3JXPA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
304
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGRMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structure of PqqB from Pseudomonas putida at 2.2 A resolution
doi rcsb
source organism Pseudomonas putida
molecule tags Biosynthetic protein
total genus 101
structure length 304
sequence length 305
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3jxpA00
1KR3A 2H6AA 2NXAA 2DKFA 4Z6XA 1YCFA 3BK2A 1BVTA 3F9OA 3KNRA 4D1VA 2NYPA 4EY2A 4EYFA 3IE0A 5HIOA 2GMNA 2FHXB 4TZEA 4TYFA 2P97A 3RKJA 3FCZA 5FQBA 3Q6VA 5ACQA 2HB9A 3ZR9A 4BZ3A 5EVKA 2OHHA 3T9MA 1M2XA 5KILA 3PY6A 4F6ZA 1MQOA 3RPCA 3S0ZA 2FHXA 4D1UA 2GFKA 4GYUA 1DD6A 2R2DA 4XWTA 2UYXA 2BFKA 4C09A 5HISA 4YSBA 3AF5A 3I14A 5AHOA 4KEPA 2GKLA 3IELA 1K07A 2Y8BA 3PG4A 5EV6A 2BIBA 2Y87A 2GCUA 4J5HA 5KIKA 4H0DA 4Z60A 4PVTA 2I7XA 1X8HA 2AZ4A 4RAWA 3I13A 5IQKA 2XF4A 3T3OA 2I7VA 4EXYA 3IDZA 4HKYA 5LS3A 1WW1A 4NQ5A 5EVDA 3IEKA 3ZWFA 5ACPA 5AYAA 4P62A 2P1EA 5ACTA 3SBLA 1ZKPA 5ACSA 4AWYB 4TZBA 1Y44A 4C1EA 4Z7RA 1ZNBA 2WYMA 3H3EA 2Q0IA 3FAIA 4XWWA 4C1DA 2DOOA 3ESHA 3MD7A 3BC2A 2BG8A 1WRAA 2ZZIA 5LM6A 2WYLA 2FU6A 3AJ3A 1WUPA 1XTOA 3X30A 5K4MA 2ZWRA 2Q42A 2M5CA 3DHCA 4PVOA 3BK1A 5HH4A 2NZEA 2WHGA 2Y8AA 3L6NA 3SRXA 2BR6A 5EV8A 3ADRA 3QH8A 3T3NA 4UAMA 3IE2A 4U4LA 5B3RA 4F6HA 4TZFA 4TZ9A 2YNUA 3I15A 5LE1A 4NQ2A 2BG7A 4YSLA 1YCGA 3DH8A 4C1GA 5K4NA 4EXSA 4NQ4A 5ACRA 5HIPA 4Z67A 3IEMA 2CBNA 4DILA 3RKKA 1BMCA 4RAMA 5FQAA 1SMLA 5B1UA 4AX1B 4C1FA 3SD9A 3AF6A 4B87A 3KL7A 3ZNBA 3VQZA 5ACWA 2FU9A 2P4ZA 4HL1A 5HIQA 3R2UA 4Z5YA 5A87A 2VW8A 1VMEA 4J5FA 3SW3A 5EWAA 4TYTA 5LCAA 2ZO4A 4GCWA 4WD6A 5EH9A 3IE1A 1L9YA 5K4KA 2BG8B 2A7MA 4CHLA 4JO0A 5HH6A 4LE6A 5LLDA 2YCBA 1E5DA 2BMIA 1X8IA 4RL2A 2FU7A 5A0VA 5EHTA 1JT1A 1JJEA 4AD9A 4BP0A 4ZNBA 2WYMC 4FSBA 2GFJA 2ZNBA 2BFLA 2AIOA 3I11A 4UWPB 4NQ6A 4C1CA 4C1HA 1KO2A 2M5DA 2OHIA 2YNTA 2QJSA 5DPXA 2Q9UA 3DHBA 4V0HA 4Z5ZA 4ZEJA 4O98A 3ZQ4A 2OHJA 5EW0A 2FU8A 1BC2A 2BG2A 3I0VA 2FK6A 1DXKA 1YCHA 4AX0B 5LMCA 2BGAA 2YNVB 5LSCA 3IOFA 1ZTCA 4UBQA 1P9EA 5EVBA 2QEDA 3X2YA 2NZFA 2BTNA 2Q0JA 5AXOA 4ZO3A 1HLKA 2XR1A 1JJTA 5HH5A 4D02A 5AXRA 5ACVA 1QH3A 4YSKA 3KNSA 2YNWA 2YNVA 2FM6A 1KO3A 3JXPA 5B15A 3TP9A 5AEBA 5LCFA 3G1PA 5AHRA 4D1TA 4UWSB 2QDSA 4EYBA 5K0WA 4XUKA 3LVZA 4ZO2A 4AWZA 1A8TA 3BV6A 4FEKA 2QDTA 3P2UA 3X2ZA 5A0TA 2BFZB 1A7TA 5ACXA 4KEQA 2BC2A 1VGNA 1X8GA 2YNTB 4HL2A 3PY5A 2E7YA 4RL0A 1DDKA 2QINA 3IOGA 4RM5A 4FR7A 1QH5A 4RBSA 3X2XA 3VPEA 2BG6A 1VJNA 2YZ3A 2I7TA 5FQCA 2BFZA 1WUOA 1XM8A 4UWOB 4GYQA 3DHAA 4DIKA 4UWRB 4EFZA 4D1WA 3A4YA 3SPUA 5ACUA 4UA4A 5A5ZA 4EYLA 3SFPA 2WRSA 3WXCA 5LCHA 2P18A
chains in the Genus database with same CATH superfamily
1KR3A 2H6AA 2NXAA 2DKFA 4Z6XA 4PDXA 1YCFA 3BK2A 2CG3A 1BVTA 3F9OA 3KNRA 4D1VA 2NYPA 4EY2A 4EYFA 3IE0A 5HIOA 2GMNA 2FHXB 4TZEA 4TYFA 2P97A 3RKJA 3FCZA 5FQBA 3Q6VA 5ACQA 2HB9A 3ZR9A 4BZ3A 5EVKA 2OHHA 3T9MA 1M2XA 5KILA 3PY6A 4F6ZA 1MQOA 3RPCA 3S0ZA 2FHXA 4D1UA 2GFKA 4GYUA 2CFUA 1DD6A 2R2DA 4XWTA 2UYXA 2BFKA 4C09A 5HISA 4YSBA 3AF5A 3I14A 5AHOA 4KEPA 2GKLA 3IELA 1K07A 2Y8BA 3PG4A 5EV6A 2BIBA 2Y87A 2GCUA 4J5HA 5KIKA 4H0DA 4Z60A 4PVTA 2I7XA 1X8HA 2AZ4A 4RAWA 3I13A 5IQKA 2XF4A 3T3OA 2I7VA 4EXYA 3IDZA 4HKYA 5LS3A 1WW1A 4NQ5A 5EVDA 3IEKA 3ZWFA 5ACPA 5AYAA 4P62A 2P1EA 5ACTA 3SBLA 1ZKPA 5ACSA 4AWYB 4TZBA 1Y44A 4C1EA 5AIJA 4Z7RA 1ZNBA 2WYMA 3H3EA 2Q0IA 3FAIA 4XWWA 4C1DA 2DOOA 3ESHA 3MD7A 3BC2A 2BG8A 1WRAA 2ZZIA 5LM6A 2WYLA 2FU6A 3AJ3A 1WUPA 1XTOA 3X30A 5K4MA 2ZWRA 2Q42A 2M5CA 3DHCA 4PVOA 2CG2A 3BK1A 5HH4A 2NZEA 2WHGA 2Y8AA 3L6NA 3SRXA 2BR6A 5EV8A 3ADRA 3QH8A 3T3NA 4UAMA 3IE2A 4U4LA 5B3RA 4F6HA 4TZFA 4TZ9A 2YNUA 3I15A 5LE1A 4NQ2A 2BG7A 4YSLA 1YCGA 3DH8A 4C1GA 5K4NA 4EXSA 4NQ4A 5ACRA 5HIPA 4Z67A 3IEMA 2CBNA 4DILA 3RKKA 1BMCA 4RAMA 4AXHA 5FQAA 1SMLA 5B1UA 4AX1B 4C1FA 3SD9A 3AF6A 4B87A 3KL7A 3ZNBA 3VQZA 5ACWA 2FU9A 2P4ZA 4HL1A 5HIQA 3R2UA 4Z5YA 5A87A 2VW8A 1VMEA 4J5FA 3SW3A 5EWAA 4TYTA 5LCAA 2ZO4A 4GCWA 4WD6A 5EH9A 3IE1A 1L9YA 5K4KA 2BG8B 2A7MA 4CHLA 4JO0A 5HH6A 4LE6A 5LLDA 2YCBA 1E5DA 2BMIA 1X8IA 4RL2A 2FU7A 5A0VA 5EHTA 1JT1A 1JJEA 4AD9A 4BP0A 4ZNBA 2WYMC 4FSBA 2GFJA 2ZNBA 2BFLA 2AIOA 3I11A 4UWPB 4NQ6A 4C1CA 4C1HA 1KO2A 2M5DA 2OHIA 2YNTA 2QJSA 5DPXA 2Q9UA 3DHBA 4V0HA 4Z5ZA 4ZEJA 4O98A 3ZQ4A 2OHJA 5EW0A 2FU8A 1BC2A 2BG2A 3I0VA 2FK6A 1DXKA 1YCHA 4AX0B 5LMCA 2BGAA 5A23A 2YNVB 5LSCA 3IOFA 1ZTCA 4UBQA 1P9EA 5EVBA 2QEDA 3X2YA 2NZFA 2BTNA 2Q0JA 5AXOA 4ZO3A 1HLKA 2XR1A 1JJTA 5HH5A 4D02A 5AXRA 5ACVA 1QH3A 4YSKA 3KNSA 2YNWA 2YNVA 2FM6A 1KO3A 3JXPA 5B15A 3TP9A 5AEBA 5LCFA 3G1PA 5AHRA 4D1TA 4UWSB 2CFZA 2QDSA 4EYBA 5K0WA 4XUKA 3LVZA 4ZO2A 4AWZA 1A8TA 3BV6A 4FEKA 4AV7A 2QDTA 3P2UA 3X2ZA 5A0TA 2BFZB 1A7TA 5ACXA 4KEQA 2BC2A 1VGNA 1X8GA 2YHEA 2YNTB 4HL2A 3PY5A 5AJLA 2E7YA 4NURA 4RL0A 1DDKA 2QINA 3IOGA 4RM5A 4FR7A 1QH5A 4RBSA 3X2XA 3VPEA 2BG6A 1VJNA 2YZ3A 2I7TA 5FQCA 2BFZA 1WUOA 1XM8A 4UWOB 4GYQA 3DHAA 4DIKA 4UWRB 4EFZA 4D1WA 3A4YA 3SPUA 5ACUA 4UA4A 5A5ZA 4EYLA 3SFPA 2WRSA 3WXCA 5LCHA 2P18A
chains in the Genus database with same CATH topology
1KR3A 2H6AA 2NXAA 2DKFA 4Z6XA 1YCFA 3BK2A 1BVTA 3F9OA 3KNRA 4D1VA 2NYPA 4EY2A 4EYFA 3IE0A 5HIOA 2GMNA 2FHXB 4TZEA 4TYFA 2P97A 3RKJA 3FCZA 5FQBA 3Q6VA 5ACQA 2HB9A 3ZR9A 4BZ3A 5EVKA 2OHHA 3T9MA 1M2XA 5KILA 3PY6A 4F6ZA 1MQOA 3RPCA 3S0ZA 2FHXA 4D1UA 2GFKA 4GYUA 1DD6A 2R2DA 4XWTA 2UYXA 2BFKA 4C09A 5HISA 4YSBA 3AF5A 3I14A 5AHOA 4KEPA 2GKLA 3IELA 1K07A 2Y8BA 3PG4A 5EV6A 2BIBA 2Y87A 2GCUA 4J5HA 5KIKA 4H0DA 4Z60A 4PVTA 2I7XA 1X8HA 2AZ4A 4RAWA 3I13A 5IQKA 2XF4A 3T3OA 2I7VA 4EXYA 3IDZA 4HKYA 5LS3A 1WW1A 4NQ5A 5EVDA 3IEKA 3ZWFA 5ACPA 5AYAA 4P62A 2P1EA 5ACTA 3SBLA 1ZKPA 5ACSA 4AWYB 4TZBA 1Y44A 4C1EA 4Z7RA 1ZNBA 2WYMA 3H3EA 2Q0IA 3FAIA 4XWWA 4C1DA 2DOOA 3ESHA 3MD7A 3BC2A 2BG8A 1WRAA 2ZZIA 5LM6A 2WYLA 2FU6A 3AJ3A 1WUPA 1XTOA 3X30A 5K4MA 2ZWRA 2Q42A 2M5CA 3DHCA 4PVOA 3BK1A 5HH4A 2NZEA 2WHGA 2Y8AA 3L6NA 3SRXA 2BR6A 5EV8A 3ADRA 3QH8A 3T3NA 4UAMA 3IE2A 4U4LA 5B3RA 4F6HA 4TZFA 4TZ9A 2YNUA 3I15A 5LE1A 4NQ2A 2BG7A 4YSLA 1YCGA 3DH8A 4C1GA 5K4NA 4EXSA 4NQ4A 5ACRA 5HIPA 4Z67A 3IEMA 2CBNA 4DILA 3RKKA 1BMCA 4RAMA 5FQAA 1SMLA 5B1UA 4AX1B 4C1FA 3SD9A 3AF6A 4B87A 3KL7A 3ZNBA 3VQZA 5ACWA 2FU9A 2P4ZA 4HL1A 5HIQA 3R2UA 4Z5YA 5A87A 2VW8A 1VMEA 4J5FA 3SW3A 5EWAA 4TYTA 5LCAA 2ZO4A 4GCWA 4WD6A 5EH9A 3IE1A 1L9YA 5K4KA 2BG8B 2A7MA 4CHLA 4JO0A 5HH6A 4LE6A 5LLDA 2YCBA 1E5DA 2BMIA 1X8IA 4RL2A 2FU7A 5A0VA 5EHTA 1JT1A 1JJEA 4AD9A 4BP0A 4ZNBA 2WYMC 4FSBA 2GFJA 2ZNBA 2BFLA 2AIOA 3I11A 4UWPB 4NQ6A 4C1CA 4C1HA 1KO2A 2M5DA 2OHIA 2YNTA 2QJSA 5DPXA 2Q9UA 3DHBA 4V0HA 4Z5ZA 4ZEJA 4O98A 3ZQ4A 2OHJA 5EW0A 2FU8A 1BC2A 2BG2A 3I0VA 2FK6A 1DXKA 1YCHA 4AX0B 5LMCA 2BGAA 2YNVB 5LSCA 3IOFA 1ZTCA 4UBQA 1P9EA 5EVBA 2QEDA 3X2YA 2NZFA 2BTNA 2Q0JA 5AXOA 4ZO3A 1HLKA 2XR1A 1JJTA 5HH5A 4D02A 5AXRA 5ACVA 1QH3A 4YSKA 3KNSA 2YNWA 2YNVA 2FM6A 1KO3A 3JXPA 5B15A 3TP9A 5AEBA 5LCFA 3G1PA 5AHRA 4D1TA 4UWSB 2QDSA 4EYBA 5K0WA 4XUKA 3LVZA 4ZO2A 4AWZA 1A8TA 3BV6A 4FEKA 2QDTA 3P2UA 3X2ZA 5A0TA 2BFZB 1A7TA 5ACXA 4KEQA 2BC2A 1VGNA 1X8GA 2YNTB 4HL2A 3PY5A 2E7YA 4RL0A 1DDKA 2QINA 3IOGA 4RM5A 4FR7A 1QH5A 4RBSA 3X2XA 3VPEA 2BG6A 1VJNA 2YZ3A 2I7TA 5FQCA 2BFZA 1WUOA 1XM8A 4UWOB 4GYQA 3DHAA 4DIKA 4UWRB 4EFZA 4D1WA 3A4YA 3SPUA 5ACUA 4UA4A 5A5ZA 4EYLA 3SFPA 2WRSA 3WXCA 5LCHA 2P18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KR3 A;  2H6A A;  2NXA A;  2DKF A;  4Z6X A;  1YCF A;  3BK2 A;  1BVT A;  3F9O A;  3KNR A;  4D1V A;  2NYP A;  4EY2 A;  4EYF A;  3IE0 A;  5HIO A;  2GMN A;  2FHX B;  4TZE A;  4TYF A;  2P97 A;  3RKJ A;  3FCZ A;  5FQB A;  3Q6V A;  5ACQ A;  2HB9 A;  3ZR9 A;  4BZ3 A;  5EVK A;  2OHH A;  3T9M A;  1M2X A;  5KIL A;  3PY6 A;  4F6Z A;  1MQO A;  3RPC A;  3S0Z A;  2FHX A;  4D1U A;  2GFK A;  4GYU A;  1DD6 A;  2R2D A;  4XWT A;  2UYX A;  2BFK A;  4C09 A;  5HIS A;  4YSB A;  3AF5 A;  3I14 A;  5AHO A;  4KEP A;  2GKL A;  3IEL A;  1K07 A;  2Y8B A;  3PG4 A;  5EV6 A;  2BIB A;  2Y87 A;  2GCU A;  4J5H A;  5KIK A;  4H0D A;  4Z60 A;  4PVT A;  2I7X A;  1X8H A;  2AZ4 A;  4RAW A;  3I13 A;  5IQK A;  2XF4 A;  3T3O A;  2I7V A;  4EXY A;  3IDZ A;  4HKY A;  5LS3 A;  1WW1 A;  4NQ5 A;  5EVD A;  3IEK A;  3ZWF A;  5ACP A;  5AYA A;  4P62 A;  2P1E A;  5ACT A;  3SBL A;  1ZKP A;  5ACS A;  4AWY B;  4TZB A;  1Y44 A;  4C1E A;  4Z7R A;  1ZNB A;  2WYM A;  3H3E A;  2Q0I A;  3FAI A;  4XWW A;  4C1D A;  2DOO A;  3ESH A;  3MD7 A;  3BC2 A;  2BG8 A;  1WRA A;  2ZZI A;  5LM6 A;  2WYL A;  2FU6 A;  3AJ3 A;  1WUP A;  1XTO A;  3X30 A;  5K4M A;  2ZWR A;  2Q42 A;  2M5C A;  3DHC A;  4PVO A;  3BK1 A;  5HH4 A;  2NZE A;  2WHG A;  2Y8A A;  3L6N A;  3SRX A;  2BR6 A;  5EV8 A;  3ADR A;  3QH8 A;  3T3N A;  4UAM A;  3IE2 A;  4U4L A;  5B3R A;  4F6H A;  4TZF A;  4TZ9 A;  2YNU A;  3I15 A;  5LE1 A;  4NQ2 A;  2BG7 A;  4YSL A;  1YCG A;  3DH8 A;  4C1G A;  5K4N A;  4EXS A;  4NQ4 A;  5ACR A;  5HIP A;  4Z67 A;  3IEM A;  2CBN A;  4DIL A;  3RKK A;  1BMC A;  4RAM A;  5FQA A;  1SML A;  5B1U A;  4AX1 B;  4C1F A;  3SD9 A;  3AF6 A;  4B87 A;  3KL7 A;  3ZNB A;  3VQZ A;  5ACW A;  2FU9 A;  2P4Z A;  4HL1 A;  5HIQ A;  3R2U A;  4Z5Y A;  5A87 A;  2VW8 A;  1VME A;  4J5F A;  3SW3 A;  5EWA A;  4TYT A;  5LCA A;  2ZO4 A;  4GCW A;  4WD6 A;  5EH9 A;  3IE1 A;  1L9Y A;  5K4K A;  2BG8 B;  2A7M A;  4CHL A;  4JO0 A;  5HH6 A;  4LE6 A;  5LLD A;  2YCB A;  1E5D A;  2BMI A;  1X8I A;  4RL2 A;  2FU7 A;  5A0V A;  5EHT A;  1JT1 A;  1JJE A;  4AD9 A;  4BP0 A;  4ZNB A;  2WYM C;  4FSB A;  2GFJ A;  2ZNB A;  2BFL A;  2AIO A;  3I11 A;  4UWP B;  4NQ6 A;  4C1C A;  4C1H A;  1KO2 A;  2M5D A;  2OHI A;  2YNT A;  2QJS A;  5DPX A;  2Q9U A;  3DHB A;  4V0H A;  4Z5Z A;  4ZEJ A;  4O98 A;  3ZQ4 A;  2OHJ A;  5EW0 A;  2FU8 A;  1BC2 A;  2BG2 A;  3I0V A;  2FK6 A;  1DXK A;  1YCH A;  4AX0 B;  5LMC A;  2BGA A;  2YNV B;  5LSC A;  3IOF A;  1ZTC A;  4UBQ A;  1P9E A;  5EVB A;  2QED A;  3X2Y A;  2NZF A;  2BTN A;  2Q0J A;  5AXO A;  4ZO3 A;  1HLK A;  2XR1 A;  1JJT A;  5HH5 A;  4D02 A;  5AXR A;  5ACV A;  1QH3 A;  4YSK A;  3KNS A;  2YNW A;  2YNV A;  2FM6 A;  1KO3 A;  3JXP A;  5B15 A;  3TP9 A;  5AEB A;  5LCF A;  3G1P A;  5AHR A;  4D1T A;  4UWS B;  2QDS A;  4EYB A;  5K0W A;  4XUK A;  3LVZ A;  4ZO2 A;  4AWZ A;  1A8T A;  3BV6 A;  4FEK A;  2QDT A;  3P2U A;  3X2Z A;  5A0T A;  2BFZ B;  1A7T A;  5ACX A;  4KEQ A;  2BC2 A;  1VGN A;  1X8G A;  2YNT B;  4HL2 A;  3PY5 A;  2E7Y A;  4RL0 A;  1DDK A;  2QIN A;  3IOG A;  4RM5 A;  4FR7 A;  1QH5 A;  4RBS A;  3X2X A;  3VPE A;  2BG6 A;  1VJN A;  2YZ3 A;  2I7T A;  5FQC A;  2BFZ A;  1WUO A;  1XM8 A;  4UWO B;  4GYQ A;  3DHA A;  4DIK A;  4UWR B;  4EFZ A;  4D1W A;  3A4Y A;  3SPU A;  5ACU A;  4UA4 A;  5A5Z A;  4EYL A;  3SFP A;  2WRS A;  3WXC A;  5LCH A;  2P18 A; 
#chains in the Genus database with same CATH topology
 1KR3 A;  2H6A A;  2NXA A;  2DKF A;  4Z6X A;  4PDX A;  1YCF A;  3BK2 A;  2CG3 A;  1BVT A;  3F9O A;  3KNR A;  4D1V A;  2NYP A;  4EY2 A;  4EYF A;  3IE0 A;  5HIO A;  2GMN A;  2FHX B;  4TZE A;  4TYF A;  2P97 A;  3RKJ A;  3FCZ A;  5FQB A;  3Q6V A;  5ACQ A;  2HB9 A;  3ZR9 A;  4BZ3 A;  5EVK A;  2OHH A;  3T9M A;  1M2X A;  5KIL A;  3PY6 A;  4F6Z A;  1MQO A;  3RPC A;  3S0Z A;  2FHX A;  4D1U A;  2GFK A;  4GYU A;  2CFU A;  1DD6 A;  2R2D A;  4XWT A;  2UYX A;  2BFK A;  4C09 A;  5HIS A;  4YSB A;  3AF5 A;  3I14 A;  5AHO A;  4KEP A;  2GKL A;  3IEL A;  1K07 A;  2Y8B A;  3PG4 A;  5EV6 A;  2BIB A;  2Y87 A;  2GCU A;  4J5H A;  5KIK A;  4H0D A;  4Z60 A;  4PVT A;  2I7X A;  1X8H A;  2AZ4 A;  4RAW A;  3I13 A;  5IQK A;  2XF4 A;  3T3O A;  2I7V A;  4EXY A;  3IDZ A;  4HKY A;  5LS3 A;  1WW1 A;  4NQ5 A;  5EVD A;  3IEK A;  3ZWF A;  5ACP A;  5AYA A;  4P62 A;  2P1E A;  5ACT A;  3SBL A;  1ZKP A;  5ACS A;  4AWY B;  4TZB A;  1Y44 A;  4C1E A;  5AIJ A;  4Z7R A;  1ZNB A;  2WYM A;  3H3E A;  2Q0I A;  3FAI A;  4XWW A;  4C1D A;  2DOO A;  3ESH A;  3MD7 A;  3BC2 A;  2BG8 A;  1WRA A;  2ZZI A;  5LM6 A;  2WYL A;  2FU6 A;  3AJ3 A;  1WUP A;  1XTO A;  3X30 A;  5K4M A;  2ZWR A;  2Q42 A;  2M5C A;  3DHC A;  4PVO A;  2CG2 A;  3BK1 A;  5HH4 A;  2NZE A;  2WHG A;  2Y8A A;  3L6N A;  3SRX A;  2BR6 A;  5EV8 A;  3ADR A;  3QH8 A;  3T3N A;  4UAM A;  3IE2 A;  4U4L A;  5B3R A;  4F6H A;  4TZF A;  4TZ9 A;  2YNU A;  3I15 A;  5LE1 A;  4NQ2 A;  2BG7 A;  4YSL A;  1YCG A;  3DH8 A;  4C1G A;  5K4N A;  4EXS A;  4NQ4 A;  5ACR A;  5HIP A;  4Z67 A;  3IEM A;  2CBN A;  4DIL A;  3RKK A;  1BMC A;  4RAM A;  4AXH A;  5FQA A;  1SML A;  5B1U A;  4AX1 B;  4C1F A;  3SD9 A;  3AF6 A;  4B87 A;  3KL7 A;  3ZNB A;  3VQZ A;  5ACW A;  2FU9 A;  2P4Z A;  4HL1 A;  5HIQ A;  3R2U A;  4Z5Y A;  5A87 A;  2VW8 A;  1VME A;  4J5F A;  3SW3 A;  5EWA A;  4TYT A;  5LCA A;  2ZO4 A;  4GCW A;  4WD6 A;  5EH9 A;  3IE1 A;  1L9Y A;  5K4K A;  2BG8 B;  2A7M A;  4CHL A;  4JO0 A;  5HH6 A;  4LE6 A;  5LLD A;  2YCB A;  1E5D A;  2BMI A;  1X8I A;  4RL2 A;  2FU7 A;  5A0V A;  5EHT A;  1JT1 A;  1JJE A;  4AD9 A;  4BP0 A;  4ZNB A;  2WYM C;  4FSB A;  2GFJ A;  2ZNB A;  2BFL A;  2AIO A;  3I11 A;  4UWP B;  4NQ6 A;  4C1C A;  4C1H A;  1KO2 A;  2M5D A;  2OHI A;  2YNT A;  2QJS A;  5DPX A;  2Q9U A;  3DHB A;  4V0H A;  4Z5Z A;  4ZEJ A;  4O98 A;  3ZQ4 A;  2OHJ A;  5EW0 A;  2FU8 A;  1BC2 A;  2BG2 A;  3I0V A;  2FK6 A;  1DXK A;  1YCH A;  4AX0 B;  5LMC A;  2BGA A;  5A23 A;  2YNV B;  5LSC A;  3IOF A;  1ZTC A;  4UBQ A;  1P9E A;  5EVB A;  2QED A;  3X2Y A;  2NZF A;  2BTN A;  2Q0J A;  5AXO A;  4ZO3 A;  1HLK A;  2XR1 A;  1JJT A;  5HH5 A;  4D02 A;  5AXR A;  5ACV A;  1QH3 A;  4YSK A;  3KNS A;  2YNW A;  2YNV A;  2FM6 A;  1KO3 A;  3JXP A;  5B15 A;  3TP9 A;  5AEB A;  5LCF A;  3G1P A;  5AHR A;  4D1T A;  4UWS B;  2CFZ A;  2QDS A;  4EYB A;  5K0W A;  4XUK A;  3LVZ A;  4ZO2 A;  4AWZ A;  1A8T A;  3BV6 A;  4FEK A;  4AV7 A;  2QDT A;  3P2U A;  3X2Z A;  5A0T A;  2BFZ B;  1A7T A;  5ACX A;  4KEQ A;  2BC2 A;  1VGN A;  1X8G A;  2YHE A;  2YNT B;  4HL2 A;  3PY5 A;  5AJL A;  2E7Y A;  4NUR A;  4RL0 A;  1DDK A;  2QIN A;  3IOG A;  4RM5 A;  4FR7 A;  1QH5 A;  4RBS A;  3X2X A;  3VPE A;  2BG6 A;  1VJN A;  2YZ3 A;  2I7T A;  5FQC A;  2BFZ A;  1WUO A;  1XM8 A;  4UWO B;  4GYQ A;  3DHA A;  4DIK A;  4UWR B;  4EFZ A;  4D1W A;  3A4Y A;  3SPU A;  5ACU A;  4UA4 A;  5A5Z A;  4EYL A;  3SFP A;  2WRS A;  3WXC A;  5LCH A;  2P18 A; 
#chains in the Genus database with same CATH homology
 1KR3 A;  2H6A A;  2NXA A;  2DKF A;  4Z6X A;  1YCF A;  3BK2 A;  1BVT A;  3F9O A;  3KNR A;  4D1V A;  2NYP A;  4EY2 A;  4EYF A;  3IE0 A;  5HIO A;  2GMN A;  2FHX B;  4TZE A;  4TYF A;  2P97 A;  3RKJ A;  3FCZ A;  5FQB A;  3Q6V A;  5ACQ A;  2HB9 A;  3ZR9 A;  4BZ3 A;  5EVK A;  2OHH A;  3T9M A;  1M2X A;  5KIL A;  3PY6 A;  4F6Z A;  1MQO A;  3RPC A;  3S0Z A;  2FHX A;  4D1U A;  2GFK A;  4GYU A;  1DD6 A;  2R2D A;  4XWT A;  2UYX A;  2BFK A;  4C09 A;  5HIS A;  4YSB A;  3AF5 A;  3I14 A;  5AHO A;  4KEP A;  2GKL A;  3IEL A;  1K07 A;  2Y8B A;  3PG4 A;  5EV6 A;  2BIB A;  2Y87 A;  2GCU A;  4J5H A;  5KIK A;  4H0D A;  4Z60 A;  4PVT A;  2I7X A;  1X8H A;  2AZ4 A;  4RAW A;  3I13 A;  5IQK A;  2XF4 A;  3T3O A;  2I7V A;  4EXY A;  3IDZ A;  4HKY A;  5LS3 A;  1WW1 A;  4NQ5 A;  5EVD A;  3IEK A;  3ZWF A;  5ACP A;  5AYA A;  4P62 A;  2P1E A;  5ACT A;  3SBL A;  1ZKP A;  5ACS A;  4AWY B;  4TZB A;  1Y44 A;  4C1E A;  4Z7R A;  1ZNB A;  2WYM A;  3H3E A;  2Q0I A;  3FAI A;  4XWW A;  4C1D A;  2DOO A;  3ESH A;  3MD7 A;  3BC2 A;  2BG8 A;  1WRA A;  2ZZI A;  5LM6 A;  2WYL A;  2FU6 A;  3AJ3 A;  1WUP A;  1XTO A;  3X30 A;  5K4M A;  2ZWR A;  2Q42 A;  2M5C A;  3DHC A;  4PVO A;  3BK1 A;  5HH4 A;  2NZE A;  2WHG A;  2Y8A A;  3L6N A;  3SRX A;  2BR6 A;  5EV8 A;  3ADR A;  3QH8 A;  3T3N A;  4UAM A;  3IE2 A;  4U4L A;  5B3R A;  4F6H A;  4TZF A;  4TZ9 A;  2YNU A;  3I15 A;  5LE1 A;  4NQ2 A;  2BG7 A;  4YSL A;  1YCG A;  3DH8 A;  4C1G A;  5K4N A;  4EXS A;  4NQ4 A;  5ACR A;  5HIP A;  4Z67 A;  3IEM A;  2CBN A;  4DIL A;  3RKK A;  1BMC A;  4RAM A;  5FQA A;  1SML A;  5B1U A;  4AX1 B;  4C1F A;  3SD9 A;  3AF6 A;  4B87 A;  3KL7 A;  3ZNB A;  3VQZ A;  5ACW A;  2FU9 A;  2P4Z A;  4HL1 A;  5HIQ A;  3R2U A;  4Z5Y A;  5A87 A;  2VW8 A;  1VME A;  4J5F A;  3SW3 A;  5EWA A;  4TYT A;  5LCA A;  2ZO4 A;  4GCW A;  4WD6 A;  5EH9 A;  3IE1 A;  1L9Y A;  5K4K A;  2BG8 B;  2A7M A;  4CHL A;  4JO0 A;  5HH6 A;  4LE6 A;  5LLD A;  2YCB A;  1E5D A;  2BMI A;  1X8I A;  4RL2 A;  2FU7 A;  5A0V A;  5EHT A;  1JT1 A;  1JJE A;  4AD9 A;  4BP0 A;  4ZNB A;  2WYM C;  4FSB A;  2GFJ A;  2ZNB A;  2BFL A;  2AIO A;  3I11 A;  4UWP B;  4NQ6 A;  4C1C A;  4C1H A;  1KO2 A;  2M5D A;  2OHI A;  2YNT A;  2QJS A;  5DPX A;  2Q9U A;  3DHB A;  4V0H A;  4Z5Z A;  4ZEJ A;  4O98 A;  3ZQ4 A;  2OHJ A;  5EW0 A;  2FU8 A;  1BC2 A;  2BG2 A;  3I0V A;  2FK6 A;  1DXK A;  1YCH A;  4AX0 B;  5LMC A;  2BGA A;  2YNV B;  5LSC A;  3IOF A;  1ZTC A;  4UBQ A;  1P9E A;  5EVB A;  2QED A;  3X2Y A;  2NZF A;  2BTN A;  2Q0J A;  5AXO A;  4ZO3 A;  1HLK A;  2XR1 A;  1JJT A;  5HH5 A;  4D02 A;  5AXR A;  5ACV A;  1QH3 A;  4YSK A;  3KNS A;  2YNW A;  2YNV A;  2FM6 A;  1KO3 A;  3JXP A;  5B15 A;  3TP9 A;  5AEB A;  5LCF A;  3G1P A;  5AHR A;  4D1T A;  4UWS B;  2QDS A;  4EYB A;  5K0W A;  4XUK A;  3LVZ A;  4ZO2 A;  4AWZ A;  1A8T A;  3BV6 A;  4FEK A;  2QDT A;  3P2U A;  3X2Z A;  5A0T A;  2BFZ B;  1A7T A;  5ACX A;  4KEQ A;  2BC2 A;  1VGN A;  1X8G A;  2YNT B;  4HL2 A;  3PY5 A;  2E7Y A;  4RL0 A;  1DDK A;  2QIN A;  3IOG A;  4RM5 A;  4FR7 A;  1QH5 A;  4RBS A;  3X2X A;  3VPE A;  2BG6 A;  1VJN A;  2YZ3 A;  2I7T A;  5FQC A;  2BFZ A;  1WUO A;  1XM8 A;  4UWO B;  4GYQ A;  3DHA A;  4DIK A;  4UWR B;  4EFZ A;  4D1W A;  3A4Y A;  3SPU A;  5ACU A;  4UA4 A;  5A5Z A;  4EYL A;  3SFP A;  2WRS A;  3WXC A;  5LCH A;  2P18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...