3JXPA

Crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
305
structure length
304
Chain Sequence
b'MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGRMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
molecule tags Biosynthetic protein
source organism Pseudomonas putida
publication title Crystal structure of PqqB from Pseudomonas putida at 2.2 A resolution
doi rcsb
total genus 101
structure length 304
sequence length 305
ec nomenclature
pdb deposition date 2009-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3jxpA00
3AF5A 5LLDA 4C09A 4C1EA 3BV6A 3IDZA 4HKYA 5HH4A 2E7YA 4P62A 4O98A 1DXKA 4D1VA 1M2XA 5EWAA 5HIOA 2ZO4A 4Z60A 2WYMA 5DPXA 3ESHA 5ACVA 4AWZA 4B87A 5AHOA 5A5ZA 2XF4A 1YCHA 4TYTA 4UA4A 5B1UA 5KIKA 4YSKA 3RKJA 5LS3A 5EHTA 3IEKA 5ACPA 2QEDA 1ZKPA 4TZFA 4ZO3A 2Y87A 2Y8BA 2ZWRA 4NQ2A 3KNSA 5EVKA 1A8TA 3Q6VA 3PG4A 4C1GA 4J5HA 4EFZA 4ZO2A 1WRAA 4YSBA 5LSCA 4H0DA 2DOOA 2I7TA 2Q0JA 2XR1A 5K4MA 3I11A 5KILA 2WYMC 2FU7A 3ZNBA 2FHXB 2I7VA 5ACQA 4EYBA 5FQAA 3SRXA 1VGNA 2GCUA 5ACSA 4Z5YA 3IE1A 1E5DA 1P9EA 5FQCA 1YCGA 2FU9A 1BVTA 4HL1A 2YNVB 2OHJA 4V0HA 1YCFA 2P18A 2Q0IA 4WD6A 2FK6A 2BIBA 5EVDA 1MQOA 2H6AA 3IE0A 3VQZA 2GFJA 2M5DA 5HIQA 2QINA 5AXRA 3X2ZA 3L6NA 2Y8AA 5HH6A 4CHLA 4Z6XA 1A7TA 5A0TA 4J5FA 2BMIA 5LM6A 3BK2A 2QJSA 2ZZIA 2OHHA 4U4LA 1DD6A 3X2XA 3DHBA 5ACUA 3FAIA 4Z67A 5B3RA 2FU8A 4KEQA 3DH8A 5LCFA 2BG2A 5HIPA 4YSLA 3RKKA 3X30A 3I15A 2BG8B 2NZEA 1VMEA 2GKLA 3ZR9A 5LCHA 4UWSB 3TP9A 3H3EA 4PVTA 5EH9A 1BC2A 3DHCA 2NYPA 3I13A 2UYXA 2WYLA 4AWYB 5IQKA 5FQBA 4GYQA 5ACXA 3SPUA 3WXCA 5A0VA 3F9OA 2CBNA 5AEBA 4D1TA 3KNRA 3T3OA 4C1CA 3IELA 5A87A 4D02A 1ZNBA 2P1EA 4BP0A 3AJ3A 4JO0A 4NQ4A 1X8GA 1DDKA 5EV6A 3I14A 4RL0A 3MD7A 2GFKA 2QDSA 1BMCA 3IOFA 3BC2A 4FSBA 4XUKA 1XM8A 2M5CA 2YNVA 3FCZA 4AD9A 3ZWFA 4TZ9A 3ZQ4A 4NQ5A 4EYLA 2WHGA 3LVZA 2FU6A 1X8IA 1KO2A 2BFKA 2BR6A 5HH5A 5AHRA 2NXAA 1SMLA 3SW3A 4C1HA 3AF6A 3SD9A 5EV8A 2BG8A 5ACTA 5EW0A 4D1WA 2YCBA 1JJTA 2BTNA 4PVOA 4Z7RA 2R2DA 4TZEA 1JT1A 2I7XA 2FM6A 4RBSA 5LMCA 2QDTA 4EY2A 1KO3A 4HL2A 4EXYA 3P2UA 4DILA 5ACRA 2YNTB 3S0ZA 1HLKA 3IE2A 4BZ3A 1K07A 1WUOA 3VPEA 2AIOA 4LE6A 5AYAA 4F6ZA 5HISA 3A4YA 5B15A 2OHIA 3I0VA 4XWTA 1QH3A 2GMNA 5EVBA 4UWRB 2BGAA 3SBLA 3PY5A 2BC2A 2YNWA 4KEPA 2P4ZA 4ZNBA 4C1FA 2P97A 4EYFA 3QH8A 4Z5ZA 2YNUA 2BG7A 2Q9UA 4UWOB 3RPCA 2HB9A 4F6HA 2WRSA 2FHXA 1WUPA 2AZ4A 5K4KA 2YZ3A 4DIKA 2BFZA 2NZFA 1WW1A 4RAMA 4NQ6A 4FEKA 1VJNA 3SFPA 5K4NA 4C1DA 3JXPA 4EXSA 5K0WA 2ZNBA 1JJEA 3T3NA 2A7MA 5LCAA 2Q42A 1QH5A 5LE1A 4RM5A 4UWPB 3BK1A 5AXOA 4TYFA 4XWWA 2VW8A 4AX1B 3G1PA 2DKFA 1L9YA 3PY6A 4D1UA 4TZBA 4UBQA 5ACWA 1Y44A 1XTOA 3IOGA 3IEMA 4ZEJA 2BG6A 2BFZB 3DHAA 4UAMA 2YNTA 4RL2A 3T9MA 3X2YA 2BFLA 3ADRA 4AX0B 3R2UA 1X8HA 1ZTCA 4FR7A 4GYUA 3KL7A 4RAWA 4GCWA 1KR3A
chains in the Genus database with same CATH superfamily
3AF5A 5LLDA 4C09A 4C1EA 3BV6A 3IDZA 4HKYA 5HH4A 4PDXA 2E7YA 4P62A 4O98A 4AV7A 1DXKA 4D1VA 1M2XA 5EWAA 5HIOA 2ZO4A 4Z60A 2WYMA 5DPXA 4AXHA 3ESHA 5ACVA 4AWZA 4B87A 5AHOA 5A5ZA 2XF4A 1YCHA 4TYTA 4UA4A 5B1UA 5KIKA 4YSKA 3RKJA 5LS3A 5EHTA 3IEKA 5ACPA 2QEDA 1ZKPA 4TZFA 4ZO3A 2Y87A 2Y8BA 2ZWRA 4NQ2A 3KNSA 5EVKA 1A8TA 3Q6VA 3PG4A 4C1GA 4J5HA 4EFZA 4ZO2A 1WRAA 4YSBA 5LSCA 4H0DA 2DOOA 2I7TA 2Q0JA 2XR1A 5K4MA 3I11A 5KILA 2WYMC 2FU7A 3ZNBA 2FHXB 2I7VA 5ACQA 4EYBA 5FQAA 3SRXA 1VGNA 2GCUA 5ACSA 4Z5YA 3IE1A 1E5DA 1P9EA 5FQCA 1YCGA 2FU9A 1BVTA 4HL1A 2YNVB 2OHJA 4V0HA 1YCFA 2P18A 2Q0IA 4WD6A 2FK6A 2BIBA 5EVDA 1MQOA 2H6AA 3IE0A 3VQZA 2GFJA 2M5DA 5HIQA 2QINA 5AXRA 3X2ZA 3L6NA 2Y8AA 5HH6A 4CHLA 4Z6XA 1A7TA 5A0TA 2CG3A 4J5FA 2BMIA 5LM6A 3BK2A 2QJSA 2ZZIA 2OHHA 4U4LA 1DD6A 3X2XA 2CFZA 3DHBA 5ACUA 3FAIA 4Z67A 5AIJA 5B3RA 2FU8A 4KEQA 3DH8A 5LCFA 2BG2A 5HIPA 4YSLA 3RKKA 3X30A 3I15A 2BG8B 2NZEA 1VMEA 2GKLA 3ZR9A 5LCHA 5A23A 4UWSB 3TP9A 3H3EA 4PVTA 5EH9A 1BC2A 3DHCA 2NYPA 3I13A 2UYXA 2WYLA 4AWYB 5IQKA 5FQBA 4GYQA 2YHEA 5ACXA 3SPUA 3WXCA 5A0VA 3F9OA 2CBNA 5AEBA 4D1TA 3KNRA 3T3OA 4C1CA 3IELA 5A87A 4D02A 1ZNBA 2P1EA 4BP0A 3AJ3A 4JO0A 4NQ4A 1X8GA 1DDKA 5EV6A 3I14A 4RL0A 3MD7A 5AJLA 2GFKA 2QDSA 1BMCA 3IOFA 3BC2A 4NURA 4FSBA 4XUKA 1XM8A 2M5CA 2YNVA 3FCZA 4AD9A 3ZWFA 4TZ9A 3ZQ4A 4NQ5A 4EYLA 2WHGA 3LVZA 2FU6A 1X8IA 1KO2A 2BFKA 2BR6A 5HH5A 5AHRA 2NXAA 1SMLA 3SW3A 4C1HA 3AF6A 3SD9A 5EV8A 2BG8A 5ACTA 5EW0A 4D1WA 2YCBA 1JJTA 2BTNA 4PVOA 4Z7RA 2R2DA 4TZEA 1JT1A 2I7XA 2FM6A 4RBSA 5LMCA 2QDTA 4EY2A 1KO3A 4HL2A 4EXYA 3P2UA 5ACRA 4DILA 2YNTB 3S0ZA 1HLKA 3IE2A 4BZ3A 1K07A 1WUOA 3VPEA 2AIOA 4LE6A 5AYAA 4F6ZA 5HISA 3A4YA 5B15A 2OHIA 3I0VA 4XWTA 1QH3A 2GMNA 5EVBA 4UWRB 2BGAA 3SBLA 3PY5A 2BC2A 2YNWA 4KEPA 2P4ZA 4ZNBA 4C1FA 2P97A 4EYFA 3QH8A 4Z5ZA 2YNUA 2BG7A 2Q9UA 4UWOB 3RPCA 2HB9A 4F6HA 2WRSA 2FHXA 1WUPA 2AZ4A 5K4KA 2YZ3A 4DIKA 2BFZA 2NZFA 1WW1A 4RAMA 4NQ6A 4FEKA 1VJNA 3SFPA 5K4NA 4C1DA 3JXPA 4EXSA 5K0WA 2ZNBA 1JJEA 3T3NA 2A7MA 5LCAA 2Q42A 1QH5A 5LE1A 4RM5A 4UWPB 3BK1A 5AXOA 4TYFA 4XWWA 2VW8A 4AX1B 3G1PA 2DKFA 1L9YA 3PY6A 4D1UA 4TZBA 4UBQA 5ACWA 1Y44A 1XTOA 3IOGA 3IEMA 4ZEJA 2BG6A 2CFUA 2BFZB 3DHAA 4UAMA 2YNTA 4RL2A 3T9MA 3X2YA 2BFLA 3ADRA 4AX0B 3R2UA 1X8HA 1ZTCA 4FR7A 4GYUA 3KL7A 4RAWA 4GCWA 2CG2A 1KR3A
chains in the Genus database with same CATH topology
3AF5A 5LLDA 4C09A 4C1EA 3BV6A 3IDZA 4HKYA 5HH4A 2E7YA 4P62A 4O98A 1DXKA 4D1VA 1M2XA 5EWAA 5HIOA 2ZO4A 4Z60A 2WYMA 5DPXA 3ESHA 5ACVA 4AWZA 4B87A 5AHOA 5A5ZA 2XF4A 1YCHA 4TYTA 4UA4A 5B1UA 5KIKA 4YSKA 3RKJA 5LS3A 5EHTA 3IEKA 5ACPA 2QEDA 1ZKPA 4TZFA 4ZO3A 2Y87A 2Y8BA 2ZWRA 4NQ2A 3KNSA 5EVKA 1A8TA 3Q6VA 3PG4A 4C1GA 4J5HA 4EFZA 4ZO2A 1WRAA 4YSBA 5LSCA 4H0DA 2DOOA 2I7TA 2Q0JA 2XR1A 5K4MA 3I11A 5KILA 2WYMC 2FU7A 3ZNBA 2FHXB 2I7VA 5ACQA 4EYBA 5FQAA 3SRXA 1VGNA 2GCUA 5ACSA 4Z5YA 3IE1A 1E5DA 1P9EA 5FQCA 1YCGA 2FU9A 1BVTA 4HL1A 2YNVB 2OHJA 4V0HA 1YCFA 2P18A 2Q0IA 4WD6A 2FK6A 2BIBA 5EVDA 1MQOA 2H6AA 3IE0A 3VQZA 2GFJA 2M5DA 5HIQA 2QINA 5AXRA 3X2ZA 3L6NA 2Y8AA 5HH6A 4CHLA 4Z6XA 1A7TA 5A0TA 4J5FA 2BMIA 5LM6A 3BK2A 2QJSA 2ZZIA 2OHHA 4U4LA 1DD6A 3X2XA 3DHBA 5ACUA 3FAIA 4Z67A 5B3RA 2FU8A 4KEQA 3DH8A 5LCFA 2BG2A 5HIPA 4YSLA 3RKKA 3X30A 3I15A 2BG8B 2NZEA 1VMEA 2GKLA 3ZR9A 5LCHA 4UWSB 3TP9A 3H3EA 4PVTA 5EH9A 1BC2A 3DHCA 2NYPA 3I13A 2UYXA 2WYLA 4AWYB 5IQKA 5FQBA 4GYQA 5ACXA 3SPUA 3WXCA 5A0VA 3F9OA 2CBNA 5AEBA 4D1TA 3KNRA 3T3OA 4C1CA 3IELA 5A87A 4D02A 1ZNBA 2P1EA 4BP0A 3AJ3A 4JO0A 4NQ4A 1X8GA 1DDKA 5EV6A 3I14A 4RL0A 3MD7A 2GFKA 2QDSA 1BMCA 3IOFA 3BC2A 4FSBA 4XUKA 1XM8A 2M5CA 2YNVA 3FCZA 4AD9A 3ZWFA 4TZ9A 3ZQ4A 4NQ5A 4EYLA 2WHGA 3LVZA 2FU6A 1X8IA 1KO2A 2BFKA 2BR6A 5HH5A 5AHRA 2NXAA 1SMLA 3SW3A 4C1HA 3AF6A 3SD9A 5EV8A 2BG8A 5ACTA 5EW0A 4D1WA 2YCBA 1JJTA 2BTNA 4PVOA 4Z7RA 2R2DA 4TZEA 1JT1A 2I7XA 2FM6A 4RBSA 5LMCA 2QDTA 4EY2A 1KO3A 4HL2A 4EXYA 3P2UA 4DILA 5ACRA 2YNTB 3S0ZA 1HLKA 3IE2A 4BZ3A 1K07A 1WUOA 3VPEA 2AIOA 4LE6A 5AYAA 4F6ZA 5HISA 3A4YA 5B15A 2OHIA 3I0VA 4XWTA 1QH3A 2GMNA 5EVBA 4UWRB 2BGAA 3SBLA 3PY5A 2BC2A 2YNWA 4KEPA 2P4ZA 4ZNBA 4C1FA 2P97A 4EYFA 3QH8A 4Z5ZA 2YNUA 2BG7A 2Q9UA 4UWOB 3RPCA 2HB9A 4F6HA 2WRSA 2FHXA 1WUPA 2AZ4A 5K4KA 2YZ3A 4DIKA 2BFZA 2NZFA 1WW1A 4RAMA 4NQ6A 4FEKA 1VJNA 3SFPA 5K4NA 4C1DA 3JXPA 4EXSA 5K0WA 2ZNBA 1JJEA 3T3NA 2A7MA 5LCAA 2Q42A 1QH5A 5LE1A 4RM5A 4UWPB 3BK1A 5AXOA 4TYFA 4XWWA 2VW8A 4AX1B 3G1PA 2DKFA 1L9YA 3PY6A 4D1UA 4TZBA 4UBQA 5ACWA 1Y44A 1XTOA 3IOGA 3IEMA 4ZEJA 2BG6A 2BFZB 3DHAA 4UAMA 2YNTA 4RL2A 3T9MA 3X2YA 2BFLA 3ADRA 4AX0B 3R2UA 1X8HA 1ZTCA 4FR7A 4GYUA 3KL7A 4RAWA 4GCWA 1KR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AF5 A;  5LLD A;  4C09 A;  4C1E A;  3BV6 A;  3IDZ A;  4HKY A;  5HH4 A;  2E7Y A;  4P62 A;  4O98 A;  1DXK A;  4D1V A;  1M2X A;  5EWA A;  5HIO A;  2ZO4 A;  4Z60 A;  2WYM A;  5DPX A;  3ESH A;  5ACV A;  4AWZ A;  4B87 A;  5AHO A;  5A5Z A;  2XF4 A;  1YCH A;  4TYT A;  4UA4 A;  5B1U A;  5KIK A;  4YSK A;  3RKJ A;  5LS3 A;  5EHT A;  3IEK A;  5ACP A;  2QED A;  1ZKP A;  4TZF A;  4ZO3 A;  2Y87 A;  2Y8B A;  2ZWR A;  4NQ2 A;  3KNS A;  5EVK A;  1A8T A;  3Q6V A;  3PG4 A;  4C1G A;  4J5H A;  4EFZ A;  4ZO2 A;  1WRA A;  4YSB A;  5LSC A;  4H0D A;  2DOO A;  2I7T A;  2Q0J A;  2XR1 A;  5K4M A;  3I11 A;  5KIL A;  2WYM C;  2FU7 A;  3ZNB A;  2FHX B;  2I7V A;  5ACQ A;  4EYB A;  5FQA A;  3SRX A;  1VGN A;  2GCU A;  5ACS A;  4Z5Y A;  3IE1 A;  1E5D A;  1P9E A;  5FQC A;  1YCG A;  2FU9 A;  1BVT A;  4HL1 A;  2YNV B;  2OHJ A;  4V0H A;  1YCF A;  2P18 A;  2Q0I A;  4WD6 A;  2FK6 A;  2BIB A;  5EVD A;  1MQO A;  2H6A A;  3IE0 A;  3VQZ A;  2GFJ A;  2M5D A;  5HIQ A;  2QIN A;  5AXR A;  3X2Z A;  3L6N A;  2Y8A A;  5HH6 A;  4CHL A;  4Z6X A;  1A7T A;  5A0T A;  4J5F A;  2BMI A;  5LM6 A;  3BK2 A;  2QJS A;  2ZZI A;  2OHH A;  4U4L A;  1DD6 A;  3X2X A;  3DHB A;  5ACU A;  3FAI A;  4Z67 A;  5B3R A;  2FU8 A;  4KEQ A;  3DH8 A;  5LCF A;  2BG2 A;  5HIP A;  4YSL A;  3RKK A;  3X30 A;  3I15 A;  2BG8 B;  2NZE A;  1VME A;  2GKL A;  3ZR9 A;  5LCH A;  4UWS B;  3TP9 A;  3H3E A;  4PVT A;  5EH9 A;  1BC2 A;  3DHC A;  2NYP A;  3I13 A;  2UYX A;  2WYL A;  4AWY B;  5IQK A;  5FQB A;  4GYQ A;  5ACX A;  3SPU A;  3WXC A;  5A0V A;  3F9O A;  2CBN A;  5AEB A;  4D1T A;  3KNR A;  3T3O A;  4C1C A;  3IEL A;  5A87 A;  4D02 A;  1ZNB A;  2P1E A;  4BP0 A;  3AJ3 A;  4JO0 A;  4NQ4 A;  1X8G A;  1DDK A;  5EV6 A;  3I14 A;  4RL0 A;  3MD7 A;  2GFK A;  2QDS A;  1BMC A;  3IOF A;  3BC2 A;  4FSB A;  4XUK A;  1XM8 A;  2M5C A;  2YNV A;  3FCZ A;  4AD9 A;  3ZWF A;  4TZ9 A;  3ZQ4 A;  4NQ5 A;  4EYL A;  2WHG A;  3LVZ A;  2FU6 A;  1X8I A;  1KO2 A;  2BFK A;  2BR6 A;  5HH5 A;  5AHR A;  2NXA A;  1SML A;  3SW3 A;  4C1H A;  3AF6 A;  3SD9 A;  5EV8 A;  2BG8 A;  5ACT A;  5EW0 A;  4D1W A;  2YCB A;  1JJT A;  2BTN A;  4PVO A;  4Z7R A;  2R2D A;  4TZE A;  1JT1 A;  2I7X A;  2FM6 A;  4RBS A;  5LMC A;  2QDT A;  4EY2 A;  1KO3 A;  4HL2 A;  4EXY A;  3P2U A;  4DIL A;  5ACR A;  2YNT B;  3S0Z A;  1HLK A;  3IE2 A;  4BZ3 A;  1K07 A;  1WUO A;  3VPE A;  2AIO A;  4LE6 A;  5AYA A;  4F6Z A;  5HIS A;  3A4Y A;  5B15 A;  2OHI A;  3I0V A;  4XWT A;  1QH3 A;  2GMN A;  5EVB A;  4UWR B;  2BGA A;  3SBL A;  3PY5 A;  2BC2 A;  2YNW A;  4KEP A;  2P4Z A;  4ZNB A;  4C1F A;  2P97 A;  4EYF A;  3QH8 A;  4Z5Z A;  2YNU A;  2BG7 A;  2Q9U A;  4UWO B;  3RPC A;  2HB9 A;  4F6H A;  2WRS A;  2FHX A;  1WUP A;  2AZ4 A;  5K4K A;  2YZ3 A;  4DIK A;  2BFZ A;  2NZF A;  1WW1 A;  4RAM A;  4NQ6 A;  4FEK A;  1VJN A;  3SFP A;  5K4N A;  4C1D A;  3JXP A;  4EXS A;  5K0W A;  2ZNB A;  1JJE A;  3T3N A;  2A7M A;  5LCA A;  2Q42 A;  1QH5 A;  5LE1 A;  4RM5 A;  4UWP B;  3BK1 A;  5AXO A;  4TYF A;  4XWW A;  2VW8 A;  4AX1 B;  3G1P A;  2DKF A;  1L9Y A;  3PY6 A;  4D1U A;  4TZB A;  4UBQ A;  5ACW A;  1Y44 A;  1XTO A;  3IOG A;  3IEM A;  4ZEJ A;  2BG6 A;  2BFZ B;  3DHA A;  4UAM A;  2YNT A;  4RL2 A;  3T9M A;  3X2Y A;  2BFL A;  3ADR A;  4AX0 B;  3R2U A;  1X8H A;  1ZTC A;  4FR7 A;  4GYU A;  3KL7 A;  4RAW A;  4GCW A;  1KR3 A; 
#chains in the Genus database with same CATH topology
 3AF5 A;  5LLD A;  4C09 A;  4C1E A;  3BV6 A;  3IDZ A;  4HKY A;  5HH4 A;  4PDX A;  2E7Y A;  4P62 A;  4O98 A;  4AV7 A;  1DXK A;  4D1V A;  1M2X A;  5EWA A;  5HIO A;  2ZO4 A;  4Z60 A;  2WYM A;  5DPX A;  4AXH A;  3ESH A;  5ACV A;  4AWZ A;  4B87 A;  5AHO A;  5A5Z A;  2XF4 A;  1YCH A;  4TYT A;  4UA4 A;  5B1U A;  5KIK A;  4YSK A;  3RKJ A;  5LS3 A;  5EHT A;  3IEK A;  5ACP A;  2QED A;  1ZKP A;  4TZF A;  4ZO3 A;  2Y87 A;  2Y8B A;  2ZWR A;  4NQ2 A;  3KNS A;  5EVK A;  1A8T A;  3Q6V A;  3PG4 A;  4C1G A;  4J5H A;  4EFZ A;  4ZO2 A;  1WRA A;  4YSB A;  5LSC A;  4H0D A;  2DOO A;  2I7T A;  2Q0J A;  2XR1 A;  5K4M A;  3I11 A;  5KIL A;  2WYM C;  2FU7 A;  3ZNB A;  2FHX B;  2I7V A;  5ACQ A;  4EYB A;  5FQA A;  3SRX A;  1VGN A;  2GCU A;  5ACS A;  4Z5Y A;  3IE1 A;  1E5D A;  1P9E A;  5FQC A;  1YCG A;  2FU9 A;  1BVT A;  4HL1 A;  2YNV B;  2OHJ A;  4V0H A;  1YCF A;  2P18 A;  2Q0I A;  4WD6 A;  2FK6 A;  2BIB A;  5EVD A;  1MQO A;  2H6A A;  3IE0 A;  3VQZ A;  2GFJ A;  2M5D A;  5HIQ A;  2QIN A;  5AXR A;  3X2Z A;  3L6N A;  2Y8A A;  5HH6 A;  4CHL A;  4Z6X A;  1A7T A;  5A0T A;  2CG3 A;  4J5F A;  2BMI A;  5LM6 A;  3BK2 A;  2QJS A;  2ZZI A;  2OHH A;  4U4L A;  1DD6 A;  3X2X A;  2CFZ A;  3DHB A;  5ACU A;  3FAI A;  4Z67 A;  5AIJ A;  5B3R A;  2FU8 A;  4KEQ A;  3DH8 A;  5LCF A;  2BG2 A;  5HIP A;  4YSL A;  3RKK A;  3X30 A;  3I15 A;  2BG8 B;  2NZE A;  1VME A;  2GKL A;  3ZR9 A;  5LCH A;  5A23 A;  4UWS B;  3TP9 A;  3H3E A;  4PVT A;  5EH9 A;  1BC2 A;  3DHC A;  2NYP A;  3I13 A;  2UYX A;  2WYL A;  4AWY B;  5IQK A;  5FQB A;  4GYQ A;  2YHE A;  5ACX A;  3SPU A;  3WXC A;  5A0V A;  3F9O A;  2CBN A;  5AEB A;  4D1T A;  3KNR A;  3T3O A;  4C1C A;  3IEL A;  5A87 A;  4D02 A;  1ZNB A;  2P1E A;  4BP0 A;  3AJ3 A;  4JO0 A;  4NQ4 A;  1X8G A;  1DDK A;  5EV6 A;  3I14 A;  4RL0 A;  3MD7 A;  5AJL A;  2GFK A;  2QDS A;  1BMC A;  3IOF A;  3BC2 A;  4NUR A;  4FSB A;  4XUK A;  1XM8 A;  2M5C A;  2YNV A;  3FCZ A;  4AD9 A;  3ZWF A;  4TZ9 A;  3ZQ4 A;  4NQ5 A;  4EYL A;  2WHG A;  3LVZ A;  2FU6 A;  1X8I A;  1KO2 A;  2BFK A;  2BR6 A;  5HH5 A;  5AHR A;  2NXA A;  1SML A;  3SW3 A;  4C1H A;  3AF6 A;  3SD9 A;  5EV8 A;  2BG8 A;  5ACT A;  5EW0 A;  4D1W A;  2YCB A;  1JJT A;  2BTN A;  4PVO A;  4Z7R A;  2R2D A;  4TZE A;  1JT1 A;  2I7X A;  2FM6 A;  4RBS A;  5LMC A;  2QDT A;  4EY2 A;  1KO3 A;  4HL2 A;  4EXY A;  3P2U A;  5ACR A;  4DIL A;  2YNT B;  3S0Z A;  1HLK A;  3IE2 A;  4BZ3 A;  1K07 A;  1WUO A;  3VPE A;  2AIO A;  4LE6 A;  5AYA A;  4F6Z A;  5HIS A;  3A4Y A;  5B15 A;  2OHI A;  3I0V A;  4XWT A;  1QH3 A;  2GMN A;  5EVB A;  4UWR B;  2BGA A;  3SBL A;  3PY5 A;  2BC2 A;  2YNW A;  4KEP A;  2P4Z A;  4ZNB A;  4C1F A;  2P97 A;  4EYF A;  3QH8 A;  4Z5Z A;  2YNU A;  2BG7 A;  2Q9U A;  4UWO B;  3RPC A;  2HB9 A;  4F6H A;  2WRS A;  2FHX A;  1WUP A;  2AZ4 A;  5K4K A;  2YZ3 A;  4DIK A;  2BFZ A;  2NZF A;  1WW1 A;  4RAM A;  4NQ6 A;  4FEK A;  1VJN A;  3SFP A;  5K4N A;  4C1D A;  3JXP A;  4EXS A;  5K0W A;  2ZNB A;  1JJE A;  3T3N A;  2A7M A;  5LCA A;  2Q42 A;  1QH5 A;  5LE1 A;  4RM5 A;  4UWP B;  3BK1 A;  5AXO A;  4TYF A;  4XWW A;  2VW8 A;  4AX1 B;  3G1P A;  2DKF A;  1L9Y A;  3PY6 A;  4D1U A;  4TZB A;  4UBQ A;  5ACW A;  1Y44 A;  1XTO A;  3IOG A;  3IEM A;  4ZEJ A;  2BG6 A;  2CFU A;  2BFZ B;  3DHA A;  4UAM A;  2YNT A;  4RL2 A;  3T9M A;  3X2Y A;  2BFL A;  3ADR A;  4AX0 B;  3R2U A;  1X8H A;  1ZTC A;  4FR7 A;  4GYU A;  3KL7 A;  4RAW A;  4GCW A;  2CG2 A;  1KR3 A; 
#chains in the Genus database with same CATH homology
 3AF5 A;  5LLD A;  4C09 A;  4C1E A;  3BV6 A;  3IDZ A;  4HKY A;  5HH4 A;  2E7Y A;  4P62 A;  4O98 A;  1DXK A;  4D1V A;  1M2X A;  5EWA A;  5HIO A;  2ZO4 A;  4Z60 A;  2WYM A;  5DPX A;  3ESH A;  5ACV A;  4AWZ A;  4B87 A;  5AHO A;  5A5Z A;  2XF4 A;  1YCH A;  4TYT A;  4UA4 A;  5B1U A;  5KIK A;  4YSK A;  3RKJ A;  5LS3 A;  5EHT A;  3IEK A;  5ACP A;  2QED A;  1ZKP A;  4TZF A;  4ZO3 A;  2Y87 A;  2Y8B A;  2ZWR A;  4NQ2 A;  3KNS A;  5EVK A;  1A8T A;  3Q6V A;  3PG4 A;  4C1G A;  4J5H A;  4EFZ A;  4ZO2 A;  1WRA A;  4YSB A;  5LSC A;  4H0D A;  2DOO A;  2I7T A;  2Q0J A;  2XR1 A;  5K4M A;  3I11 A;  5KIL A;  2WYM C;  2FU7 A;  3ZNB A;  2FHX B;  2I7V A;  5ACQ A;  4EYB A;  5FQA A;  3SRX A;  1VGN A;  2GCU A;  5ACS A;  4Z5Y A;  3IE1 A;  1E5D A;  1P9E A;  5FQC A;  1YCG A;  2FU9 A;  1BVT A;  4HL1 A;  2YNV B;  2OHJ A;  4V0H A;  1YCF A;  2P18 A;  2Q0I A;  4WD6 A;  2FK6 A;  2BIB A;  5EVD A;  1MQO A;  2H6A A;  3IE0 A;  3VQZ A;  2GFJ A;  2M5D A;  5HIQ A;  2QIN A;  5AXR A;  3X2Z A;  3L6N A;  2Y8A A;  5HH6 A;  4CHL A;  4Z6X A;  1A7T A;  5A0T A;  4J5F A;  2BMI A;  5LM6 A;  3BK2 A;  2QJS A;  2ZZI A;  2OHH A;  4U4L A;  1DD6 A;  3X2X A;  3DHB A;  5ACU A;  3FAI A;  4Z67 A;  5B3R A;  2FU8 A;  4KEQ A;  3DH8 A;  5LCF A;  2BG2 A;  5HIP A;  4YSL A;  3RKK A;  3X30 A;  3I15 A;  2BG8 B;  2NZE A;  1VME A;  2GKL A;  3ZR9 A;  5LCH A;  4UWS B;  3TP9 A;  3H3E A;  4PVT A;  5EH9 A;  1BC2 A;  3DHC A;  2NYP A;  3I13 A;  2UYX A;  2WYL A;  4AWY B;  5IQK A;  5FQB A;  4GYQ A;  5ACX A;  3SPU A;  3WXC A;  5A0V A;  3F9O A;  2CBN A;  5AEB A;  4D1T A;  3KNR A;  3T3O A;  4C1C A;  3IEL A;  5A87 A;  4D02 A;  1ZNB A;  2P1E A;  4BP0 A;  3AJ3 A;  4JO0 A;  4NQ4 A;  1X8G A;  1DDK A;  5EV6 A;  3I14 A;  4RL0 A;  3MD7 A;  2GFK A;  2QDS A;  1BMC A;  3IOF A;  3BC2 A;  4FSB A;  4XUK A;  1XM8 A;  2M5C A;  2YNV A;  3FCZ A;  4AD9 A;  3ZWF A;  4TZ9 A;  3ZQ4 A;  4NQ5 A;  4EYL A;  2WHG A;  3LVZ A;  2FU6 A;  1X8I A;  1KO2 A;  2BFK A;  2BR6 A;  5HH5 A;  5AHR A;  2NXA A;  1SML A;  3SW3 A;  4C1H A;  3AF6 A;  3SD9 A;  5EV8 A;  2BG8 A;  5ACT A;  5EW0 A;  4D1W A;  2YCB A;  1JJT A;  2BTN A;  4PVO A;  4Z7R A;  2R2D A;  4TZE A;  1JT1 A;  2I7X A;  2FM6 A;  4RBS A;  5LMC A;  2QDT A;  4EY2 A;  1KO3 A;  4HL2 A;  4EXY A;  3P2U A;  4DIL A;  5ACR A;  2YNT B;  3S0Z A;  1HLK A;  3IE2 A;  4BZ3 A;  1K07 A;  1WUO A;  3VPE A;  2AIO A;  4LE6 A;  5AYA A;  4F6Z A;  5HIS A;  3A4Y A;  5B15 A;  2OHI A;  3I0V A;  4XWT A;  1QH3 A;  2GMN A;  5EVB A;  4UWR B;  2BGA A;  3SBL A;  3PY5 A;  2BC2 A;  2YNW A;  4KEP A;  2P4Z A;  4ZNB A;  4C1F A;  2P97 A;  4EYF A;  3QH8 A;  4Z5Z A;  2YNU A;  2BG7 A;  2Q9U A;  4UWO B;  3RPC A;  2HB9 A;  4F6H A;  2WRS A;  2FHX A;  1WUP A;  2AZ4 A;  5K4K A;  2YZ3 A;  4DIK A;  2BFZ A;  2NZF A;  1WW1 A;  4RAM A;  4NQ6 A;  4FEK A;  1VJN A;  3SFP A;  5K4N A;  4C1D A;  3JXP A;  4EXS A;  5K0W A;  2ZNB A;  1JJE A;  3T3N A;  2A7M A;  5LCA A;  2Q42 A;  1QH5 A;  5LE1 A;  4RM5 A;  4UWP B;  3BK1 A;  5AXO A;  4TYF A;  4XWW A;  2VW8 A;  4AX1 B;  3G1P A;  2DKF A;  1L9Y A;  3PY6 A;  4D1U A;  4TZB A;  4UBQ A;  5ACW A;  1Y44 A;  1XTO A;  3IOG A;  3IEM A;  4ZEJ A;  2BG6 A;  2BFZ B;  3DHA A;  4UAM A;  2YNT A;  4RL2 A;  3T9M A;  3X2Y A;  2BFL A;  3ADR A;  4AX0 B;  3R2U A;  1X8H A;  1ZTC A;  4FR7 A;  4GYU A;  3KL7 A;  4RAW A;  4GCW A;  1KR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...