3JXPA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
304
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGRMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structure of PqqB from Pseudomonas putida at 2.2 A resolution
doi rcsb
source organism Pseudomonas putida
total genus 101
structure length 304
sequence length 305
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3jxpA00
1VMEA 2M5DA 2ZZIA 1MQOA 2FU6A 3MD7A 5A0VA 3IOFA 2Q0IA 2QINA 4UWRB 4GCWA 2I7XA 1ZKPA 4TZ9A 1VJNA 2FU9A 3SRXA 2FHXA 1DDKA 3RKJA 5LCAA 5ACTA 2QEDA 2ZWRA 4P62A 5EW0A 4EYLA 3ZNBA 1YCFA 3F9OA 4C1EA 3SBLA 3KNRA 5HIOA 3BK2A 1BVTA 5AYAA 3SD9A 5K4KA 5EVDA 4AD9A 5FQCA 3DHCA 4TZBA 5AEBA 5EWAA 4RL2A 5EVBA 1YCGA 2YNUA 3BV6A 3T3OA 4Z5ZA 1Y44A 2BG8B 2GKLA 3PY5A 3SFPA 2QJSA 2BG7A 5FQBA 3T3NA 1HLKA 4Z6XA 2AZ4A 3AJ3A 3QH8A 5A87A 2A7MA 2NXAA 3R2UA 3TP9A 2P1EA 2H6AA 2YNTA 5LCHA 4C1CA 4TYTA 2BIBA 2FHXB 1KO2A 1A7TA 2OHIA 1P9EA 5K0WA 4UA4A 3ZR9A 4H0DA 3WXCA 4FEKA 1JJTA 5EHTA 2E7YA 3DH8A 4B87A 1XTOA 5HH4A 4C1HA 2Y8AA 3PG4A 3BC2A 2FU8A 2OHJA 1DXKA 3IE2A 5LCFA 3AF5A 4FSBA 1WRAA 5ACXA 5IQKA 3IEMA 1VGNA 4HKYA 4GYUA 2R2DA 2VW8A 3G1PA 2BTNA 4ZEJA 4EY2A 2Q9UA 4C09A 2NZFA 4AX0B 5AHRA 1BC2A 4UAMA 2GFJA 2BG2A 3IOGA 3AF6A 2QDSA 1YCHA 2YNTB 2FU7A 2XR1A 4RAMA 4Z5YA 4D1TA 2WYMA 2BFLA 4EFZA 5LS3A 5A0TA 1KO3A 4GYQA 3H3EA 4UWPB 1SMLA 2I7TA 4XUKA 4UWOB 5LSCA 1DD6A 2GMNA 4TZEA 4XWWA 2Y8BA 2YZ3A 4Z67A 3Q6VA 3FCZA 5LE1A 1X8IA 4F6HA 4PVOA 4RBSA 5HH5A 5AXRA 4AWZA 4HL1A 2BFZA 3IDZA 4O98A 4TYFA 3SPUA 1X8HA 2Q42A 3RPCA 4NQ5A 4NQ2A 4J5HA 3IE0A 3I0VA 5LM6A 1WUOA 2BGAA 3I14A 2FM6A 4FR7A 4BP0A 2M5CA 1ZNBA 2WYLA 2XF4A 4J5FA 5FQAA 2P4ZA 2CBNA 4KEQA 5AHOA 1QH3A 4C1FA 3BK1A 2YNVA 4ZO2A 4D1UA 5ACSA 2DOOA 4HL2A 5K4NA 3LVZA 5LLDA 2FK6A 2Y87A 5HISA 3VQZA 2WYMC 1JJEA 3DHBA 2BFKA 4AWYB 2P97A 5ACUA 2UYXA 4ZO3A 2BFZB 1ZTCA 5HH6A 4RL0A 4D02A 1E5DA 2YCBA 5K4MA 1QH5A 4XWTA 4CHLA 3FAIA 4EXYA 3IE1A 3I11A 4ZNBA 3KNSA 4EXSA 2BMIA 5HIQA 5B1UA 4BZ3A 2BG6A 5B15A 4JO0A 4DILA 4RAWA 4UBQA 2YNVB 4NQ4A 2YNWA 3IELA 4D1VA 3I13A 2BC2A 1L9YA 4LE6A 5EVKA 5EV8A 2BR6A 1X8GA 5ACQA 1XM8A 3I15A 2WHGA 3P2UA 3VPEA 5EV6A 4EYBA 2ZNBA 2HB9A 3JXPA 4WD6A 4DIKA 5DPXA 4PVTA 4NQ6A 4F6ZA 4EYFA 1BMCA 2NZEA 3PY6A 3ZWFA 2DKFA 3L6NA 4YSLA 2WRSA 5EH9A 2NYPA 3ADRA 3SW3A 2GCUA 5AXOA 2ZO4A 2QDTA 2I7VA 5HIPA 1WUPA 5ACVA 4D1WA 3T9MA 5ACPA 5A5ZA 5ACRA 2GFKA 4KEPA 3A4YA 3ESHA 2OHHA 4RM5A 3KL7A 1K07A 5B3RA 2Q0JA 4UWSB 5LMCA 1KR3A 4U4LA 3DHAA 1M2XA 2P18A 3X30A 5KILA 4YSBA 3IEKA 4YSKA 5KIKA 2AIOA 4C1GA 4AX1B 3RKKA 3S0ZA 1JT1A 2BG8A 3ZQ4A 4Z7RA 4V0HA 3X2YA 1A8TA 3X2ZA 5ACWA 3X2XA 1WW1A 4Z60A 4C1DA 4TZFA
chains in the Genus database with same CATH superfamily
2CG2A 1VMEA 2M5DA 2ZZIA 1MQOA 2FU6A 3MD7A 5A0VA 3IOFA 2Q0IA 2QINA 4UWRB 4GCWA 2I7XA 1ZKPA 4TZ9A 5A23A 1VJNA 2FU9A 3SRXA 2FHXA 1DDKA 3RKJA 5LCAA 5ACTA 2QEDA 2ZWRA 4P62A 5EW0A 4EYLA 3ZNBA 1YCFA 3F9OA 4C1EA 3SBLA 3KNRA 5HIOA 3BK2A 1BVTA 5AYAA 3SD9A 5K4KA 5EVDA 4AD9A 5FQCA 3DHCA 4TZBA 5AEBA 5EWAA 4RL2A 5EVBA 1YCGA 2YNUA 3BV6A 3T3OA 4Z5ZA 1Y44A 2BG8B 2GKLA 3PY5A 3SFPA 2QJSA 2BG7A 5FQBA 3T3NA 1HLKA 4Z6XA 2AZ4A 3AJ3A 3QH8A 5A87A 2A7MA 2NXAA 3R2UA 3TP9A 2P1EA 2H6AA 2YNTA 5LCHA 4C1CA 4TYTA 2BIBA 2FHXB 1KO2A 1A7TA 2OHIA 1P9EA 5K0WA 4UA4A 3ZR9A 4H0DA 3WXCA 4FEKA 1JJTA 5EHTA 2E7YA 3DH8A 4B87A 1XTOA 5HH4A 4C1HA 2Y8AA 3PG4A 3BC2A 2FU8A 2OHJA 1DXKA 3IE2A 5LCFA 3AF5A 4FSBA 1WRAA 5ACXA 5IQKA 3IEMA 1VGNA 4HKYA 4GYUA 2R2DA 2VW8A 3G1PA 2BTNA 4ZEJA 4EY2A 2Q9UA 4C09A 2NZFA 4AX0B 5AHRA 1BC2A 4UAMA 2GFJA 2BG2A 3IOGA 3AF6A 2QDSA 1YCHA 2YNTB 2FU7A 2XR1A 4RAMA 4Z5YA 4D1TA 2WYMA 2BFLA 4EFZA 5LS3A 5A0TA 1KO3A 4GYQA 3H3EA 4UWPB 1SMLA 2I7TA 4XUKA 4UWOB 5LSCA 1DD6A 2GMNA 4TZEA 4XWWA 2Y8BA 2YZ3A 4Z67A 3Q6VA 3FCZA 5LE1A 1X8IA 4F6HA 4PVOA 4RBSA 5HH5A 5AXRA 4AWZA 4HL1A 2BFZA 3IDZA 4O98A 4TYFA 3SPUA 1X8HA 2Q42A 3RPCA 4NQ5A 4NQ2A 4NURA 4J5HA 3IE0A 3I0VA 5LM6A 1WUOA 2BGAA 3I14A 2FM6A 4FR7A 4BP0A 4AV7A 2M5CA 1ZNBA 2WYLA 2XF4A 4J5FA 5FQAA 2P4ZA 2CBNA 4KEQA 5AHOA 1QH3A 4C1FA 3BK1A 2YNVA 4ZO2A 4D1UA 5ACSA 2DOOA 4HL2A 5K4NA 3LVZA 5LLDA 2FK6A 2Y87A 5HISA 3VQZA 2WYMC 1JJEA 3DHBA 2BFKA 4AWYB 2P97A 5ACUA 2CFUA 2UYXA 4ZO3A 2BFZB 1ZTCA 5HH6A 4RL0A 4D02A 1E5DA 2YCBA 2YHEA 5K4MA 1QH5A 4XWTA 5AIJA 4CHLA 3FAIA 4EXYA 3IE1A 3I11A 4ZNBA 3KNSA 4EXSA 2BMIA 5HIQA 5B1UA 4BZ3A 2BG6A 5B15A 4JO0A 4DILA 4RAWA 4UBQA 2YNVB 4NQ4A 2YNWA 3IELA 4D1VA 3I13A 2BC2A 4AXHA 1L9YA 4LE6A 5EVKA 5EV8A 2BR6A 1X8GA 5ACQA 1XM8A 3I15A 2WHGA 3P2UA 3VPEA 5AJLA 5EV6A 4EYBA 2ZNBA 2HB9A 3JXPA 4WD6A 4DIKA 5DPXA 4PVTA 4NQ6A 4F6ZA 4EYFA 1BMCA 2NZEA 2CFZA 3PY6A 3ZWFA 2DKFA 3L6NA 4YSLA 2WRSA 5EH9A 2NYPA 3ADRA 3SW3A 2GCUA 5AXOA 2ZO4A 2QDTA 2I7VA 5HIPA 1WUPA 5ACVA 4D1WA 3T9MA 5ACPA 5A5ZA 5ACRA 2GFKA 4KEPA 3A4YA 4PDXA 3ESHA 2OHHA 4RM5A 3KL7A 1K07A 5B3RA 2Q0JA 4UWSB 2CG3A 5LMCA 1KR3A 4U4LA 3DHAA 1M2XA 2P18A 3X30A 5KILA 4YSBA 3IEKA 4YSKA 5KIKA 2AIOA 4C1GA 4AX1B 3RKKA 3S0ZA 1JT1A 2BG8A 3ZQ4A 4Z7RA 4V0HA 3X2YA 1A8TA 3X2ZA 5ACWA 3X2XA 1WW1A 4Z60A 4C1DA 4TZFA
chains in the Genus database with same CATH topology
1VMEA 2M5DA 2ZZIA 1MQOA 2FU6A 3MD7A 5A0VA 3IOFA 2Q0IA 2QINA 4UWRB 4GCWA 2I7XA 1ZKPA 4TZ9A 1VJNA 2FU9A 3SRXA 2FHXA 1DDKA 3RKJA 5LCAA 5ACTA 2QEDA 2ZWRA 4P62A 5EW0A 4EYLA 3ZNBA 1YCFA 3F9OA 4C1EA 3SBLA 3KNRA 5HIOA 3BK2A 1BVTA 5AYAA 3SD9A 5K4KA 5EVDA 4AD9A 5FQCA 3DHCA 4TZBA 5AEBA 5EWAA 4RL2A 5EVBA 1YCGA 2YNUA 3BV6A 3T3OA 4Z5ZA 1Y44A 2BG8B 2GKLA 3PY5A 3SFPA 2QJSA 2BG7A 5FQBA 3T3NA 1HLKA 4Z6XA 2AZ4A 3AJ3A 3QH8A 5A87A 2A7MA 2NXAA 3R2UA 3TP9A 2P1EA 2H6AA 2YNTA 5LCHA 4C1CA 4TYTA 2BIBA 2FHXB 1KO2A 1A7TA 2OHIA 1P9EA 5K0WA 4UA4A 3ZR9A 4H0DA 3WXCA 4FEKA 1JJTA 5EHTA 2E7YA 3DH8A 4B87A 1XTOA 5HH4A 4C1HA 2Y8AA 3PG4A 3BC2A 2FU8A 2OHJA 1DXKA 3IE2A 5LCFA 3AF5A 4FSBA 1WRAA 5ACXA 5IQKA 3IEMA 1VGNA 4HKYA 4GYUA 2R2DA 2VW8A 3G1PA 2BTNA 4ZEJA 4EY2A 2Q9UA 4C09A 2NZFA 4AX0B 5AHRA 1BC2A 4UAMA 2GFJA 2BG2A 3IOGA 3AF6A 2QDSA 1YCHA 2YNTB 2FU7A 2XR1A 4RAMA 4Z5YA 4D1TA 2WYMA 2BFLA 4EFZA 5LS3A 5A0TA 1KO3A 4GYQA 3H3EA 4UWPB 1SMLA 2I7TA 4XUKA 4UWOB 5LSCA 1DD6A 2GMNA 4TZEA 4XWWA 2Y8BA 2YZ3A 4Z67A 3Q6VA 3FCZA 5LE1A 1X8IA 4F6HA 4PVOA 4RBSA 5HH5A 5AXRA 4AWZA 4HL1A 2BFZA 3IDZA 4O98A 4TYFA 3SPUA 1X8HA 2Q42A 3RPCA 4NQ5A 4NQ2A 4J5HA 3IE0A 3I0VA 5LM6A 1WUOA 2BGAA 3I14A 2FM6A 4FR7A 4BP0A 2M5CA 1ZNBA 2WYLA 2XF4A 4J5FA 5FQAA 2P4ZA 2CBNA 4KEQA 5AHOA 1QH3A 4C1FA 3BK1A 2YNVA 4ZO2A 4D1UA 5ACSA 2DOOA 4HL2A 5K4NA 3LVZA 5LLDA 2FK6A 2Y87A 5HISA 3VQZA 2WYMC 1JJEA 3DHBA 2BFKA 4AWYB 2P97A 5ACUA 2UYXA 4ZO3A 2BFZB 1ZTCA 5HH6A 4RL0A 4D02A 1E5DA 2YCBA 5K4MA 1QH5A 4XWTA 4CHLA 3FAIA 4EXYA 3IE1A 3I11A 4ZNBA 3KNSA 4EXSA 2BMIA 5HIQA 5B1UA 4BZ3A 2BG6A 5B15A 4JO0A 4DILA 4RAWA 4UBQA 2YNVB 4NQ4A 2YNWA 3IELA 4D1VA 3I13A 2BC2A 1L9YA 4LE6A 5EVKA 5EV8A 2BR6A 1X8GA 5ACQA 1XM8A 3I15A 2WHGA 3P2UA 3VPEA 5EV6A 4EYBA 2ZNBA 2HB9A 3JXPA 4WD6A 4DIKA 5DPXA 4PVTA 4NQ6A 4F6ZA 4EYFA 1BMCA 2NZEA 3PY6A 3ZWFA 2DKFA 3L6NA 4YSLA 2WRSA 5EH9A 2NYPA 3ADRA 3SW3A 2GCUA 5AXOA 2ZO4A 2QDTA 2I7VA 5HIPA 1WUPA 5ACVA 4D1WA 3T9MA 5ACPA 5A5ZA 5ACRA 2GFKA 4KEPA 3A4YA 3ESHA 2OHHA 4RM5A 3KL7A 1K07A 5B3RA 2Q0JA 4UWSB 5LMCA 1KR3A 4U4LA 3DHAA 1M2XA 2P18A 3X30A 5KILA 4YSBA 3IEKA 4YSKA 5KIKA 2AIOA 4C1GA 4AX1B 3RKKA 3S0ZA 1JT1A 2BG8A 3ZQ4A 4Z7RA 4V0HA 3X2YA 1A8TA 3X2ZA 5ACWA 3X2XA 1WW1A 4Z60A 4C1DA 4TZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VME A;  2M5D A;  2ZZI A;  1MQO A;  2FU6 A;  3MD7 A;  5A0V A;  3IOF A;  2Q0I A;  2QIN A;  4UWR B;  4GCW A;  2I7X A;  1ZKP A;  4TZ9 A;  1VJN A;  2FU9 A;  3SRX A;  2FHX A;  1DDK A;  3RKJ A;  5LCA A;  5ACT A;  2QED A;  2ZWR A;  4P62 A;  5EW0 A;  4EYL A;  3ZNB A;  1YCF A;  3F9O A;  4C1E A;  3SBL A;  3KNR A;  5HIO A;  3BK2 A;  1BVT A;  5AYA A;  3SD9 A;  5K4K A;  5EVD A;  4AD9 A;  5FQC A;  3DHC A;  4TZB A;  5AEB A;  5EWA A;  4RL2 A;  5EVB A;  1YCG A;  2YNU A;  3BV6 A;  3T3O A;  4Z5Z A;  1Y44 A;  2BG8 B;  2GKL A;  3PY5 A;  3SFP A;  2QJS A;  2BG7 A;  5FQB A;  3T3N A;  1HLK A;  4Z6X A;  2AZ4 A;  3AJ3 A;  3QH8 A;  5A87 A;  2A7M A;  2NXA A;  3R2U A;  3TP9 A;  2P1E A;  2H6A A;  2YNT A;  5LCH A;  4C1C A;  4TYT A;  2BIB A;  2FHX B;  1KO2 A;  1A7T A;  2OHI A;  1P9E A;  5K0W A;  4UA4 A;  3ZR9 A;  4H0D A;  3WXC A;  4FEK A;  1JJT A;  5EHT A;  2E7Y A;  3DH8 A;  4B87 A;  1XTO A;  5HH4 A;  4C1H A;  2Y8A A;  3PG4 A;  3BC2 A;  2FU8 A;  2OHJ A;  1DXK A;  3IE2 A;  5LCF A;  3AF5 A;  4FSB A;  1WRA A;  5ACX A;  5IQK A;  3IEM A;  1VGN A;  4HKY A;  4GYU A;  2R2D A;  2VW8 A;  3G1P A;  2BTN A;  4ZEJ A;  4EY2 A;  2Q9U A;  4C09 A;  2NZF A;  4AX0 B;  5AHR A;  1BC2 A;  4UAM A;  2GFJ A;  2BG2 A;  3IOG A;  3AF6 A;  2QDS A;  1YCH A;  2YNT B;  2FU7 A;  2XR1 A;  4RAM A;  4Z5Y A;  4D1T A;  2WYM A;  2BFL A;  4EFZ A;  5LS3 A;  5A0T A;  1KO3 A;  4GYQ A;  3H3E A;  4UWP B;  1SML A;  2I7T A;  4XUK A;  4UWO B;  5LSC A;  1DD6 A;  2GMN A;  4TZE A;  4XWW A;  2Y8B A;  2YZ3 A;  4Z67 A;  3Q6V A;  3FCZ A;  5LE1 A;  1X8I A;  4F6H A;  4PVO A;  4RBS A;  5HH5 A;  5AXR A;  4AWZ A;  4HL1 A;  2BFZ A;  3IDZ A;  4O98 A;  4TYF A;  3SPU A;  1X8H A;  2Q42 A;  3RPC A;  4NQ5 A;  4NQ2 A;  4J5H A;  3IE0 A;  3I0V A;  5LM6 A;  1WUO A;  2BGA A;  3I14 A;  2FM6 A;  4FR7 A;  4BP0 A;  2M5C A;  1ZNB A;  2WYL A;  2XF4 A;  4J5F A;  5FQA A;  2P4Z A;  2CBN A;  4KEQ A;  5AHO A;  1QH3 A;  4C1F A;  3BK1 A;  2YNV A;  4ZO2 A;  4D1U A;  5ACS A;  2DOO A;  4HL2 A;  5K4N A;  3LVZ A;  5LLD A;  2FK6 A;  2Y87 A;  5HIS A;  3VQZ A;  2WYM C;  1JJE A;  3DHB A;  2BFK A;  4AWY B;  2P97 A;  5ACU A;  2UYX A;  4ZO3 A;  2BFZ B;  1ZTC A;  5HH6 A;  4RL0 A;  4D02 A;  1E5D A;  2YCB A;  5K4M A;  1QH5 A;  4XWT A;  4CHL A;  3FAI A;  4EXY A;  3IE1 A;  3I11 A;  4ZNB A;  3KNS A;  4EXS A;  2BMI A;  5HIQ A;  5B1U A;  4BZ3 A;  2BG6 A;  5B15 A;  4JO0 A;  4DIL A;  4RAW A;  4UBQ A;  2YNV B;  4NQ4 A;  2YNW A;  3IEL A;  4D1V A;  3I13 A;  2BC2 A;  1L9Y A;  4LE6 A;  5EVK A;  5EV8 A;  2BR6 A;  1X8G A;  5ACQ A;  1XM8 A;  3I15 A;  2WHG A;  3P2U A;  3VPE A;  5EV6 A;  4EYB A;  2ZNB A;  2HB9 A;  3JXP A;  4WD6 A;  4DIK A;  5DPX A;  4PVT A;  4NQ6 A;  4F6Z A;  4EYF A;  1BMC A;  2NZE A;  3PY6 A;  3ZWF A;  2DKF A;  3L6N A;  4YSL A;  2WRS A;  5EH9 A;  2NYP A;  3ADR A;  3SW3 A;  2GCU A;  5AXO A;  2ZO4 A;  2QDT A;  2I7V A;  5HIP A;  1WUP A;  5ACV A;  4D1W A;  3T9M A;  5ACP A;  5A5Z A;  5ACR A;  2GFK A;  4KEP A;  3A4Y A;  3ESH A;  2OHH A;  4RM5 A;  3KL7 A;  1K07 A;  5B3R A;  2Q0J A;  4UWS B;  5LMC A;  1KR3 A;  4U4L A;  3DHA A;  1M2X A;  2P18 A;  3X30 A;  5KIL A;  4YSB A;  3IEK A;  4YSK A;  5KIK A;  2AIO A;  4C1G A;  4AX1 B;  3RKK A;  3S0Z A;  1JT1 A;  2BG8 A;  3ZQ4 A;  4Z7R A;  4V0H A;  3X2Y A;  1A8T A;  3X2Z A;  5ACW A;  3X2X A;  1WW1 A;  4Z60 A;  4C1D A;  4TZF A; 
#chains in the Genus database with same CATH topology
 2CG2 A;  1VME A;  2M5D A;  2ZZI A;  1MQO A;  2FU6 A;  3MD7 A;  5A0V A;  3IOF A;  2Q0I A;  2QIN A;  4UWR B;  4GCW A;  2I7X A;  1ZKP A;  4TZ9 A;  5A23 A;  1VJN A;  2FU9 A;  3SRX A;  2FHX A;  1DDK A;  3RKJ A;  5LCA A;  5ACT A;  2QED A;  2ZWR A;  4P62 A;  5EW0 A;  4EYL A;  3ZNB A;  1YCF A;  3F9O A;  4C1E A;  3SBL A;  3KNR A;  5HIO A;  3BK2 A;  1BVT A;  5AYA A;  3SD9 A;  5K4K A;  5EVD A;  4AD9 A;  5FQC A;  3DHC A;  4TZB A;  5AEB A;  5EWA A;  4RL2 A;  5EVB A;  1YCG A;  2YNU A;  3BV6 A;  3T3O A;  4Z5Z A;  1Y44 A;  2BG8 B;  2GKL A;  3PY5 A;  3SFP A;  2QJS A;  2BG7 A;  5FQB A;  3T3N A;  1HLK A;  4Z6X A;  2AZ4 A;  3AJ3 A;  3QH8 A;  5A87 A;  2A7M A;  2NXA A;  3R2U A;  3TP9 A;  2P1E A;  2H6A A;  2YNT A;  5LCH A;  4C1C A;  4TYT A;  2BIB A;  2FHX B;  1KO2 A;  1A7T A;  2OHI A;  1P9E A;  5K0W A;  4UA4 A;  3ZR9 A;  4H0D A;  3WXC A;  4FEK A;  1JJT A;  5EHT A;  2E7Y A;  3DH8 A;  4B87 A;  1XTO A;  5HH4 A;  4C1H A;  2Y8A A;  3PG4 A;  3BC2 A;  2FU8 A;  2OHJ A;  1DXK A;  3IE2 A;  5LCF A;  3AF5 A;  4FSB A;  1WRA A;  5ACX A;  5IQK A;  3IEM A;  1VGN A;  4HKY A;  4GYU A;  2R2D A;  2VW8 A;  3G1P A;  2BTN A;  4ZEJ A;  4EY2 A;  2Q9U A;  4C09 A;  2NZF A;  4AX0 B;  5AHR A;  1BC2 A;  4UAM A;  2GFJ A;  2BG2 A;  3IOG A;  3AF6 A;  2QDS A;  1YCH A;  2YNT B;  2FU7 A;  2XR1 A;  4RAM A;  4Z5Y A;  4D1T A;  2WYM A;  2BFL A;  4EFZ A;  5LS3 A;  5A0T A;  1KO3 A;  4GYQ A;  3H3E A;  4UWP B;  1SML A;  2I7T A;  4XUK A;  4UWO B;  5LSC A;  1DD6 A;  2GMN A;  4TZE A;  4XWW A;  2Y8B A;  2YZ3 A;  4Z67 A;  3Q6V A;  3FCZ A;  5LE1 A;  1X8I A;  4F6H A;  4PVO A;  4RBS A;  5HH5 A;  5AXR A;  4AWZ A;  4HL1 A;  2BFZ A;  3IDZ A;  4O98 A;  4TYF A;  3SPU A;  1X8H A;  2Q42 A;  3RPC A;  4NQ5 A;  4NQ2 A;  4NUR A;  4J5H A;  3IE0 A;  3I0V A;  5LM6 A;  1WUO A;  2BGA A;  3I14 A;  2FM6 A;  4FR7 A;  4BP0 A;  4AV7 A;  2M5C A;  1ZNB A;  2WYL A;  2XF4 A;  4J5F A;  5FQA A;  2P4Z A;  2CBN A;  4KEQ A;  5AHO A;  1QH3 A;  4C1F A;  3BK1 A;  2YNV A;  4ZO2 A;  4D1U A;  5ACS A;  2DOO A;  4HL2 A;  5K4N A;  3LVZ A;  5LLD A;  2FK6 A;  2Y87 A;  5HIS A;  3VQZ A;  2WYM C;  1JJE A;  3DHB A;  2BFK A;  4AWY B;  2P97 A;  5ACU A;  2CFU A;  2UYX A;  4ZO3 A;  2BFZ B;  1ZTC A;  5HH6 A;  4RL0 A;  4D02 A;  1E5D A;  2YCB A;  2YHE A;  5K4M A;  1QH5 A;  4XWT A;  5AIJ A;  4CHL A;  3FAI A;  4EXY A;  3IE1 A;  3I11 A;  4ZNB A;  3KNS A;  4EXS A;  2BMI A;  5HIQ A;  5B1U A;  4BZ3 A;  2BG6 A;  5B15 A;  4JO0 A;  4DIL A;  4RAW A;  4UBQ A;  2YNV B;  4NQ4 A;  2YNW A;  3IEL A;  4D1V A;  3I13 A;  2BC2 A;  4AXH A;  1L9Y A;  4LE6 A;  5EVK A;  5EV8 A;  2BR6 A;  1X8G A;  5ACQ A;  1XM8 A;  3I15 A;  2WHG A;  3P2U A;  3VPE A;  5AJL A;  5EV6 A;  4EYB A;  2ZNB A;  2HB9 A;  3JXP A;  4WD6 A;  4DIK A;  5DPX A;  4PVT A;  4NQ6 A;  4F6Z A;  4EYF A;  1BMC A;  2NZE A;  2CFZ A;  3PY6 A;  3ZWF A;  2DKF A;  3L6N A;  4YSL A;  2WRS A;  5EH9 A;  2NYP A;  3ADR A;  3SW3 A;  2GCU A;  5AXO A;  2ZO4 A;  2QDT A;  2I7V A;  5HIP A;  1WUP A;  5ACV A;  4D1W A;  3T9M A;  5ACP A;  5A5Z A;  5ACR A;  2GFK A;  4KEP A;  3A4Y A;  4PDX A;  3ESH A;  2OHH A;  4RM5 A;  3KL7 A;  1K07 A;  5B3R A;  2Q0J A;  4UWS B;  2CG3 A;  5LMC A;  1KR3 A;  4U4L A;  3DHA A;  1M2X A;  2P18 A;  3X30 A;  5KIL A;  4YSB A;  3IEK A;  4YSK A;  5KIK A;  2AIO A;  4C1G A;  4AX1 B;  3RKK A;  3S0Z A;  1JT1 A;  2BG8 A;  3ZQ4 A;  4Z7R A;  4V0H A;  3X2Y A;  1A8T A;  3X2Z A;  5ACW A;  3X2X A;  1WW1 A;  4Z60 A;  4C1D A;  4TZF A; 
#chains in the Genus database with same CATH homology
 1VME A;  2M5D A;  2ZZI A;  1MQO A;  2FU6 A;  3MD7 A;  5A0V A;  3IOF A;  2Q0I A;  2QIN A;  4UWR B;  4GCW A;  2I7X A;  1ZKP A;  4TZ9 A;  1VJN A;  2FU9 A;  3SRX A;  2FHX A;  1DDK A;  3RKJ A;  5LCA A;  5ACT A;  2QED A;  2ZWR A;  4P62 A;  5EW0 A;  4EYL A;  3ZNB A;  1YCF A;  3F9O A;  4C1E A;  3SBL A;  3KNR A;  5HIO A;  3BK2 A;  1BVT A;  5AYA A;  3SD9 A;  5K4K A;  5EVD A;  4AD9 A;  5FQC A;  3DHC A;  4TZB A;  5AEB A;  5EWA A;  4RL2 A;  5EVB A;  1YCG A;  2YNU A;  3BV6 A;  3T3O A;  4Z5Z A;  1Y44 A;  2BG8 B;  2GKL A;  3PY5 A;  3SFP A;  2QJS A;  2BG7 A;  5FQB A;  3T3N A;  1HLK A;  4Z6X A;  2AZ4 A;  3AJ3 A;  3QH8 A;  5A87 A;  2A7M A;  2NXA A;  3R2U A;  3TP9 A;  2P1E A;  2H6A A;  2YNT A;  5LCH A;  4C1C A;  4TYT A;  2BIB A;  2FHX B;  1KO2 A;  1A7T A;  2OHI A;  1P9E A;  5K0W A;  4UA4 A;  3ZR9 A;  4H0D A;  3WXC A;  4FEK A;  1JJT A;  5EHT A;  2E7Y A;  3DH8 A;  4B87 A;  1XTO A;  5HH4 A;  4C1H A;  2Y8A A;  3PG4 A;  3BC2 A;  2FU8 A;  2OHJ A;  1DXK A;  3IE2 A;  5LCF A;  3AF5 A;  4FSB A;  1WRA A;  5ACX A;  5IQK A;  3IEM A;  1VGN A;  4HKY A;  4GYU A;  2R2D A;  2VW8 A;  3G1P A;  2BTN A;  4ZEJ A;  4EY2 A;  2Q9U A;  4C09 A;  2NZF A;  4AX0 B;  5AHR A;  1BC2 A;  4UAM A;  2GFJ A;  2BG2 A;  3IOG A;  3AF6 A;  2QDS A;  1YCH A;  2YNT B;  2FU7 A;  2XR1 A;  4RAM A;  4Z5Y A;  4D1T A;  2WYM A;  2BFL A;  4EFZ A;  5LS3 A;  5A0T A;  1KO3 A;  4GYQ A;  3H3E A;  4UWP B;  1SML A;  2I7T A;  4XUK A;  4UWO B;  5LSC A;  1DD6 A;  2GMN A;  4TZE A;  4XWW A;  2Y8B A;  2YZ3 A;  4Z67 A;  3Q6V A;  3FCZ A;  5LE1 A;  1X8I A;  4F6H A;  4PVO A;  4RBS A;  5HH5 A;  5AXR A;  4AWZ A;  4HL1 A;  2BFZ A;  3IDZ A;  4O98 A;  4TYF A;  3SPU A;  1X8H A;  2Q42 A;  3RPC A;  4NQ5 A;  4NQ2 A;  4J5H A;  3IE0 A;  3I0V A;  5LM6 A;  1WUO A;  2BGA A;  3I14 A;  2FM6 A;  4FR7 A;  4BP0 A;  2M5C A;  1ZNB A;  2WYL A;  2XF4 A;  4J5F A;  5FQA A;  2P4Z A;  2CBN A;  4KEQ A;  5AHO A;  1QH3 A;  4C1F A;  3BK1 A;  2YNV A;  4ZO2 A;  4D1U A;  5ACS A;  2DOO A;  4HL2 A;  5K4N A;  3LVZ A;  5LLD A;  2FK6 A;  2Y87 A;  5HIS A;  3VQZ A;  2WYM C;  1JJE A;  3DHB A;  2BFK A;  4AWY B;  2P97 A;  5ACU A;  2UYX A;  4ZO3 A;  2BFZ B;  1ZTC A;  5HH6 A;  4RL0 A;  4D02 A;  1E5D A;  2YCB A;  5K4M A;  1QH5 A;  4XWT A;  4CHL A;  3FAI A;  4EXY A;  3IE1 A;  3I11 A;  4ZNB A;  3KNS A;  4EXS A;  2BMI A;  5HIQ A;  5B1U A;  4BZ3 A;  2BG6 A;  5B15 A;  4JO0 A;  4DIL A;  4RAW A;  4UBQ A;  2YNV B;  4NQ4 A;  2YNW A;  3IEL A;  4D1V A;  3I13 A;  2BC2 A;  1L9Y A;  4LE6 A;  5EVK A;  5EV8 A;  2BR6 A;  1X8G A;  5ACQ A;  1XM8 A;  3I15 A;  2WHG A;  3P2U A;  3VPE A;  5EV6 A;  4EYB A;  2ZNB A;  2HB9 A;  3JXP A;  4WD6 A;  4DIK A;  5DPX A;  4PVT A;  4NQ6 A;  4F6Z A;  4EYF A;  1BMC A;  2NZE A;  3PY6 A;  3ZWF A;  2DKF A;  3L6N A;  4YSL A;  2WRS A;  5EH9 A;  2NYP A;  3ADR A;  3SW3 A;  2GCU A;  5AXO A;  2ZO4 A;  2QDT A;  2I7V A;  5HIP A;  1WUP A;  5ACV A;  4D1W A;  3T9M A;  5ACP A;  5A5Z A;  5ACR A;  2GFK A;  4KEP A;  3A4Y A;  3ESH A;  2OHH A;  4RM5 A;  3KL7 A;  1K07 A;  5B3R A;  2Q0J A;  4UWS B;  5LMC A;  1KR3 A;  4U4L A;  3DHA A;  1M2X A;  2P18 A;  3X30 A;  5KIL A;  4YSB A;  3IEK A;  4YSK A;  5KIK A;  2AIO A;  4C1G A;  4AX1 B;  3RKK A;  3S0Z A;  1JT1 A;  2BG8 A;  3ZQ4 A;  4Z7R A;  4V0H A;  3X2Y A;  1A8T A;  3X2Z A;  5ACW A;  3X2X A;  1WW1 A;  4Z60 A;  4C1D A;  4TZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...