BZ3 A;  5ACS A;  2CBN A;  1YCG A;  5LMC A;  3RKK A;  1XM8 A;  5LM6 A;  2NYP A;  2WRS A;  4XWW A;  1X8G A;  5EVD A;  3IE1 A;  2I7T A;  1JT1 A;  2P97 A;  4Z5Z A;  2Y8B A;  4PVO A;  4C1E A;  3ZQ4 A;  5EVK A;  3ESH A;  5KIL A;  4UWP B;  3BK1 A;  5ACR A;  5LCH A;  1SML A;  2YNT A;  5HH5 A;  2Q0J A;  2HB9 A;  2A7M A;  3PY5 A;  4F6Z A;  2BFZ A;  4TZB A;  1VME A;  3FAI A;  4UA4 A;  3IDZ A;  3DHA A;  1JJT A;  1DDK A;  1BMC A;  5K0W A;  1A7T A;  1X8H A;  5EWA A;  1WUO A;  5ACT A;  2Y87 A;  2Q0I A;  5AHO A;  4GCW A;  3BC2 A;  3ZR9 A;  3F9O A;  2BGA A;  4RL0 A;  4ZO2 A;  3R2U A;  5DPX A;  2GKL A;  3KNR A;  3AF5 A;  4D02 A;  5IQK A;  4UWO B;  2H6A A;  4EXY A;  3T3N A;  2QED A;  2FU6 A;  3DHB A;  4Z60 A;  4CHL A;  2BFL A;  1K07 A;  2XF4 A;  2BFZ B;  2OHH A;  3I11 A;  3VQZ A;  5LLD A;  2AIO A;  3G1P A;  3WXC A;  4Z67 A;  2R2D A;  4PVT A;  2BC2 A;  1VGN A;  4AX0 B;  5EW0 A;  3IEK A;  2ZNB A;  2ZWR A;  3SFP A;  2NZE A;  1ZKP A;  2VW8 A;  4Z7R A;  4EFZ A;  1KO3 A;  4C1D A;  2P4Z A;  4ZO3 A;  3ADR A;  3TP9 A;  3X30 A;  1XTO A;  3ZWF A;  2GMN A;  4HL1 A;  2OHI A;  2Y8A A;  4EYL A;  4C1F A;  5ACX A;  5LS3 A;  5AXO A;  3SW3 A;  5AYA A;  4HL2 A;  4H0D A;  2I7V A;  3RPC A;  3SPU A;  3X2Z A;  3I14 A;  2FHX B;  2P18 A;  4TZ9 A;  4ZEJ A;  3L6N A;  2YNW A;  1QH3 A;  4UWS B;  2FU9 A;  2WYL A;  3SRX A;  1KO2 A;  5B15 A;  2BG2 A;  5FQC A;  2OHJ A;  2Q9U A;  5ACP A;  3BK2 A;  2GCU A;  2UYX A;  4F6H A;  3DH8 A;  2QIN A;  5EV6 A;  1E5D A;  2E7Y A;  4EXS A;  2M5C A;  5FQB A;  4D1T A;  1M2X A;  3T3O A;  2YNV A;  2AZ4 A;  1L9Y A;  5B1U A;  3IE2 A;  4C1H A;  4C1G A;  4GYU A;  2YNT B;  3QH8 A;  3I15 A;  2BTN A;  2P1E A;  4KEQ A;  1MQO A;  4DIK A;  2WYM A;  3KL7 A;  2BG8 A;  5LCA A;  1VJN A;  4AD9 A;  4BP0 A;  2DOO A;  3Q6V A;  1BC2 A;  4FR7 A;  1A8T A;  3PG4 A;  2Q42 A;  2BG7 A;  1YCF A;  2QJS A;  2FU8 A;  3FCZ A;  2YCB A;  4EYB A;  5A87 A;  3IOG A;  3X2Y A;  3AJ3 A;  3IEM A;  4TYF A;  4TYT A;  5HIO A;  4D1W A;  1ZNB A;  2WYM C;  3H3E A;  3AF6 A;  4U4L A;  4AWZ A;  3MD7 A;  2YNU A;  2XR1 A;  5AXR A;  2BG8 B;  3IE0 A;  4B87 A;  4UBQ A;  4FEK A;  1KR3 A;  4LE6 A;  4RAM A;  5HIQ A;  1BVT A;  5ACU A;  2BG6 A;  2FU7 A;  4Z6X A;  3A4Y A;  4TZE A;  3PY6 A;  4ZNB A;  4Z5Y A;  1ZTC A; 
#chains in the Genus database with same CATH topology
 5HIP A;  4WD6 A;  1WUP A;  4XWT A;  2ZO4 A;  2QDS A;  2BR6 A;  5LCF A;  4EYF A;  5LSC A;  4C1C A;  1YCH A;  4V0H A;  4NQ6 A;  2NXA A;  4DIL A;  4RAW A;  4EY2 A;  2BIB A;  2NZF A;  3DHC A;  3SBL A;  4J5F A;  2BFK A;  3LVZ A;  3I13 A;  1X8I A;  4YSL A;  4RL2 A;  4KEP A;  5KIK A;  3BV6 A;  5EHT A;  3P2U A;  5EVB A;  2GFK A;  3IOF A;  3T9M A;  1DXK A;  1JJE A;  3S0Z A;  4UAM A;  1DD6 A;  2CFU A;  5A0V A;  4TZF A;  2M5D A;  4NQ4 A;  2GFJ A;  1WRA A;  5K4N A;  4YSB A;  3X2X A;  4D1U A;  5ACW A;  1Y44 A;  4D1V A;  5EV8 A;  2I7X A;  4AWY B;  3RKJ A;  4FSB A;  4O98 A;  4PDX A;  3KNS A;  4JO0 A;  5HH6 A;  4GYQ A;  5B3R A;  4C09 A;  3IEL A;  3JXP A;  3ZNB A;  5K4K A;  3VPE A;  5A0T A;  5ACQ A;  4HKY A;  5HH4 A;  5A5Z A;  2FM6 A;  4RBS A;  5AHR A;  5EH9 A;  2YNV B;  3I0V A;  4YSK A;  4UWR B;  1P9E A;  2CG3 A;  4XUK A;  1QH5 A;  5FQA A;  4J5H A;  4P62 A;  2QDT A;  4AX1 B;  3SD9 A;  2FHX A;  4NQ2 A;  4RM5 A;  5LE1 A;  5ACV A;  5HIS A;  1WW1 A;  2FK6 A;  2BMI A;  2YZ3 A;  2DKF A;  5AEB A;  1HLK A;  2ZZI A;  5K4M A;  4NQ5 A;  2WHG A;  4AV7 A;  4BZ3 A;  5ACS A;  2CBN A;  1YCG A;  5LMC A;  3RKK A;  1XM8 A;  5LM6 A;  2NYP A;  2WRS A;  4XWW A;  1X8G A;  5EVD A;  3IE1 A;  2I7T A;  1JT1 A;  2P97 A;  4Z5Z A;  2Y8B A;  4PVO A;  4C1E A;  3ZQ4 A;  5EVK A;  3ESH A;  5KIL A;  4UWP B;  3BK1 A;  5ACR A;  5LCH A;  1SML A;  2YNT A;  5HH5 A;  2Q0J A;  2HB9 A;  2A7M A;  3PY5 A;  4F6Z A;  2BFZ A;  4TZB A;  1VME A;  3FAI A;  4UA4 A;  3IDZ A;  3DHA A;  1JJT A;  1DDK A;  1BMC A;  5K0W A;  1A7T A;  1X8H A;  5EWA A;  1WUO A;  5ACT A;  2CG2 A;  2Y87 A;  2Q0I A;  5AHO A;  4GCW A;  3BC2 A;  4AXH A;  3ZR9 A;  3F9O A;  2BGA A;  4RL0 A;  4ZO2 A;  3R2U A;  5DPX A;  2GKL A;  3KNR A;  3AF5 A;  4D02 A;  5IQK A;  4UWO B;  2H6A A;  4EXY A;  3T3N A;  2QED A;  2FU6 A;  3DHB A;  4Z60 A;  4CHL A;  5AIJ A;  2BFL A;  1K07 A;  2XF4 A;  2BFZ B;  2OHH A;  3I11 A;  3VQZ A;  5LLD A;  2AIO A;  3G1P A;  3WXC A;  4Z67 A;  2R2D A;  4PVT A;  2BC2 A;  1VGN A;  4AX0 B;  5EW0 A;  3IEK A;  2ZNB A;  2ZWR A;  3SFP A;  2NZE A;  1ZKP A;  2VW8 A;  4Z7R A;  4EFZ A;  5AJL A;  1KO3 A;  4C1D A;  2P4Z A;  4ZO3 A;  3ADR A;  3TP9 A;  3X30 A;  1XTO A;  3ZWF A;  2GMN A;  4HL1 A;  2OHI A;  2Y8A A;  4EYL A;  4C1F A;  5ACX A;  5LS3 A;  5AXO A;  3SW3 A;  5AYA A;  2CFZ A;  4HL2 A;  2YHE A;  4H0D A;  2I7V A;  3RPC A;  3SPU A;  3X2Z A;  3I14 A;  2FHX B;  2P18 A;  4TZ9 A;  4ZEJ A;  3L6N A;  2YNW A;  1QH3 A;  4UWS B;  2FU9 A;  2WYL A;  3SRX A;  5A23 A;  1KO2 A;  5B15 A;  2BG2 A;  5FQC A;  2OHJ A;  2Q9U A;  5ACP A;  3BK2 A;  2GCU A;  2UYX A;  4F6H A;  3DH8 A;  2QIN A;  5EV6 A;  1E5D A;  2E7Y A;  4EXS A;  2M5C A;  5FQB A;  4D1T A;  1M2X A;  3T3O A;  2YNV A;  2AZ4 A;  1L9Y A;  5B1U A;  3IE2 A;  4C1H A;  4C1G A;  4GYU A;  2YNT B;  3QH8 A;  3I15 A;  2BTN A;  2P1E A;  4KEQ A;  1MQO A;  4DIK A;  2WYM A;  3KL7 A;  2BG8 A;  5LCA A;  1VJN A;  4AD9 A;  4BP0 A;  2DOO A;  3Q6V A;  1BC2 A;  4FR7 A;  1A8T A;  3PG4 A;  2Q42 A;  2BG7 A;  1YCF A;  2QJS A;  2FU8 A;  3FCZ A;  2YCB A;  4EYB A;  5A87 A;  3X2Y A;  3IOG A;  3AJ3 A;  3IEM A;  4NUR A;  4TYF A;  4TYT A;  5HIO A;  4D1W A;  1ZNB A;  2WYM C;  3H3E A;  3AF6 A;  4U4L A;  4AWZ A;  3MD7 A;  2YNU A;  2XR1 A;  5AXR A;  2BG8 B;  3IE0 A;  4B87 A;  4UBQ A;  4FEK A;  1KR3 A;  4LE6 A;  4RAM A;  5HIQ A;  1BVT A;  5ACU A;  2BG6 A;  2FU7 A;  4Z6X A;  3A4Y A;  4TZE A;  3PY6 A;  4ZNB A;  4Z5Y A;  1ZTC A; 
#chains in the Genus database with same CATH homology
 5HIP A;  4WD6 A;  1WUP A;  4XWT A;  2ZO4 A;  2QDS A;  2BR6 A;  5LCF A;  4EYF A;  5LSC A;  4C1C A;  1YCH A;  4V0H A;  4NQ6 A;  2NXA A;  4DIL A;  4RAW A;  4EY2 A;  2BIB A;  2NZF A;  3DHC A;  3SBL A;  4J5F A;  2BFK A;  3LVZ A;  3I13 A;  1X8I A;  4YSL A;  4RL2 A;  4KEP A;  5KIK A;  3BV6 A;  5EHT A;  3P2U A;  5EVB A;  2GFK A;  3IOF A;  3T9M A;  1DXK A;  1JJE A;  3S0Z A;  4UAM A;  1DD6 A;  5A0V A;  4TZF A;  2M5D A;  4NQ4 A;  2GFJ A;  1WRA A;  5K4N A;  4YSB A;  3X2X A;  4D1U A;  5ACW A;  1Y44 A;  4D1V A;  5EV8 A;  2I7X A;  4AWY B;  3RKJ A;  4FSB A;  4O98 A;  3KNS A;  4JO0 A;  5HH6 A;  4GYQ A;  5B3R A;  4C09 A;  3IEL A;  3JXP A;  3ZNB A;  5K4K A;  3VPE A;  5A0T A;  5ACQ A;  4HKY A;  5HH4 A;  5A5Z A;  2FM6 A;  4RBS A;  5AHR A;  5EH9 A;  2YNV B;  3I0V A;  4YSK A;  4UWR B;  1P9E A;  4XUK A;  1QH5 A;  5FQA A;  4J5H A;  4P62 A;  2QDT A;  4AX1 B;  3SD9 A;  2FHX A;  4NQ2 A;  4RM5 A;  5LE1 A;  5ACV A;  5HIS A;  1WW1 A;  2FK6 A;  2BMI A;  2YZ3 A;  2DKF A;  5AEB A;  1HLK A;  2ZZI A;  5K4M A;  4NQ5 A;  2WHG A;  4BZ3 A;  5ACS A;  2CBN A;  1YCG A;  5LMC A;  3RKK A;  1XM8 A;  5LM6 A;  2NYP A;  2WRS A;  4XWW A;  1X8G A;  5EVD A;  3IE1 A;  2I7T A;  1JT1 A;  2P97 A;  4Z5Z A;  2Y8B A;  4PVO A;  4C1E A;  3ZQ4 A;  5EVK A;  3ESH A;  5KIL A;  4UWP B;  3BK1 A;  5ACR A;  5LCH A;  1SML A;  2YNT A;  5HH5 A;  2Q0J A;  2HB9 A;  2A7M A;  3PY5 A;  4F6Z A;  2BFZ A;  4TZB A;  1VME A;  3FAI A;  4UA4 A;  3IDZ A;  3DHA A;  1JJT A;  1DDK A;  1BMC A;  5K0W A;  1A7T A;  1X8H A;  5EWA A;  1WUO A;  5ACT A;  2Y87 A;  2Q0I A;  5AHO A;  4GCW A;  3BC2 A;  3ZR9 A;  3F9O A;  2BGA A;  4RL0 A;  4ZO2 A;  3R2U A;  5DPX A;  2GKL A;  3KNR A;  3AF5 A;  4D02 A;  5IQK A;  4UWO B;  2H6A A;  4EXY A;  3T3N A;  2QED A;  2FU6 A;  3DHB A;  4Z60 A;  4CHL A;  2BFL A;  1K07 A;  2XF4 A;  2BFZ B;  2OHH A;  3I11 A;  3VQZ A;  5LLD A;  2AIO A;  3G1P A;  3WXC A;  4Z67 A;  2R2D A;  4PVT A;  2BC2 A;  1VGN A;  4AX0 B;  5EW0 A;  3IEK A;  2ZNB A;  2ZWR A;  3SFP A;  2NZE A;  1ZKP A;  2VW8 A;  4Z7R A;  4EFZ A;  1KO3 A;  4C1D A;  2P4Z A;  4ZO3 A;  3ADR A;  3TP9 A;  3X30 A;  1XTO A;  3ZWF A;  2GMN A;  4HL1 A;  2OHI A;  2Y8A A;  4EYL A;  4C1F A;  5ACX A;  5LS3 A;  5AXO A;  3SW3 A;  5AYA A;  4HL2 A;  4H0D A;  2I7V A;  3RPC A;  3SPU A;  3X2Z A;  3I14 A;  2FHX B;  2P18 A;  4TZ9 A;  4ZEJ A;  3L6N A;  2YNW A;  1QH3 A;  4UWS B;  2FU9 A;  2WYL A;  3SRX A;  1KO2 A;  5B15 A;  2BG2 A;  5FQC A;  2OHJ A;  2Q9U A;  5ACP A;  3BK2 A;  2GCU A;  2UYX A;  4F6H A;  3DH8 A;  2QIN A;  5EV6 A;  1E5D A;  2E7Y A;  4EXS A;  2M5C A;  5FQB A;  4D1T A;  1M2X A;  3T3O A;  2YNV A;  2AZ4 A;  1L9Y A;  5B1U A;  3IE2 A;  4C1H A;  4C1G A;  4GYU A;  2YNT B;  3QH8 A;  3I15 A;  2BTN A;  2P1E A;  4KEQ A;  1MQO A;  4DIK A;  2WYM A;  3KL7 A;  2BG8 A;  5LCA A;  1VJN A;  4AD9 A;  4BP0 A;  2DOO A;  3Q6V A;  1BC2 A;  4FR7 A;  1A8T A;  3PG4 A;  2Q42 A;  2BG7 A;  1YCF A;  2QJS A;  2FU8 A;  3FCZ A;  2YCB A;  4EYB A;  5A87 A;  3IOG A;  3X2Y A;  3AJ3 A;  3IEM A;  4TYF A;  4TYT A;  5HIO A;  4D1W A;  1ZNB A;  2WYM C;  3H3E A;  3AF6 A;  4U4L A;  4AWZ A;  3MD7 A;  2YNU A;  2XR1 A;  5AXR A;  2BG8 B;  3IE0 A;  4B87 A;  4UBQ A;  4FEK A;  1KR3 A;  4LE6 A;  4RAM A;  5HIQ A;  1BVT A;  5ACU A;  2BG6 A;  2FU7 A;  4Z6X A;  3A4Y A;  4TZE A;  3PY6 A;  4ZNB A;  4Z5Y A;  1ZTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...