3JXPA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
304
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGRMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PqqB from Pseudomonas putida at 2.2 A resolution
doi rcsb
source organism Pseudomonas putida
molecule tags Biosynthetic protein
molecule keywords Coenzyme PQQ synthesis protein B
total genus 101
structure length 304
sequence length 305
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3jxpA00
3I14A 2QINA 5FQAA 2WYLA 4RAWA 3VQZA 2A7MA 4CHLA 5K4NA 2FU9A 4TZBA 1Y44A 1WW1A 2GKLA 3I15A 2ZO4A 2NZEA 1A7TA 5K4KA 5A0TA 1DXKA 2BC2A 5AXOA 3BK1A 2GFKA 2OHHA 3ZWFA 4YSKA 4F6ZA 1BMCA 4C1EA 5LSCA 2YNWA 1DD6A 4FEKA 4JO0A 4RBSA 3I0VA 1VGNA 1WRAA 5EW0A 3I11A 2QEDA 5K4MA 3SRXA 1BVTA 5LE1A 2DOOA 1JJTA 2ZNBA 3X2XA 4H0DA 3R2UA 3DHCA 4EYFA 1YCFA 4EXYA 2BG2A 3I13A 4Z5ZA 4C1DA 5A0VA 3SFPA 4RM5A 4KEPA 5K0WA 2BMIA 5AXRA 2P97A 5AHRA 3SW3A 3IE2A 3ZNBA 4D1UA 4B87A 5EV8A 3MD7A 3X2ZA 1X8GA 2AIOA 2Y87A 5FQCA 4UWSB 1P9EA 4XUKA 4C1FA 5LMCA 4TYFA 3ZQ4A 4D02A 1BC2A 5ACVA 4Z5YA 5ACSA 1JT1A 2DKFA 2I7VA 3FAIA 3IOGA 3T3NA 4NQ4A 4KEQA 4LE6A 3PY5A 1X8HA 2BFLA 5KILA 4ZEJA 3JXPA 1YCHA 2CBNA 4UAMA 5FQBA 2BFZB 4PVOA 1KR3A 4J5FA 3IOFA 2QJSA 5ACQA 4O98A 2QDSA 5B15A 4C09A 1QH3A 2WRSA 2ZWRA 2WYMA 2BG7A 4Z7RA 2NZFA 4GYUA 4AD9A 1WUOA 4AWZA 3BV6A 4YSLA 5ACWA 3WXCA 4HKYA 2GMNA 4F6HA 2YNVB 3IEKA 4WD6A 2QDTA 1X8IA 4DILA 2BG8B 4V0HA 3IEMA 5HIOA 3T3OA 4RL2A 3DH8A 1DDKA 1KO3A 4EYBA 5EVBA 4AWYB 4RAMA 4C1HA 4EY2A 2BTNA 3AF5A 3QH8A 2I7XA 3L6NA 3RKJA 5IQKA 4RL0A 4ZO3A 3DHAA 3IE0A 5A87A 4TZEA 2BG8A 5EWAA 1ZTCA 4Z67A 1YCGA 5LLDA 2YNTA 3X2YA 3T9MA 5HH6A 3ESHA 1L9YA 5AHOA 3A4YA 5EVDA 2Q42A 4DIKA 5AYAA 2FU7A 2XR1A 4D1TA 4NQ2A 1K07A 2FU6A 3SBLA 2WYMC 4FR7A 3PG4A 4D1WA 4HL2A 5ACPA 2OHJA 1KO2A 4Z6XA 4UWOB 4EFZA 3F9OA 5EH9A 3RPCA 1JJEA 3IDZA 3IELA 2Q0JA 2BFZA 3IE1A 3KL7A 4UWRB 2BR6A 2Y8BA 2R2DA 3BK2A 1VMEA 4TZ9A 1E5DA 2HB9A 2FHXA 2NXAA 4P62A 4FSBA 4ZO2A 5LCFA 3ZR9A 1ZKPA 2BFKA 2YNVA 5LCAA 1XTOA 3AF6A 1M2XA 1ZNBA 5HH4A 5LS3A 3DHBA 2I7TA 2FK6A 2E7YA 4XWTA 4XWWA 2YNUA 2Q9UA 4PVTA 4HL1A 3KNRA 3RKKA 4C1GA 4EXSA 2M5CA 4TZFA 3LVZA 2FM6A 4GYQA 2Q0IA 5KIKA 5LM6A 2YCBA 5ACUA 4GCWA 2GFJA 4UA4A 1MQOA 2NYPA 5B3RA 2YZ3A 4D1VA 4EYLA 3G1PA 2P18A 4NQ6A 3TP9A 5HIPA 5EVKA 2BIBA 2P4ZA 2AZ4A 4AX0B 5HIQA 1A8TA 3X30A 2M5DA 4TYTA 2GCUA 3P2UA 5B1UA 5ACRA 2OHIA 4UWPB 1QH5A 4AX1B 4NQ5A 1WUPA 5LCHA 1XM8A 4C1CA 3FCZA 3ADRA 2Y8AA 5HH5A 4YSBA 5ACXA 2UYXA 5AEBA 2H6AA 2WHGA 4U4LA 5A5ZA 3Q6VA 2FHXB 1SMLA 5EV6A 4BZ3A 3KNSA 2BGAA 3H3EA 3SD9A 5ACTA 1HLKA 5DPXA 3SPUA 5HISA 3BC2A 3VPEA 4BP0A 5EHTA 3S0ZA 3AJ3A 2YNTB 4UBQA 2XF4A 3PY6A 2FU8A 4J5HA 2ZZIA 4Z60A 2P1EA 2VW8A 4ZNBA 2BG6A 1VJNA
chains in the Genus database with same CATH superfamily
3I14A 5AJLA 2QINA 5FQAA 2WYLA 4RAWA 3VQZA 2A7MA 4CHLA 5K4NA 2FU9A 4TZBA 1Y44A 1WW1A 2GKLA 3I15A 2ZO4A 2CFUA 2NZEA 1A7TA 5K4KA 5A0TA 1DXKA 2BC2A 5AXOA 3BK1A 2GFKA 2OHHA 3ZWFA 4YSKA 4F6ZA 1BMCA 4C1EA 5LSCA 2YNWA 1DD6A 4FEKA 4JO0A 4RBSA 3I0VA 1VGNA 1WRAA 5EW0A 3I11A 2QEDA 5K4MA 3SRXA 1BVTA 5LE1A 2DOOA 1JJTA 4AXHA 2ZNBA 3X2XA 4H0DA 3R2UA 3DHCA 4EYFA 1YCFA 4EXYA 2BG2A 3I13A 4Z5ZA 4C1DA 5A0VA 3SFPA 4RM5A 4KEPA 5K0WA 2BMIA 5AXRA 2P97A 5AHRA 3SW3A 3IE2A 3ZNBA 4D1UA 4B87A 5EV8A 3MD7A 3X2ZA 1X8GA 2AIOA 2Y87A 5FQCA 4UWSB 1P9EA 4XUKA 4C1FA 5LMCA 4TYFA 3ZQ4A 4D02A 1BC2A 2YHEA 5ACVA 4Z5YA 5ACSA 1JT1A 2DKFA 2I7VA 3FAIA 3IOGA 3T3NA 4NQ4A 4KEQA 4LE6A 3PY5A 1X8HA 2BFLA 5KILA 4ZEJA 3JXPA 1YCHA 2CBNA 4UAMA 5FQBA 2BFZB 4PVOA 1KR3A 4J5FA 3IOFA 2QJSA 5ACQA 4O98A 2QDSA 5B15A 4C09A 1QH3A 2CG3A 2WRSA 2ZWRA 2WYMA 2BG7A 4Z7RA 2NZFA 4GYUA 4AD9A 1WUOA 4AWZA 3BV6A 4YSLA 5ACWA 3WXCA 4HKYA 2GMNA 4F6HA 2CG2A 2YNVB 3IEKA 4WD6A 2QDTA 1X8IA 4DILA 2BG8B 4V0HA 3IEMA 5HIOA 3T3OA 4RL2A 3DH8A 1DDKA 1KO3A 4EYBA 5EVBA 4AWYB 4RAMA 4C1HA 4EY2A 2BTNA 3AF5A 3QH8A 2I7XA 3L6NA 3RKJA 5IQKA 4RL0A 4ZO3A 3DHAA 3IE0A 5A87A 4TZEA 2BG8A 5EWAA 1ZTCA 4Z67A 1YCGA 2YNTA 5LLDA 3X2YA 3T9MA 5HH6A 3ESHA 1L9YA 5AHOA 3A4YA 5EVDA 2Q42A 4DIKA 5AYAA 2FU7A 2XR1A 4D1TA 4NQ2A 1K07A 2FU6A 3SBLA 2WYMC 4FR7A 3PG4A 4D1WA 4HL2A 5ACPA 2OHJA 1KO2A 4Z6XA 4UWOB 4EFZA 3F9OA 5EH9A 3RPCA 1JJEA 3IDZA 3IELA 4NURA 2Q0JA 2BFZA 3IE1A 3KL7A 4UWRB 2BR6A 2Y8BA 2R2DA 3BK2A 1VMEA 4TZ9A 1E5DA 2HB9A 2FHXA 2NXAA 4P62A 4FSBA 4ZO2A 5LCFA 3ZR9A 1ZKPA 2BFKA 2YNVA 4PDXA 5LCAA 1XTOA 3AF6A 1M2XA 1ZNBA 5HH4A 5LS3A 3DHBA 2I7TA 2FK6A 2E7YA 4XWTA 4XWWA 2YNUA 2Q9UA 4PVTA 4HL1A 3KNRA 3RKKA 4C1GA 4EXSA 2M5CA 4TZFA 3LVZA 2FM6A 4GYQA 2Q0IA 5KIKA 5LM6A 2YCBA 5ACUA 4GCWA 2GFJA 4UA4A 1MQOA 2NYPA 5B3RA 2YZ3A 4D1VA 4EYLA 3G1PA 2P18A 4NQ6A 3TP9A 5HIPA 5EVKA 2BIBA 2P4ZA 2AZ4A 4AX0B 5A23A 5HIQA 1A8TA 3X30A 2M5DA 4TYTA 2GCUA 3P2UA 5B1UA 5ACRA 2OHIA 4UWPB 1QH5A 4AX1B 4NQ5A 1WUPA 5LCHA 1XM8A 4C1CA 3FCZA 3ADRA 2Y8AA 5HH5A 4YSBA 5ACXA 2UYXA 5AEBA 2H6AA 2WHGA 4U4LA 5A5ZA 3Q6VA 2FHXB 1SMLA 5EV6A 4BZ3A 3KNSA 2BGAA 2CFZA 3H3EA 3SD9A 5ACTA 1HLKA 5DPXA 3SPUA 5HISA 3BC2A 3VPEA 4BP0A 5EHTA 3S0ZA 3AJ3A 2YNTB 4UBQA 2XF4A 3PY6A 2FU8A 4J5HA 2ZZIA 4Z60A 5AIJA 2P1EA 4AV7A 2VW8A 4ZNBA 2BG6A 1VJNA
chains in the Genus database with same CATH topology
3I14A 2QINA 5FQAA 2WYLA 4RAWA 3VQZA 2A7MA 4CHLA 5K4NA 2FU9A 4TZBA 1Y44A 1WW1A 2GKLA 3I15A 2ZO4A 2NZEA 1A7TA 5K4KA 5A0TA 1DXKA 2BC2A 5AXOA 3BK1A 2GFKA 2OHHA 3ZWFA 4YSKA 4F6ZA 1BMCA 4C1EA 5LSCA 2YNWA 1DD6A 4FEKA 4JO0A 4RBSA 3I0VA 1VGNA 1WRAA 5EW0A 3I11A 2QEDA 5K4MA 3SRXA 1BVTA 5LE1A 2DOOA 1JJTA 2ZNBA 3X2XA 4H0DA 3R2UA 3DHCA 4EYFA 1YCFA 4EXYA 2BG2A 3I13A 4Z5ZA 4C1DA 5A0VA 3SFPA 4RM5A 4KEPA 5K0WA 2BMIA 5AXRA 2P97A 5AHRA 3SW3A 3IE2A 3ZNBA 4D1UA 4B87A 5EV8A 3MD7A 3X2ZA 1X8GA 2AIOA 2Y87A 5FQCA 4UWSB 1P9EA 4XUKA 4C1FA 5LMCA 4TYFA 3ZQ4A 4D02A 1BC2A 5ACVA 4Z5YA 5ACSA 1JT1A 2DKFA 2I7VA 3FAIA 3IOGA 3T3NA 4NQ4A 4KEQA 4LE6A 3PY5A 1X8HA 2BFLA 5KILA 4ZEJA 3JXPA 1YCHA 2CBNA 4UAMA 5FQBA 2BFZB 4PVOA 1KR3A 4J5FA 3IOFA 2QJSA 5ACQA 4O98A 2QDSA 5B15A 4C09A 1QH3A 2WRSA 2ZWRA 2WYMA 2BG7A 4Z7RA 2NZFA 4GYUA 4AD9A 1WUOA 4AWZA 3BV6A 4YSLA 5ACWA 3WXCA 4HKYA 2GMNA 4F6HA 2YNVB 3IEKA 4WD6A 2QDTA 1X8IA 4DILA 2BG8B 4V0HA 3IEMA 5HIOA 3T3OA 4RL2A 3DH8A 1DDKA 1KO3A 4EYBA 5EVBA 4AWYB 4RAMA 4C1HA 4EY2A 2BTNA 3AF5A 3QH8A 2I7XA 3L6NA 3RKJA 5IQKA 4RL0A 4ZO3A 3DHAA 3IE0A 5A87A 4TZEA 2BG8A 5EWAA 1ZTCA 4Z67A 1YCGA 5LLDA 2YNTA 3X2YA 3T9MA 5HH6A 3ESHA 1L9YA 5AHOA 3A4YA 5EVDA 2Q42A 4DIKA 5AYAA 2FU7A 2XR1A 4D1TA 4NQ2A 1K07A 2FU6A 3SBLA 2WYMC 4FR7A 3PG4A 4D1WA 4HL2A 5ACPA 2OHJA 1KO2A 4Z6XA 4UWOB 4EFZA 3F9OA 5EH9A 3RPCA 1JJEA 3IDZA 3IELA 2Q0JA 2BFZA 3IE1A 3KL7A 4UWRB 2BR6A 2Y8BA 2R2DA 3BK2A 1VMEA 4TZ9A 1E5DA 2HB9A 2FHXA 2NXAA 4P62A 4FSBA 4ZO2A 5LCFA 3ZR9A 1ZKPA 2BFKA 2YNVA 5LCAA 1XTOA 3AF6A 1M2XA 1ZNBA 5HH4A 5LS3A 3DHBA 2I7TA 2FK6A 2E7YA 4XWTA 4XWWA 2YNUA 2Q9UA 4PVTA 4HL1A 3KNRA 3RKKA 4C1GA 4EXSA 2M5CA 4TZFA 3LVZA 2FM6A 4GYQA 2Q0IA 5KIKA 5LM6A 2YCBA 5ACUA 4GCWA 2GFJA 4UA4A 1MQOA 2NYPA 5B3RA 2YZ3A 4D1VA 4EYLA 3G1PA 2P18A 4NQ6A 3TP9A 5HIPA 5EVKA 2BIBA 2P4ZA 2AZ4A 4AX0B 5HIQA 1A8TA 3X30A 2M5DA 4TYTA 2GCUA 3P2UA 5B1UA 5ACRA 2OHIA 4UWPB 1QH5A 4AX1B 4NQ5A 1WUPA 5LCHA 1XM8A 4C1CA 3FCZA 3ADRA 2Y8AA 5HH5A 4YSBA 5ACXA 2UYXA 5AEBA 2H6AA 2WHGA 4U4LA 5A5ZA 3Q6VA 2FHXB 1SMLA 5EV6A 4BZ3A 3KNSA 2BGAA 3H3EA 3SD9A 5ACTA 1HLKA 5DPXA 3SPUA 5HISA 3BC2A 3VPEA 4BP0A 5EHTA 3S0ZA 3AJ3A 2YNTB 4UBQA 2XF4A 3PY6A 2FU8A 4J5HA 2ZZIA 4Z60A 2P1EA 2VW8A 4ZNBA 2BG6A 1VJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I14 A;  2QIN A;  5FQA A;  2WYL A;  4RAW A;  3VQZ A;  2A7M A;  4CHL A;  5K4N A;  2FU9 A;  4TZB A;  1Y44 A;  1WW1 A;  2GKL A;  3I15 A;  2ZO4 A;  2NZE A;  1A7T A;  5K4K A;  5A0T A;  1DXK A;  2BC2 A;  5AXO A;  3BK1 A;  2GFK A;  2OHH A;  3ZWF A;  4YSK A;  4F6Z A;  1BMC A;  4C1E A;  5LSC A;  2YNW A;  1DD6 A;  4FEK A;  4JO0 A;  4RBS A;  3I0V A;  1VGN A;  1WRA A;  5EW0 A;  3I11 A;  2QED A;  5K4M A;  3SRX A;  1BVT A;  5LE1 A;  2DOO A;  1JJT A;  2ZNB A;  3X2X A;  4H0D A;  3R2U A;  3DHC A;  4EYF A;  1YCF A;  4EXY A;  2BG2 A;  3I13 A;  4Z5Z A;  4C1D A;  5A0V A;  3SFP A;  4RM5 A;  4KEP A;  5K0W A;  2BMI A;  5AXR A;  2P97 A;  5AHR A;  3SW3 A;  3IE2 A;  3ZNB A;  4D1U A;  4B87 A;  5EV8 A;  3MD7 A;  3X2Z A;  1X8G A;  2AIO A;  2Y87 A;  5FQC A;  4UWS B;  1P9E A;  4XUK A;  4C1F A;  5LMC A;  4TYF A;  3ZQ4 A;  4D02 A;  1BC2 A;  5ACV A;  4Z5Y A;  5ACS A;  1JT1 A;  2DKF A;  2I7V A;  3FAI A;  3IOG A;  3T3N A;  4NQ4 A;  4KEQ A;  4LE6 A;  3PY5 A;  1X8H A;  2BFL A;  5KIL A;  4ZEJ A;  3JXP A;  1YCH A;  2CBN A;  4UAM A;  5FQB A;  2BFZ B;  4PVO A;  1KR3 A;  4J5F A;  3IOF A;  2QJS A;  5ACQ A;  4O98 A;  2QDS A;  5B15 A;  4C09 A;  1QH3 A;  2WRS A;  2ZWR A;  2WYM A;  2BG7 A;  4Z7R A;  2NZF A;  4GYU A;  4AD9 A;  1WUO A;  4AWZ A;  3BV6 A;  4YSL A;  5ACW A;  3WXC A;  4HKY A;  2GMN A;  4F6H A;  2YNV B;  3IEK A;  4WD6 A;  2QDT A;  1X8I A;  4DIL A;  2BG8 B;  4V0H A;  3IEM A;  5HIO A;  3T3O A;  4RL2 A;  3DH8 A;  1DDK A;  1KO3 A;  4EYB A;  5EVB A;  4AWY B;  4RAM A;  4C1H A;  4EY2 A;  2BTN A;  3AF5 A;  3QH8 A;  2I7X A;  3L6N A;  3RKJ A;  5IQK A;  4RL0 A;  4ZO3 A;  3DHA A;  3IE0 A;  5A87 A;  4TZE A;  2BG8 A;  5EWA A;  1ZTC A;  4Z67 A;  1YCG A;  5LLD A;  2YNT A;  3X2Y A;  3T9M A;  5HH6 A;  3ESH A;  1L9Y A;  5AHO A;  3A4Y A;  5EVD A;  2Q42 A;  4DIK A;  5AYA A;  2FU7 A;  2XR1 A;  4D1T A;  4NQ2 A;  1K07 A;  2FU6 A;  3SBL A;  2WYM C;  4FR7 A;  3PG4 A;  4D1W A;  4HL2 A;  5ACP A;  2OHJ A;  1KO2 A;  4Z6X A;  4UWO B;  4EFZ A;  3F9O A;  5EH9 A;  3RPC A;  1JJE A;  3IDZ A;  3IEL A;  2Q0J A;  2BFZ A;  3IE1 A;  3KL7 A;  4UWR B;  2BR6 A;  2Y8B A;  2R2D A;  3BK2 A;  1VME A;  4TZ9 A;  1E5D A;  2HB9 A;  2FHX A;  2NXA A;  4P62 A;  4FSB A;  4ZO2 A;  5LCF A;  3ZR9 A;  1ZKP A;  2BFK A;  2YNV A;  5LCA A;  1XTO A;  3AF6 A;  1M2X A;  1ZNB A;  5HH4 A;  5LS3 A;  3DHB A;  2I7T A;  2FK6 A;  2E7Y A;  4XWT A;  4XWW A;  2YNU A;  2Q9U A;  4PVT A;  4HL1 A;  3KNR A;  3RKK A;  4C1G A;  4EXS A;  2M5C A;  4TZF A;  3LVZ A;  2FM6 A;  4GYQ A;  2Q0I A;  5KIK A;  5LM6 A;  2YCB A;  5ACU A;  4GCW A;  2GFJ A;  4UA4 A;  1MQO A;  2NYP A;  5B3R A;  2YZ3 A;  4D1V A;  4EYL A;  3G1P A;  2P18 A;  4NQ6 A;  3TP9 A;  5HIP A;  5EVK A;  2BIB A;  2P4Z A;  2AZ4 A;  4AX0 B;  5HIQ A;  1A8T A;  3X30 A;  2M5D A;  4TYT A;  2GCU A;  3P2U A;  5B1U A;  5ACR A;  2OHI A;  4UWP B;  1QH5 A;  4AX1 B;  4NQ5 A;  1WUP A;  5LCH A;  1XM8 A;  4C1C A;  3FCZ A;  3ADR A;  2Y8A A;  5HH5 A;  4YSB A;  5ACX A;  2UYX A;  5AEB A;  2H6A A;  2WHG A;  4U4L A;  5A5Z A;  3Q6V A;  2FHX B;  1SML A;  5EV6 A;  4BZ3 A;  3KNS A;  2BGA A;  3H3E A;  3SD9 A;  5ACT A;  1HLK A;  5DPX A;  3SPU A;  5HIS A;  3BC2 A;  3VPE A;  4BP0 A;  5EHT A;  3S0Z A;  3AJ3 A;  2YNT B;  4UBQ A;  2XF4 A;  3PY6 A;  2FU8 A;  4J5H A;  2ZZI A;  4Z60 A;  2P1E A;  2VW8 A;  4ZNB A;  2BG6 A;  1VJN A; 
#chains in the Genus database with same CATH topology
 3I14 A;  5AJL A;  2QIN A;  5FQA A;  2WYL A;  4RAW A;  3VQZ A;  2A7M A;  4CHL A;  5K4N A;  2FU9 A;  4TZB A;  1Y44 A;  1WW1 A;  2GKL A;  3I15 A;  2ZO4 A;  2CFU A;  2NZE A;  1A7T A;  5K4K A;  5A0T A;  1DXK A;  2BC2 A;  5AXO A;  3BK1 A;  2GFK A;  2OHH A;  3ZWF A;  4YSK A;  4F6Z A;  1BMC A;  4C1E A;  5LSC A;  2YNW A;  1DD6 A;  4FEK A;  4JO0 A;  4RBS A;  3I0V A;  1VGN A;  1WRA A;  5EW0 A;  3I11 A;  2QED A;  5K4M A;  3SRX A;  1BVT A;  5LE1 A;  2DOO A;  1JJT A;  4AXH A;  2ZNB A;  3X2X A;  4H0D A;  3R2U A;  3DHC A;  4EYF A;  1YCF A;  4EXY A;  2BG2 A;  3I13 A;  4Z5Z A;  4C1D A;  5A0V A;  3SFP A;  4RM5 A;  4KEP A;  5K0W A;  2BMI A;  5AXR A;  2P97 A;  5AHR A;  3SW3 A;  3IE2 A;  3ZNB A;  4D1U A;  4B87 A;  5EV8 A;  3MD7 A;  3X2Z A;  1X8G A;  2AIO A;  2Y87 A;  5FQC A;  4UWS B;  1P9E A;  4XUK A;  4C1F A;  5LMC A;  4TYF A;  3ZQ4 A;  4D02 A;  1BC2 A;  2YHE A;  5ACV A;  4Z5Y A;  5ACS A;  1JT1 A;  2DKF A;  2I7V A;  3FAI A;  3IOG A;  3T3N A;  4NQ4 A;  4KEQ A;  4LE6 A;  3PY5 A;  1X8H A;  2BFL A;  5KIL A;  4ZEJ A;  3JXP A;  1YCH A;  2CBN A;  4UAM A;  5FQB A;  2BFZ B;  4PVO A;  1KR3 A;  4J5F A;  3IOF A;  2QJS A;  5ACQ A;  4O98 A;  2QDS A;  5B15 A;  4C09 A;  1QH3 A;  2CG3 A;  2WRS A;  2ZWR A;  2WYM A;  2BG7 A;  4Z7R A;  2NZF A;  4GYU A;  4AD9 A;  1WUO A;  4AWZ A;  3BV6 A;  4YSL A;  5ACW A;  3WXC A;  4HKY A;  2GMN A;  4F6H A;  2CG2 A;  2YNV B;  3IEK A;  4WD6 A;  2QDT A;  1X8I A;  4DIL A;  2BG8 B;  4V0H A;  3IEM A;  5HIO A;  3T3O A;  4RL2 A;  3DH8 A;  1DDK A;  1KO3 A;  4EYB A;  5EVB A;  4AWY B;  4RAM A;  4C1H A;  4EY2 A;  2BTN A;  3AF5 A;  3QH8 A;  2I7X A;  3L6N A;  3RKJ A;  5IQK A;  4RL0 A;  4ZO3 A;  3DHA A;  3IE0 A;  5A87 A;  4TZE A;  2BG8 A;  5EWA A;  1ZTC A;  4Z67 A;  1YCG A;  2YNT A;  5LLD A;  3X2Y A;  3T9M A;  5HH6 A;  3ESH A;  1L9Y A;  5AHO A;  3A4Y A;  5EVD A;  2Q42 A;  4DIK A;  5AYA A;  2FU7 A;  2XR1 A;  4D1T A;  4NQ2 A;  1K07 A;  2FU6 A;  3SBL A;  2WYM C;  4FR7 A;  3PG4 A;  4D1W A;  4HL2 A;  5ACP A;  2OHJ A;  1KO2 A;  4Z6X A;  4UWO B;  4EFZ A;  3F9O A;  5EH9 A;  3RPC A;  1JJE A;  3IDZ A;  3IEL A;  4NUR A;  2Q0J A;  2BFZ A;  3IE1 A;  3KL7 A;  4UWR B;  2BR6 A;  2Y8B A;  2R2D A;  3BK2 A;  1VME A;  4TZ9 A;  1E5D A;  2HB9 A;  2FHX A;  2NXA A;  4P62 A;  4FSB A;  4ZO2 A;  5LCF A;  3ZR9 A;  1ZKP A;  2BFK A;  2YNV A;  4PDX A;  5LCA A;  1XTO A;  3AF6 A;  1M2X A;  1ZNB A;  5HH4 A;  5LS3 A;  3DHB A;  2I7T A;  2FK6 A;  2E7Y A;  4XWT A;  4XWW A;  2YNU A;  2Q9U A;  4PVT A;  4HL1 A;  3KNR A;  3RKK A;  4C1G A;  4EXS A;  2M5C A;  4TZF A;  3LVZ A;  2FM6 A;  4GYQ A;  2Q0I A;  5KIK A;  5LM6 A;  2YCB A;  5ACU A;  4GCW A;  2GFJ A;  4UA4 A;  1MQO A;  2NYP A;  5B3R A;  2YZ3 A;  4D1V A;  4EYL A;  3G1P A;  2P18 A;  4NQ6 A;  3TP9 A;  5HIP A;  5EVK A;  2BIB A;  2P4Z A;  2AZ4 A;  4AX0 B;  5A23 A;  5HIQ A;  1A8T A;  3X30 A;  2M5D A;  4TYT A;  2GCU A;  3P2U A;  5B1U A;  5ACR A;  2OHI A;  4UWP B;  1QH5 A;  4AX1 B;  4NQ5 A;  1WUP A;  5LCH A;  1XM8 A;  4C1C A;  3FCZ A;  3ADR A;  2Y8A A;  5HH5 A;  4YSB A;  5ACX A;  2UYX A;  5AEB A;  2H6A A;  2WHG A;  4U4L A;  5A5Z A;  3Q6V A;  2FHX B;  1SML A;  5EV6 A;  4BZ3 A;  3KNS A;  2BGA A;  2CFZ A;  3H3E A;  3SD9 A;  5ACT A;  1HLK A;  5DPX A;  3SPU A;  5HIS A;  3BC2 A;  3VPE A;  4BP0 A;  5EHT A;  3S0Z A;  3AJ3 A;  2YNT B;  4UBQ A;  2XF4 A;  3PY6 A;  2FU8 A;  4J5H A;  2ZZI A;  4Z60 A;  5AIJ A;  2P1E A;  4AV7 A;  2VW8 A;  4ZNB A;  2BG6 A;  1VJN A; 
#chains in the Genus database with same CATH homology
 3I14 A;  2QIN A;  5FQA A;  2WYL A;  4RAW A;  3VQZ A;  2A7M A;  4CHL A;  5K4N A;  2FU9 A;  4TZB A;  1Y44 A;  1WW1 A;  2GKL A;  3I15 A;  2ZO4 A;  2NZE A;  1A7T A;  5K4K A;  5A0T A;  1DXK A;  2BC2 A;  5AXO A;  3BK1 A;  2GFK A;  2OHH A;  3ZWF A;  4YSK A;  4F6Z A;  1BMC A;  4C1E A;  5LSC A;  2YNW A;  1DD6 A;  4FEK A;  4JO0 A;  4RBS A;  3I0V A;  1VGN A;  1WRA A;  5EW0 A;  3I11 A;  2QED A;  5K4M A;  3SRX A;  1BVT A;  5LE1 A;  2DOO A;  1JJT A;  2ZNB A;  3X2X A;  4H0D A;  3R2U A;  3DHC A;  4EYF A;  1YCF A;  4EXY A;  2BG2 A;  3I13 A;  4Z5Z A;  4C1D A;  5A0V A;  3SFP A;  4RM5 A;  4KEP A;  5K0W A;  2BMI A;  5AXR A;  2P97 A;  5AHR A;  3SW3 A;  3IE2 A;  3ZNB A;  4D1U A;  4B87 A;  5EV8 A;  3MD7 A;  3X2Z A;  1X8G A;  2AIO A;  2Y87 A;  5FQC A;  4UWS B;  1P9E A;  4XUK A;  4C1F A;  5LMC A;  4TYF A;  3ZQ4 A;  4D02 A;  1BC2 A;  5ACV A;  4Z5Y A;  5ACS A;  1JT1 A;  2DKF A;  2I7V A;  3FAI A;  3IOG A;  3T3N A;  4NQ4 A;  4KEQ A;  4LE6 A;  3PY5 A;  1X8H A;  2BFL A;  5KIL A;  4ZEJ A;  3JXP A;  1YCH A;  2CBN A;  4UAM A;  5FQB A;  2BFZ B;  4PVO A;  1KR3 A;  4J5F A;  3IOF A;  2QJS A;  5ACQ A;  4O98 A;  2QDS A;  5B15 A;  4C09 A;  1QH3 A;  2WRS A;  2ZWR A;  2WYM A;  2BG7 A;  4Z7R A;  2NZF A;  4GYU A;  4AD9 A;  1WUO A;  4AWZ A;  3BV6 A;  4YSL A;  5ACW A;  3WXC A;  4HKY A;  2GMN A;  4F6H A;  2YNV B;  3IEK A;  4WD6 A;  2QDT A;  1X8I A;  4DIL A;  2BG8 B;  4V0H A;  3IEM A;  5HIO A;  3T3O A;  4RL2 A;  3DH8 A;  1DDK A;  1KO3 A;  4EYB A;  5EVB A;  4AWY B;  4RAM A;  4C1H A;  4EY2 A;  2BTN A;  3AF5 A;  3QH8 A;  2I7X A;  3L6N A;  3RKJ A;  5IQK A;  4RL0 A;  4ZO3 A;  3DHA A;  3IE0 A;  5A87 A;  4TZE A;  2BG8 A;  5EWA A;  1ZTC A;  4Z67 A;  1YCG A;  5LLD A;  2YNT A;  3X2Y A;  3T9M A;  5HH6 A;  3ESH A;  1L9Y A;  5AHO A;  3A4Y A;  5EVD A;  2Q42 A;  4DIK A;  5AYA A;  2FU7 A;  2XR1 A;  4D1T A;  4NQ2 A;  1K07 A;  2FU6 A;  3SBL A;  2WYM C;  4FR7 A;  3PG4 A;  4D1W A;  4HL2 A;  5ACP A;  2OHJ A;  1KO2 A;  4Z6X A;  4UWO B;  4EFZ A;  3F9O A;  5EH9 A;  3RPC A;  1JJE A;  3IDZ A;  3IEL A;  2Q0J A;  2BFZ A;  3IE1 A;  3KL7 A;  4UWR B;  2BR6 A;  2Y8B A;  2R2D A;  3BK2 A;  1VME A;  4TZ9 A;  1E5D A;  2HB9 A;  2FHX A;  2NXA A;  4P62 A;  4FSB A;  4ZO2 A;  5LCF A;  3ZR9 A;  1ZKP A;  2BFK A;  2YNV A;  5LCA A;  1XTO A;  3AF6 A;  1M2X A;  1ZNB A;  5HH4 A;  5LS3 A;  3DHB A;  2I7T A;  2FK6 A;  2E7Y A;  4XWT A;  4XWW A;  2YNU A;  2Q9U A;  4PVT A;  4HL1 A;  3KNR A;  3RKK A;  4C1G A;  4EXS A;  2M5C A;  4TZF A;  3LVZ A;  2FM6 A;  4GYQ A;  2Q0I A;  5KIK A;  5LM6 A;  2YCB A;  5ACU A;  4GCW A;  2GFJ A;  4UA4 A;  1MQO A;  2NYP A;  5B3R A;  2YZ3 A;  4D1V A;  4EYL A;  3G1P A;  2P18 A;  4NQ6 A;  3TP9 A;  5HIP A;  5EVK A;  2BIB A;  2P4Z A;  2AZ4 A;  4AX0 B;  5HIQ A;  1A8T A;  3X30 A;  2M5D A;  4TYT A;  2GCU A;  3P2U A;  5B1U A;  5ACR A;  2OHI A;  4UWP B;  1QH5 A;  4AX1 B;  4NQ5 A;  1WUP A;  5LCH A;  1XM8 A;  4C1C A;  3FCZ A;  3ADR A;  2Y8A A;  5HH5 A;  4YSB A;  5ACX A;  2UYX A;  5AEB A;  2H6A A;  2WHG A;  4U4L A;  5A5Z A;  3Q6V A;  2FHX B;  1SML A;  5EV6 A;  4BZ3 A;  3KNS A;  2BGA A;  3H3E A;  3SD9 A;  5ACT A;  1HLK A;  5DPX A;  3SPU A;  5HIS A;  3BC2 A;  3VPE A;  4BP0 A;  5EHT A;  3S0Z A;  3AJ3 A;  2YNT B;  4UBQ A;  2XF4 A;  3PY6 A;  2FU8 A;  4J5H A;  2ZZI A;  4Z60 A;  2P1E A;  2VW8 A;  4ZNB A;  2BG6 A;  1VJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...