3JXPA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
304
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGRMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PqqB from Pseudomonas putida at 2.2 A resolution
doi rcsb
source organism Pseudomonas putida
molecule tags Biosynthetic protein
molecule keywords Coenzyme PQQ synthesis protein B
total genus 101
structure length 304
sequence length 305
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3jxpA00
4DIKA 4KEQA 4AX1B 4C1DA 2YNVA 2OHHA 3IELA 5HIPA 2YNUA 3KNRA 5ACWA 5LLDA 5AHRA 4EYLA 4ZEJA 2ZZIA 1XM8A 4J5FA 1X8HA 4TZBA 3IOFA 2QEDA 5ACXA 2BG8B 5LSCA 4Z5ZA 3SRXA 2NXAA 3PY5A 4AWZA 5HH6A 5A0VA 2NZFA 4HKYA 4C1CA 5EV8A 5K0WA 5A0TA 2ZWRA 4YSKA 4DILA 5B15A 5EVBA 1YCFA 4AD9A 3SD9A 2Q42A 3X2ZA 5FQAA 4H0DA 4B87A 1X8GA 2AZ4A 2BG6A 4EXSA 4D1UA 1KR3A 2YCBA 4UA4A 2Y8BA 3KNSA 2BG7A 3AF6A 3WXCA 5B1UA 2VW8A 3AJ3A 3LVZA 3IEMA 4JO0A 4RAWA 1YCGA 2YNWA 3DH8A 4AWYB 2OHJA 4Z60A 5HISA 5B3RA 5K4KA 1ZNBA 1QH3A 3MD7A 2WYMC 4EY2A 3F9OA 1VMEA 5LM6A 2WYMA 5ACSA 1DXKA 2BIBA 2WRSA 3I13A 1WUPA 2GMNA 4RL2A 3BK1A 4TZFA 4GCWA 1VGNA 5EV6A 2OHIA 5HH5A 2BR6A 4EFZA 4BZ3A 2Y87A 4FEKA 4Z7RA 2UYXA 2Q9UA 2WYLA 4AX0B 1YCHA 4FSBA 2QJSA 1JJTA 2GFJA 1L9YA 1SMLA 4HL2A 4FR7A 5EW0A 2Y8AA 3I11A 5ACUA 3AF5A 5KIKA 2P4ZA 3ADRA 5A87A 2P1EA 3T3NA 4XWTA 4ZNBA 3ESHA 1HLKA 2QDSA 4D1TA 4U4LA 5LMCA 3BC2A 4EYFA 3SPUA 4D02A 1DDKA 2ZO4A 4C1FA 3R2UA 4NQ4A 4BP0A 2M5DA 3ZWFA 2GFKA 3T9MA 3IE2A 4Z6XA 3I14A 2GKLA 3ZQ4A 2I7XA 4C09A 1QH5A 3Q6VA 5IQKA 4UWOB 3VQZA 4GYUA 2BFLA 4RBSA 2QDTA 5AXOA 4CHLA 3T3OA 2R2DA 4RM5A 4TZEA 5A5ZA 4EYBA 5EHTA 2XR1A 3RKKA 5FQBA 2GCUA 1A7TA 4NQ5A 4O98A 2H6AA 4PVOA 2NZEA 1E5DA 2FM6A 3X2YA 4EXYA 5K4MA 4UBQA 2BG2A 5LE1A 5FQCA 4C1GA 4XWWA 4TYTA 2P97A 3DHAA 3DHBA 3JXPA 2YNTB 1A8TA 5AHOA 3RPCA 4TYFA 4F6HA 2BGAA 4C1HA 1JJEA 2BG8A 4WD6A 3IOGA 1P9EA 5EVDA 3IE0A 3H3EA 4TZ9A 5HIOA 3SW3A 3A4YA 3PY6A 2FU8A 4GYQA 2BC2A 1WRAA 3G1PA 4XUKA 3TP9A 3BK2A 3SBLA 2YZ3A 5ACQA 5HH4A 2M5CA 5LS3A 3PG4A 3IDZA 4J5HA 1ZKPA 2Q0IA 3FCZA 4D1WA 2E7YA 1BMCA 1KO3A 3ZNBA 4UWSB 4V0HA 1M2XA 2BFZB 2P18A 3X2XA 2FHXB 5K4NA 4KEPA 5KILA 2FU9A 5ACPA 3FAIA 4UWPB 3L6NA 1K07A 4YSBA 3SFPA 2ZNBA 2BTNA 3QH8A 1JT1A 5AXRA 1Y44A 1ZTCA 2YNVB 5EH9A 4YSLA 2NYPA 3X30A 5AEBA 3RKJA 3S0ZA 3BV6A 1X8IA 2HB9A 1MQOA 2YNTA 2I7TA 1BVTA 2WHGA 5ACRA 1WUOA 4NQ6A 4D1VA 3IE1A 2FU6A 4Z5YA 4C1EA 4PVTA 3VPEA 4HL1A 3KL7A 5DPXA 2QINA 2CBNA 5AYAA 4UWRB 2BMIA 4ZO2A 4P62A 3DHCA 4ZO3A 2XF4A 2FK6A 5LCFA 2DOOA 4RL0A 5ACVA 3P2UA 5LCAA 1BC2A 4RAMA 2I7VA 2BFZA 5ACTA 3I0VA 2Q0JA 2AIOA 1VJNA 3ZR9A 4Z67A 3I15A 2BFKA 4UAMA 4LE6A 1XTOA 1WW1A 3IEKA 2FU7A 4F6ZA 5LCHA 2A7MA 2DKFA 4NQ2A 2FHXA 1KO2A 5EWAA 5HIQA 1DD6A 5EVKA
chains in the Genus database with same CATH superfamily
4DIKA 4KEQA 4AX1B 4C1DA 2YNVA 2OHHA 3IELA 5HIPA 2YNUA 3KNRA 5ACWA 5LLDA 5AHRA 4EYLA 4ZEJA 2ZZIA 1XM8A 4J5FA 1X8HA 4TZBA 3IOFA 2QEDA 2CFZA 2CFUA 5ACXA 2BG8B 5LSCA 4Z5ZA 3SRXA 2NXAA 3PY5A 4AWZA 5HH6A 5A0VA 2NZFA 4HKYA 4C1CA 5EV8A 5K0WA 5A0TA 2ZWRA 4YSKA 4DILA 5B15A 5EVBA 4NURA 1YCFA 4AD9A 3SD9A 2Q42A 3X2ZA 5FQAA 4H0DA 4B87A 1X8GA 2AZ4A 2BG6A 4EXSA 4D1UA 1KR3A 2YCBA 4UA4A 2Y8BA 3KNSA 2BG7A 3AF6A 3WXCA 5B1UA 2VW8A 3AJ3A 3LVZA 3IEMA 4JO0A 4RAWA 1YCGA 2YNWA 3DH8A 4AWYB 2OHJA 4Z60A 5HISA 5B3RA 5K4KA 1ZNBA 1QH3A 3MD7A 2WYMC 4EY2A 3F9OA 1VMEA 5LM6A 2WYMA 5ACSA 1DXKA 2BIBA 2WRSA 3I13A 1WUPA 2GMNA 4RL2A 3BK1A 4TZFA 4PDXA 4GCWA 1VGNA 5EV6A 2OHIA 5HH5A 2BR6A 4EFZA 4BZ3A 2Y87A 4FEKA 4Z7RA 2UYXA 2Q9UA 2WYLA 4AX0B 1YCHA 4FSBA 2CG3A 2QJSA 1JJTA 2GFJA 1L9YA 1SMLA 4HL2A 4FR7A 5EW0A 2Y8AA 3I11A 5ACUA 3AF5A 5KIKA 2P4ZA 3ADRA 5A87A 2CG2A 2P1EA 3T3NA 4XWTA 4ZNBA 3ESHA 1HLKA 2QDSA 4D1TA 4U4LA 5LMCA 3BC2A 4EYFA 3SPUA 4D02A 1DDKA 2ZO4A 4C1FA 3R2UA 4NQ4A 4BP0A 2M5DA 3ZWFA 2GFKA 3T9MA 3IE2A 4Z6XA 3I14A 2GKLA 3ZQ4A 2I7XA 4C09A 1QH5A 3Q6VA 5IQKA 4UWOB 3VQZA 4GYUA 2BFLA 4RBSA 2QDTA 5AXOA 4CHLA 3T3OA 2R2DA 4RM5A 4TZEA 2YHEA 5A5ZA 4EYBA 5EHTA 2XR1A 3RKKA 5FQBA 2GCUA 1A7TA 4NQ5A 4O98A 2H6AA 4PVOA 2NZEA 1E5DA 2FM6A 3X2YA 4EXYA 5K4MA 4UBQA 2BG2A 5LE1A 5FQCA 4C1GA 4XWWA 4TYTA 2P97A 3DHAA 3DHBA 3JXPA 2YNTB 1A8TA 5AHOA 3RPCA 4TYFA 4F6HA 2BGAA 4C1HA 1JJEA 2BG8A 4WD6A 5A23A 3IOGA 1P9EA 5EVDA 3IE0A 3H3EA 4TZ9A 4AXHA 5HIOA 3SW3A 3A4YA 3PY6A 2FU8A 4GYQA 2BC2A 1WRAA 3G1PA 4XUKA 3TP9A 3BK2A 3SBLA 2YZ3A 5ACQA 4AV7A 5HH4A 2M5CA 5LS3A 3PG4A 3IDZA 4J5HA 1ZKPA 2Q0IA 3FCZA 4D1WA 2E7YA 1BMCA 1KO3A 3ZNBA 4UWSB 4V0HA 1M2XA 2BFZB 2P18A 3X2XA 2FHXB 5K4NA 4KEPA 5KILA 2FU9A 5ACPA 5AIJA 3FAIA 4UWPB 3L6NA 1K07A 4YSBA 3SFPA 5AJLA 2ZNBA 2BTNA 3QH8A 1JT1A 5AXRA 1Y44A 1ZTCA 2YNVB 5EH9A 4YSLA 2NYPA 3X30A 5AEBA 3RKJA 3S0ZA 3BV6A 1X8IA 2HB9A 1MQOA 2YNTA 2I7TA 1BVTA 2WHGA 5ACRA 1WUOA 4NQ6A 4D1VA 3IE1A 2FU6A 4Z5YA 4C1EA 4PVTA 3VPEA 4HL1A 3KL7A 5DPXA 2QINA 2CBNA 5AYAA 4UWRB 2BMIA 4ZO2A 4P62A 3DHCA 4ZO3A 2XF4A 2FK6A 5LCFA 2DOOA 4RL0A 5ACVA 3P2UA 5LCAA 1BC2A 4RAMA 2I7VA 2BFZA 5ACTA 3I0VA 2Q0JA 2AIOA 1VJNA 3ZR9A 4Z67A 3I15A 2BFKA 4UAMA 4LE6A 1XTOA 1WW1A 3IEKA 2FU7A 4F6ZA 5LCHA 2A7MA 2DKFA 4NQ2A 2FHXA 1KO2A 5EWAA 5HIQA 1DD6A 5EVKA
chains in the Genus database with same CATH topology
4DIKA 4KEQA 4AX1B 4C1DA 2YNVA 2OHHA 3IELA 5HIPA 2YNUA 3KNRA 5ACWA 5LLDA 5AHRA 4EYLA 4ZEJA 2ZZIA 1XM8A 4J5FA 1X8HA 4TZBA 3IOFA 2QEDA 5ACXA 2BG8B 5LSCA 4Z5ZA 3SRXA 2NXAA 3PY5A 4AWZA 5HH6A 5A0VA 2NZFA 4HKYA 4C1CA 5EV8A 5K0WA 5A0TA 2ZWRA 4YSKA 4DILA 5B15A 5EVBA 1YCFA 4AD9A 3SD9A 2Q42A 3X2ZA 5FQAA 4H0DA 4B87A 1X8GA 2AZ4A 2BG6A 4EXSA 4D1UA 1KR3A 2YCBA 4UA4A 2Y8BA 3KNSA 2BG7A 3AF6A 3WXCA 5B1UA 2VW8A 3AJ3A 3LVZA 3IEMA 4JO0A 4RAWA 1YCGA 2YNWA 3DH8A 4AWYB 2OHJA 4Z60A 5HISA 5B3RA 5K4KA 1ZNBA 1QH3A 3MD7A 2WYMC 4EY2A 3F9OA 1VMEA 5LM6A 2WYMA 5ACSA 1DXKA 2BIBA 2WRSA 3I13A 1WUPA 2GMNA 4RL2A 3BK1A 4TZFA 4GCWA 1VGNA 5EV6A 2OHIA 5HH5A 2BR6A 4EFZA 4BZ3A 2Y87A 4FEKA 4Z7RA 2UYXA 2Q9UA 2WYLA 4AX0B 1YCHA 4FSBA 2QJSA 1JJTA 2GFJA 1L9YA 1SMLA 4HL2A 4FR7A 5EW0A 2Y8AA 3I11A 5ACUA 3AF5A 5KIKA 2P4ZA 3ADRA 5A87A 2P1EA 3T3NA 4XWTA 4ZNBA 3ESHA 1HLKA 2QDSA 4D1TA 4U4LA 5LMCA 3BC2A 4EYFA 3SPUA 4D02A 1DDKA 2ZO4A 4C1FA 3R2UA 4NQ4A 4BP0A 2M5DA 3ZWFA 2GFKA 3T9MA 3IE2A 4Z6XA 3I14A 2GKLA 3ZQ4A 2I7XA 4C09A 1QH5A 3Q6VA 5IQKA 4UWOB 3VQZA 4GYUA 2BFLA 4RBSA 2QDTA 5AXOA 4CHLA 3T3OA 2R2DA 4RM5A 4TZEA 5A5ZA 4EYBA 5EHTA 2XR1A 3RKKA 5FQBA 2GCUA 1A7TA 4NQ5A 4O98A 2H6AA 4PVOA 2NZEA 1E5DA 2FM6A 3X2YA 4EXYA 5K4MA 4UBQA 2BG2A 5LE1A 5FQCA 4C1GA 4XWWA 4TYTA 2P97A 3DHAA 3DHBA 3JXPA 2YNTB 1A8TA 5AHOA 3RPCA 4TYFA 4F6HA 2BGAA 4C1HA 1JJEA 2BG8A 4WD6A 3IOGA 1P9EA 5EVDA 3IE0A 3H3EA 4TZ9A 5HIOA 3SW3A 3A4YA 3PY6A 2FU8A 4GYQA 2BC2A 1WRAA 3G1PA 4XUKA 3TP9A 3BK2A 3SBLA 2YZ3A 5ACQA 5HH4A 2M5CA 5LS3A 3PG4A 3IDZA 4J5HA 1ZKPA 2Q0IA 3FCZA 4D1WA 2E7YA 1BMCA 1KO3A 3ZNBA 4UWSB 4V0HA 1M2XA 2BFZB 2P18A 3X2XA 2FHXB 5K4NA 4KEPA 5KILA 2FU9A 5ACPA 3FAIA 4UWPB 3L6NA 1K07A 4YSBA 3SFPA 2ZNBA 2BTNA 3QH8A 1JT1A 5AXRA 1Y44A 1ZTCA 2YNVB 5EH9A 4YSLA 2NYPA 3X30A 5AEBA 3RKJA 3S0ZA 3BV6A 1X8IA 2HB9A 1MQOA 2YNTA 2I7TA 1BVTA 2WHGA 5ACRA 1WUOA 4NQ6A 4D1VA 3IE1A 2FU6A 4Z5YA 4C1EA 4PVTA 3VPEA 4HL1A 3KL7A 5DPXA 2QINA 2CBNA 5AYAA 4UWRB 2BMIA 4ZO2A 4P62A 3DHCA 4ZO3A 2XF4A 2FK6A 5LCFA 2DOOA 4RL0A 5ACVA 3P2UA 5LCAA 1BC2A 4RAMA 2I7VA 2BFZA 5ACTA 3I0VA 2Q0JA 2AIOA 1VJNA 3ZR9A 4Z67A 3I15A 2BFKA 4UAMA 4LE6A 1XTOA 1WW1A 3IEKA 2FU7A 4F6ZA 5LCHA 2A7MA 2DKFA 4NQ2A 2FHXA 1KO2A 5EWAA 5HIQA 1DD6A 5EVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DIK A;  4KEQ A;  4AX1 B;  4C1D A;  2YNV A;  2OHH A;  3IEL A;  5HIP A;  2YNU A;  3KNR A;  5ACW A;  5LLD A;  5AHR A;  4EYL A;  4ZEJ A;  2ZZI A;  1XM8 A;  4J5F A;  1X8H A;  4TZB A;  3IOF A;  2QED A;  5ACX A;  2BG8 B;  5LSC A;  4Z5Z A;  3SRX A;  2NXA A;  3PY5 A;  4AWZ A;  5HH6 A;  5A0V A;  2NZF A;  4HKY A;  4C1C A;  5EV8 A;  5K0W A;  5A0T A;  2ZWR A;  4YSK A;  4DIL A;  5B15 A;  5EVB A;  1YCF A;  4AD9 A;  3SD9 A;  2Q42 A;  3X2Z A;  5FQA A;  4H0D A;  4B87 A;  1X8G A;  2AZ4 A;  2BG6 A;  4EXS A;  4D1U A;  1KR3 A;  2YCB A;  4UA4 A;  2Y8B A;  3KNS A;  2BG7 A;  3AF6 A;  3WXC A;  5B1U A;  2VW8 A;  3AJ3 A;  3LVZ A;  3IEM A;  4JO0 A;  4RAW A;  1YCG A;  2YNW A;  3DH8 A;  4AWY B;  2OHJ A;  4Z60 A;  5HIS A;  5B3R A;  5K4K A;  1ZNB A;  1QH3 A;  3MD7 A;  2WYM C;  4EY2 A;  3F9O A;  1VME A;  5LM6 A;  2WYM A;  5ACS A;  1DXK A;  2BIB A;  2WRS A;  3I13 A;  1WUP A;  2GMN A;  4RL2 A;  3BK1 A;  4TZF A;  4GCW A;  1VGN A;  5EV6 A;  2OHI A;  5HH5 A;  2BR6 A;  4EFZ A;  4BZ3 A;  2Y87 A;  4FEK A;  4Z7R A;  2UYX A;  2Q9U A;  2WYL A;  4AX0 B;  1YCH A;  4FSB A;  2QJS A;  1JJT A;  2GFJ A;  1L9Y A;  1SML A;  4HL2 A;  4FR7 A;  5EW0 A;  2Y8A A;  3I11 A;  5ACU A;  3AF5 A;  5KIK A;  2P4Z A;  3ADR A;  5A87 A;  2P1E A;  3T3N A;  4XWT A;  4ZNB A;  3ESH A;  1HLK A;  2QDS A;  4D1T A;  4U4L A;  5LMC A;  3BC2 A;  4EYF A;  3SPU A;  4D02 A;  1DDK A;  2ZO4 A;  4C1F A;  3R2U A;  4NQ4 A;  4BP0 A;  2M5D A;  3ZWF A;  2GFK A;  3T9M A;  3IE2 A;  4Z6X A;  3I14 A;  2GKL A;  3ZQ4 A;  2I7X A;  4C09 A;  1QH5 A;  3Q6V A;  5IQK A;  4UWO B;  3VQZ A;  4GYU A;  2BFL A;  4RBS A;  2QDT A;  5AXO A;  4CHL A;  3T3O A;  2R2D A;  4RM5 A;  4TZE A;  5A5Z A;  4EYB A;  5EHT A;  2XR1 A;  3RKK A;  5FQB A;  2GCU A;  1A7T A;  4NQ5 A;  4O98 A;  2H6A A;  4PVO A;  2NZE A;  1E5D A;  2FM6 A;  3X2Y A;  4EXY A;  5K4M A;  4UBQ A;  2BG2 A;  5LE1 A;  5FQC A;  4C1G A;  4XWW A;  4TYT A;  2P97 A;  3DHA A;  3DHB A;  3JXP A;  2YNT B;  1A8T A;  5AHO A;  3RPC A;  4TYF A;  4F6H A;  2BGA A;  4C1H A;  1JJE A;  2BG8 A;  4WD6 A;  3IOG A;  1P9E A;  5EVD A;  3IE0 A;  3H3E A;  4TZ9 A;  5HIO A;  3SW3 A;  3A4Y A;  3PY6 A;  2FU8 A;  4GYQ A;  2BC2 A;  1WRA A;  3G1P A;  4XUK A;  3TP9 A;  3BK2 A;  3SBL A;  2YZ3 A;  5ACQ A;  5HH4 A;  2M5C A;  5LS3 A;  3PG4 A;  3IDZ A;  4J5H A;  1ZKP A;  2Q0I A;  3FCZ A;  4D1W A;  2E7Y A;  1BMC A;  1KO3 A;  3ZNB A;  4UWS B;  4V0H A;  1M2X A;  2BFZ B;  2P18 A;  3X2X A;  2FHX B;  5K4N A;  4KEP A;  5KIL A;  2FU9 A;  5ACP A;  3FAI A;  4UWP B;  3L6N A;  1K07 A;  4YSB A;  3SFP A;  2ZNB A;  2BTN A;  3QH8 A;  1JT1 A;  5AXR A;  1Y44 A;  1ZTC A;  2YNV B;  5EH9 A;  4YSL A;  2NYP A;  3X30 A;  5AEB A;  3RKJ A;  3S0Z A;  3BV6 A;  1X8I A;  2HB9 A;  1MQO A;  2YNT A;  2I7T A;  1BVT A;  2WHG A;  5ACR A;  1WUO A;  4NQ6 A;  4D1V A;  3IE1 A;  2FU6 A;  4Z5Y A;  4C1E A;  4PVT A;  3VPE A;  4HL1 A;  3KL7 A;  5DPX A;  2QIN A;  2CBN A;  5AYA A;  4UWR B;  2BMI A;  4ZO2 A;  4P62 A;  3DHC A;  4ZO3 A;  2XF4 A;  2FK6 A;  5LCF A;  2DOO A;  4RL0 A;  5ACV A;  3P2U A;  5LCA A;  1BC2 A;  4RAM A;  2I7V A;  2BFZ A;  5ACT A;  3I0V A;  2Q0J A;  2AIO A;  1VJN A;  3ZR9 A;  4Z67 A;  3I15 A;  2BFK A;  4UAM A;  4LE6 A;  1XTO A;  1WW1 A;  3IEK A;  2FU7 A;  4F6Z A;  5LCH A;  2A7M A;  2DKF A;  4NQ2 A;  2FHX A;  1KO2 A;  5EWA A;  5HIQ A;  1DD6 A;  5EVK A; 
#chains in the Genus database with same CATH topology
 4DIK A;  4KEQ A;  4AX1 B;  4C1D A;  2YNV A;  2OHH A;  3IEL A;  5HIP A;  2YNU A;  3KNR A;  5ACW A;  5LLD A;  5AHR A;  4EYL A;  4ZEJ A;  2ZZI A;  1XM8 A;  4J5F A;  1X8H A;  4TZB A;  3IOF A;  2QED A;  2CFZ A;  2CFU A;  5ACX A;  2BG8 B;  5LSC A;  4Z5Z A;  3SRX A;  2NXA A;  3PY5 A;  4AWZ A;  5HH6 A;  5A0V A;  2NZF A;  4HKY A;  4C1C A;  5EV8 A;  5K0W A;  5A0T A;  2ZWR A;  4YSK A;  4DIL A;  5B15 A;  5EVB A;  4NUR A;  1YCF A;  4AD9 A;  3SD9 A;  2Q42 A;  3X2Z A;  5FQA A;  4H0D A;  4B87 A;  1X8G A;  2AZ4 A;  2BG6 A;  4EXS A;  4D1U A;  1KR3 A;  2YCB A;  4UA4 A;  2Y8B A;  3KNS A;  2BG7 A;  3AF6 A;  3WXC A;  5B1U A;  2VW8 A;  3AJ3 A;  3LVZ A;  3IEM A;  4JO0 A;  4RAW A;  1YCG A;  2YNW A;  3DH8 A;  4AWY B;  2OHJ A;  4Z60 A;  5HIS A;  5B3R A;  5K4K A;  1ZNB A;  1QH3 A;  3MD7 A;  2WYM C;  4EY2 A;  3F9O A;  1VME A;  5LM6 A;  2WYM A;  5ACS A;  1DXK A;  2BIB A;  2WRS A;  3I13 A;  1WUP A;  2GMN A;  4RL2 A;  3BK1 A;  4TZF A;  4PDX A;  4GCW A;  1VGN A;  5EV6 A;  2OHI A;  5HH5 A;  2BR6 A;  4EFZ A;  4BZ3 A;  2Y87 A;  4FEK A;  4Z7R A;  2UYX A;  2Q9U A;  2WYL A;  4AX0 B;  1YCH A;  4FSB A;  2CG3 A;  2QJS A;  1JJT A;  2GFJ A;  1L9Y A;  1SML A;  4HL2 A;  4FR7 A;  5EW0 A;  2Y8A A;  3I11 A;  5ACU A;  3AF5 A;  5KIK A;  2P4Z A;  3ADR A;  5A87 A;  2CG2 A;  2P1E A;  3T3N A;  4XWT A;  4ZNB A;  3ESH A;  1HLK A;  2QDS A;  4D1T A;  4U4L A;  5LMC A;  3BC2 A;  4EYF A;  3SPU A;  4D02 A;  1DDK A;  2ZO4 A;  4C1F A;  3R2U A;  4NQ4 A;  4BP0 A;  2M5D A;  3ZWF A;  2GFK A;  3T9M A;  3IE2 A;  4Z6X A;  3I14 A;  2GKL A;  3ZQ4 A;  2I7X A;  4C09 A;  1QH5 A;  3Q6V A;  5IQK A;  4UWO B;  3VQZ A;  4GYU A;  2BFL A;  4RBS A;  2QDT A;  5AXO A;  4CHL A;  3T3O A;  2R2D A;  4RM5 A;  4TZE A;  2YHE A;  5A5Z A;  4EYB A;  5EHT A;  2XR1 A;  3RKK A;  5FQB A;  2GCU A;  1A7T A;  4NQ5 A;  4O98 A;  2H6A A;  4PVO A;  2NZE A;  1E5D A;  2FM6 A;  3X2Y A;  4EXY A;  5K4M A;  4UBQ A;  2BG2 A;  5LE1 A;  5FQC A;  4C1G A;  4XWW A;  4TYT A;  2P97 A;  3DHA A;  3DHB A;  3JXP A;  2YNT B;  1A8T A;  5AHO A;  3RPC A;  4TYF A;  4F6H A;  2BGA A;  4C1H A;  1JJE A;  2BG8 A;  4WD6 A;  5A23 A;  3IOG A;  1P9E A;  5EVD A;  3IE0 A;  3H3E A;  4TZ9 A;  4AXH A;  5HIO A;  3SW3 A;  3A4Y A;  3PY6 A;  2FU8 A;  4GYQ A;  2BC2 A;  1WRA A;  3G1P A;  4XUK A;  3TP9 A;  3BK2 A;  3SBL A;  2YZ3 A;  5ACQ A;  4AV7 A;  5HH4 A;  2M5C A;  5LS3 A;  3PG4 A;  3IDZ A;  4J5H A;  1ZKP A;  2Q0I A;  3FCZ A;  4D1W A;  2E7Y A;  1BMC A;  1KO3 A;  3ZNB A;  4UWS B;  4V0H A;  1M2X A;  2BFZ B;  2P18 A;  3X2X A;  2FHX B;  5K4N A;  4KEP A;  5KIL A;  2FU9 A;  5ACP A;  5AIJ A;  3FAI A;  4UWP B;  3L6N A;  1K07 A;  4YSB A;  3SFP A;  5AJL A;  2ZNB A;  2BTN A;  3QH8 A;  1JT1 A;  5AXR A;  1Y44 A;  1ZTC A;  2YNV B;  5EH9 A;  4YSL A;  2NYP A;  3X30 A;  5AEB A;  3RKJ A;  3S0Z A;  3BV6 A;  1X8I A;  2HB9 A;  1MQO A;  2YNT A;  2I7T A;  1BVT A;  2WHG A;  5ACR A;  1WUO A;  4NQ6 A;  4D1V A;  3IE1 A;  2FU6 A;  4Z5Y A;  4C1E A;  4PVT A;  3VPE A;  4HL1 A;  3KL7 A;  5DPX A;  2QIN A;  2CBN A;  5AYA A;  4UWR B;  2BMI A;  4ZO2 A;  4P62 A;  3DHC A;  4ZO3 A;  2XF4 A;  2FK6 A;  5LCF A;  2DOO A;  4RL0 A;  5ACV A;  3P2U A;  5LCA A;  1BC2 A;  4RAM A;  2I7V A;  2BFZ A;  5ACT A;  3I0V A;  2Q0J A;  2AIO A;  1VJN A;  3ZR9 A;  4Z67 A;  3I15 A;  2BFK A;  4UAM A;  4LE6 A;  1XTO A;  1WW1 A;  3IEK A;  2FU7 A;  4F6Z A;  5LCH A;  2A7M A;  2DKF A;  4NQ2 A;  2FHX A;  1KO2 A;  5EWA A;  5HIQ A;  1DD6 A;  5EVK A; 
#chains in the Genus database with same CATH homology
 4DIK A;  4KEQ A;  4AX1 B;  4C1D A;  2YNV A;  2OHH A;  3IEL A;  5HIP A;  2YNU A;  3KNR A;  5ACW A;  5LLD A;  5AHR A;  4EYL A;  4ZEJ A;  2ZZI A;  1XM8 A;  4J5F A;  1X8H A;  4TZB A;  3IOF A;  2QED A;  5ACX A;  2BG8 B;  5LSC A;  4Z5Z A;  3SRX A;  2NXA A;  3PY5 A;  4AWZ A;  5HH6 A;  5A0V A;  2NZF A;  4HKY A;  4C1C A;  5EV8 A;  5K0W A;  5A0T A;  2ZWR A;  4YSK A;  4DIL A;  5B15 A;  5EVB A;  1YCF A;  4AD9 A;  3SD9 A;  2Q42 A;  3X2Z A;  5FQA A;  4H0D A;  4B87 A;  1X8G A;  2AZ4 A;  2BG6 A;  4EXS A;  4D1U A;  1KR3 A;  2YCB A;  4UA4 A;  2Y8B A;  3KNS A;  2BG7 A;  3AF6 A;  3WXC A;  5B1U A;  2VW8 A;  3AJ3 A;  3LVZ A;  3IEM A;  4JO0 A;  4RAW A;  1YCG A;  2YNW A;  3DH8 A;  4AWY B;  2OHJ A;  4Z60 A;  5HIS A;  5B3R A;  5K4K A;  1ZNB A;  1QH3 A;  3MD7 A;  2WYM C;  4EY2 A;  3F9O A;  1VME A;  5LM6 A;  2WYM A;  5ACS A;  1DXK A;  2BIB A;  2WRS A;  3I13 A;  1WUP A;  2GMN A;  4RL2 A;  3BK1 A;  4TZF A;  4GCW A;  1VGN A;  5EV6 A;  2OHI A;  5HH5 A;  2BR6 A;  4EFZ A;  4BZ3 A;  2Y87 A;  4FEK A;  4Z7R A;  2UYX A;  2Q9U A;  2WYL A;  4AX0 B;  1YCH A;  4FSB A;  2QJS A;  1JJT A;  2GFJ A;  1L9Y A;  1SML A;  4HL2 A;  4FR7 A;  5EW0 A;  2Y8A A;  3I11 A;  5ACU A;  3AF5 A;  5KIK A;  2P4Z A;  3ADR A;  5A87 A;  2P1E A;  3T3N A;  4XWT A;  4ZNB A;  3ESH A;  1HLK A;  2QDS A;  4D1T A;  4U4L A;  5LMC A;  3BC2 A;  4EYF A;  3SPU A;  4D02 A;  1DDK A;  2ZO4 A;  4C1F A;  3R2U A;  4NQ4 A;  4BP0 A;  2M5D A;  3ZWF A;  2GFK A;  3T9M A;  3IE2 A;  4Z6X A;  3I14 A;  2GKL A;  3ZQ4 A;  2I7X A;  4C09 A;  1QH5 A;  3Q6V A;  5IQK A;  4UWO B;  3VQZ A;  4GYU A;  2BFL A;  4RBS A;  2QDT A;  5AXO A;  4CHL A;  3T3O A;  2R2D A;  4RM5 A;  4TZE A;  5A5Z A;  4EYB A;  5EHT A;  2XR1 A;  3RKK A;  5FQB A;  2GCU A;  1A7T A;  4NQ5 A;  4O98 A;  2H6A A;  4PVO A;  2NZE A;  1E5D A;  2FM6 A;  3X2Y A;  4EXY A;  5K4M A;  4UBQ A;  2BG2 A;  5LE1 A;  5FQC A;  4C1G A;  4XWW A;  4TYT A;  2P97 A;  3DHA A;  3DHB A;  3JXP A;  2YNT B;  1A8T A;  5AHO A;  3RPC A;  4TYF A;  4F6H A;  2BGA A;  4C1H A;  1JJE A;  2BG8 A;  4WD6 A;  3IOG A;  1P9E A;  5EVD A;  3IE0 A;  3H3E A;  4TZ9 A;  5HIO A;  3SW3 A;  3A4Y A;  3PY6 A;  2FU8 A;  4GYQ A;  2BC2 A;  1WRA A;  3G1P A;  4XUK A;  3TP9 A;  3BK2 A;  3SBL A;  2YZ3 A;  5ACQ A;  5HH4 A;  2M5C A;  5LS3 A;  3PG4 A;  3IDZ A;  4J5H A;  1ZKP A;  2Q0I A;  3FCZ A;  4D1W A;  2E7Y A;  1BMC A;  1KO3 A;  3ZNB A;  4UWS B;  4V0H A;  1M2X A;  2BFZ B;  2P18 A;  3X2X A;  2FHX B;  5K4N A;  4KEP A;  5KIL A;  2FU9 A;  5ACP A;  3FAI A;  4UWP B;  3L6N A;  1K07 A;  4YSB A;  3SFP A;  2ZNB A;  2BTN A;  3QH8 A;  1JT1 A;  5AXR A;  1Y44 A;  1ZTC A;  2YNV B;  5EH9 A;  4YSL A;  2NYP A;  3X30 A;  5AEB A;  3RKJ A;  3S0Z A;  3BV6 A;  1X8I A;  2HB9 A;  1MQO A;  2YNT A;  2I7T A;  1BVT A;  2WHG A;  5ACR A;  1WUO A;  4NQ6 A;  4D1V A;  3IE1 A;  2FU6 A;  4Z5Y A;  4C1E A;  4PVT A;  3VPE A;  4HL1 A;  3KL7 A;  5DPX A;  2QIN A;  2CBN A;  5AYA A;  4UWR B;  2BMI A;  4ZO2 A;  4P62 A;  3DHC A;  4ZO3 A;  2XF4 A;  2FK6 A;  5LCF A;  2DOO A;  4RL0 A;  5ACV A;  3P2U A;  5LCA A;  1BC2 A;  4RAM A;  2I7V A;  2BFZ A;  5ACT A;  3I0V A;  2Q0J A;  2AIO A;  1VJN A;  3ZR9 A;  4Z67 A;  3I15 A;  2BFK A;  4UAM A;  4LE6 A;  1XTO A;  1WW1 A;  3IEK A;  2FU7 A;  4F6Z A;  5LCH A;  2A7M A;  2DKF A;  4NQ2 A;  2FHX A;  1KO2 A;  5EWA A;  5HIQ A;  1DD6 A;  5EVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...