1VJNA

Crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
209
structure length
194
Chain Sequence
HMKITWFGHACFALEMEGKTIVTDPFDPIPNVTADVVTESHQHNAHHLVKGNFRVIDRPGAYTVNGVKIKGVETFHDGKNIVFVFEGEGIKVCHLGDLGHVLTPAQVEEIGEIDVLLVPVGGTYTIGPKEAKEVADLLNAKVIIPMHYKTKYLKFNLLPVDDFLKLFDSYERVGNILELFEKPKERKVVVMEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Zn-dependent hydrolase of metallo-beta-lactamase superfamily
publication title Crystal structure of Zn-dependent hydrolase of metallo-beta-lactamase superfamily (TM0207) from Thermotoga maritima at 2.00 A resolution
rcsb
source organism Thermotoga maritima
total genus 43
structure length 194
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1vjnA00
5EV6A 3X2YA 5B15A 1HLKA 2FU8A 5AXRA 4BZ3A 3ZR9A 4Z67A 4D1WA 5LCFA 5AHOA 2OHJA 2Q42A 3RKKA 5EWAA 4UA4A 5ACSA 2I7VA 2NYPA 2ZZIA 4YSKA 2DKFA 2YNVA 3BC2A 5EVKA 2VW8A 1E5DA 2A7MA 5AHRA 5EH9A 5EVBA 2Y8AA 4NQ5A 4TZBA 5ACWA 4D1TA 2YNTA 4KEQA 4AD9A 3T3NA 1QH3A 5ACQA 3IEMA 3TP9A 5A0VA 3SD9A 4UWPB 1XM8A 3I11A 2R2DA 4V0HA 4HKYA 1VJNA 4RL0A 4B87A 3R2UA 5HH5A 3BV6A 2H6AA 3BK2A 2FU9A 2I7XA 2E7YA 4AWYB 1A8TA 2P4ZA 4C1CA 4UWOB 2CBNA 2Y8BA 1YCFA 3ZWFA 4FEKA 4D1VA 2BFZA 3A4YA 4JO0A 3DHBA 5DPXA 2FK6A 1WUPA 5ACTA 4EXSA 2YZ3A 3SRXA 4LE6A 2Q9UA 4UAMA 1X8HA 5LLDA 4GYUA 3X2XA 3X30A 5ACXA 4XWTA 4Z6XA 4RAWA 4FR7A 1SMLA 3IEKA 5IQKA 5LCHA 4UBQA 2UYXA 2FHXA 1WRAA 3H3EA 4YSBA 2QDTA 1P9EA 2OHHA 4TZEA 4Z5ZA 1Y44A 1DD6A 4NQ6A 4NQ2A 3JXPA 3I14A 4TYFA 4PVOA 4AWZA 4EY2A 3QH8A 1L9YA 4PVTA 4F6HA 3KL7A 1ZKPA 2FM6A 1JJTA 2BC2A 4Z60A 4FSBA 4UWRB 5HISA 2YNWA 4ZEJA 2QEDA 1YCGA 1XTOA 5HIPA 4AX0B 4GCWA 1WW1A 4HL1A 4GYQA 1M2XA 2M5CA 4WD6A 3IDZA 1VGNA 5AEBA 1K07A 4TZFA 5K4MA 3FCZA 2WYMA 2YNUA 2BG2A 2QJSA 2I7TA 3SBLA 1BC2A 1JJEA 1KO3A 4H0DA 4UWSB 3PY5A 2BR6A 1YCHA 4J5HA 5EHTA 2BIBA 2BG6A 3P2UA 3SPUA 3SW3A 2Q0IA 2YCBA 3KNRA 2BG8B 4EXYA 3BK1A 4D1UA 3AF5A 5HH6A 3ZNBA 5B1UA 4RBSA 3IE0A 1ZTCA 3Q6VA 5ACUA 3AF6A 3IELA 5EVDA 3DHCA 2BG7A 3F9OA 2XR1A 3IE2A 3X2ZA 2ZO4A 4DIKA 4XUKA 4ZO3A 2GMNA 3T9MA 3VPEA 5AXOA 5K0WA 5LE1A 5KIKA 4AX1B 4EFZA 1MQOA 4O98A 4EYLA 4ZO2A 3PY6A 1ZNBA 3SFPA 3I0VA 2BFLA 4XWWA 2Y87A 5KILA 4TZ9A 2GFJA 5ACPA 5FQBA 3DH8A 1BVTA 1KR3A 1JT1A 1VMEA 2WYMC 4BP0A 4C1FA 4C1EA 3L6NA 4C1HA 2AIOA 1A7TA 5LM6A 3IE1A 2WHGA 2XF4A 2YNVB 2ZNBA 2BFKA 3I15A 3G1PA 4J5FA 5A5ZA 2OHIA 2P97A 4TYTA 2NZFA 2NZEA 2YNTB 3DHAA 5A87A 5LMCA 2WRSA 5HIOA 5HH4A 2QINA 5LSCA 4RM5A 5LCAA 5K4KA 3AJ3A 2BMIA 2AZ4A 3WXCA 2WYLA 2FU6A 4RAMA 3RKJA 3ZQ4A 5FQAA 4YSLA 4CHLA 5FQCA 3ADRA 5HIQA 4C09A 3ESHA 5LS3A 5B3RA 3VQZA 4Z5YA 2P1EA 4EYFA 3PG4A 4HL2A 2HB9A 2Q0JA 1WUOA 1QH5A 3RPCA 2BFZB 4D02A 2M5DA 4RL2A 4KEPA 2NXAA 2BTNA 3S0ZA 3FAIA 4DILA 5EW0A 5ACRA 2BGAA 2ZWRA 2BG8A 5ACVA 5AYAA 2GFKA 4C1GA 2DOOA 3LVZA 2FU7A 4P62A 1X8GA 3T3OA 2GKLA 4U4LA 3IOGA 2P18A 4ZNBA 3I13A 2GCUA 4NQ4A 3KNSA 2FHXB 1BMCA 5A0TA 4F6ZA 1DDKA 5EV8A 3IOFA 1X8IA 2QDSA 4EYBA 4C1DA 4Z7RA 1KO2A 3MD7A 1DXKA 5K4NA
chains in the Genus database with same CATH superfamily
5EV6A 3X2YA 5B15A 1HLKA 2FU8A 5AXRA 4BZ3A 3ZR9A 4Z67A 4NURA 4D1WA 4PDXA 5LCFA 5AHOA 2OHJA 2Q42A 3RKKA 5EWAA 4UA4A 5ACSA 2I7VA 2NYPA 2ZZIA 4YSKA 2DKFA 2YNVA 3BC2A 5EVKA 2VW8A 1E5DA 2A7MA 5AHRA 5EH9A 5EVBA 2Y8AA 4NQ5A 4TZBA 5ACWA 4D1TA 2YNTA 4KEQA 4AD9A 3T3NA 1QH3A 5ACQA 3IEMA 3TP9A 5A0VA 3SD9A 4UWPB 1XM8A 3I11A 2R2DA 4V0HA 4HKYA 1VJNA 4RL0A 4B87A 3R2UA 5HH5A 3BV6A 2H6AA 3BK2A 2FU9A 2I7XA 2E7YA 4AWYB 1A8TA 2P4ZA 4C1CA 4UWOB 2CBNA 2Y8BA 1YCFA 3ZWFA 4FEKA 4D1VA 2BFZA 3A4YA 4JO0A 4AV7A 3DHBA 2CFUA 5DPXA 2FK6A 1WUPA 5ACTA 4EXSA 2YZ3A 3SRXA 4LE6A 2Q9UA 4UAMA 1X8HA 5LLDA 4GYUA 3X2XA 3X30A 5ACXA 4XWTA 4Z6XA 4RAWA 4FR7A 1SMLA 3IEKA 5IQKA 5LCHA 4UBQA 2UYXA 2FHXA 1WRAA 3H3EA 4YSBA 2QDTA 1P9EA 2OHHA 4TZEA 4Z5ZA 1Y44A 1DD6A 4NQ6A 4NQ2A 3JXPA 3I14A 4AXHA 2CG2A 4TYFA 4PVOA 4AWZA 4EY2A 3QH8A 1L9YA 4PVTA 4F6HA 3KL7A 1ZKPA 2FM6A 1JJTA 2BC2A 5A23A 4Z60A 4FSBA 4UWRB 5HISA 2YNWA 4ZEJA 2QEDA 1YCGA 1XTOA 5HIPA 4AX0B 4GCWA 1WW1A 4HL1A 4GYQA 1M2XA 2M5CA 4WD6A 3IDZA 1VGNA 5AEBA 1K07A 4TZFA 5K4MA 3FCZA 2WYMA 2YNUA 2BG2A 2QJSA 2I7TA 3SBLA 1BC2A 1JJEA 1KO3A 4H0DA 4UWSB 3PY5A 2BR6A 1YCHA 4J5HA 5EHTA 2BIBA 2BG6A 3P2UA 3SPUA 3SW3A 2Q0IA 2YCBA 3KNRA 2BG8B 4EXYA 3BK1A 4D1UA 3AF5A 5HH6A 3ZNBA 5B1UA 4RBSA 3IE0A 1ZTCA 3Q6VA 5ACUA 3AF6A 3IELA 5EVDA 3DHCA 2BG7A 3F9OA 2XR1A 3IE2A 3X2ZA 2ZO4A 4DIKA 4XUKA 4ZO3A 2GMNA 3T9MA 3VPEA 5AXOA 5K0WA 5LE1A 5KIKA 4AX1B 4EFZA 1MQOA 4O98A 4EYLA 4ZO2A 3PY6A 5AJLA 1ZNBA 3SFPA 3I0VA 2BFLA 4XWWA 2Y87A 5KILA 4TZ9A 2GFJA 5ACPA 5FQBA 3DH8A 1BVTA 1KR3A 1JT1A 1VMEA 2WYMC 4BP0A 4C1FA 4C1EA 3L6NA 4C1HA 2AIOA 1A7TA 5LM6A 3IE1A 2WHGA 2XF4A 2YNVB 2ZNBA 2BFKA 3I15A 5AIJA 3G1PA 4J5FA 5A5ZA 2OHIA 2P97A 4TYTA 2NZFA 2NZEA 2YNTB 3DHAA 5A87A 5LMCA 2WRSA 5HIOA 5HH4A 2QINA 5LSCA 4RM5A 5LCAA 5K4KA 2YHEA 3AJ3A 2BMIA 2AZ4A 3WXCA 2WYLA 2FU6A 4RAMA 3RKJA 3ZQ4A 5FQAA 4YSLA 4CHLA 5FQCA 3ADRA 5HIQA 4C09A 3ESHA 5LS3A 5B3RA 3VQZA 4Z5YA 2P1EA 4EYFA 2CFZA 3PG4A 4HL2A 2HB9A 2Q0JA 1WUOA 1QH5A 3RPCA 2BFZB 4D02A 2M5DA 4RL2A 4KEPA 2NXAA 2BTNA 3S0ZA 3FAIA 4DILA 5EW0A 5ACRA 2BGAA 2ZWRA 2BG8A 5ACVA 5AYAA 2GFKA 4C1GA 2DOOA 3LVZA 2FU7A 2CG3A 4P62A 1X8GA 3T3OA 2GKLA 4U4LA 3IOGA 2P18A 4ZNBA 3I13A 2GCUA 4NQ4A 3KNSA 2FHXB 1BMCA 5A0TA 4F6ZA 1DDKA 5EV8A 3IOFA 1X8IA 2QDSA 4EYBA 4C1DA 4Z7RA 1KO2A 3MD7A 1DXKA 5K4NA
chains in the Genus database with same CATH topology
5EV6A 3X2YA 5B15A 1HLKA 2FU8A 5AXRA 4BZ3A 3ZR9A 4Z67A 4D1WA 5LCFA 5AHOA 2OHJA 2Q42A 3RKKA 5EWAA 4UA4A 5ACSA 2I7VA 2NYPA 2ZZIA 4YSKA 2DKFA 2YNVA 3BC2A 5EVKA 2VW8A 1E5DA 2A7MA 5AHRA 5EH9A 5EVBA 2Y8AA 4NQ5A 4TZBA 5ACWA 4D1TA 2YNTA 4KEQA 4AD9A 3T3NA 1QH3A 5ACQA 3IEMA 3TP9A 5A0VA 3SD9A 4UWPB 1XM8A 3I11A 2R2DA 4V0HA 4HKYA 1VJNA 4RL0A 4B87A 3R2UA 5HH5A 3BV6A 2H6AA 3BK2A 2FU9A 2I7XA 2E7YA 4AWYB 1A8TA 2P4ZA 4C1CA 4UWOB 2CBNA 2Y8BA 1YCFA 3ZWFA 4FEKA 4D1VA 2BFZA 3A4YA 4JO0A 3DHBA 5DPXA 2FK6A 1WUPA 5ACTA 4EXSA 2YZ3A 3SRXA 4LE6A 2Q9UA 4UAMA 1X8HA 5LLDA 4GYUA 3X2XA 3X30A 5ACXA 4XWTA 4Z6XA 4RAWA 4FR7A 1SMLA 3IEKA 5IQKA 5LCHA 4UBQA 2UYXA 2FHXA 1WRAA 3H3EA 4YSBA 2QDTA 1P9EA 2OHHA 4TZEA 4Z5ZA 1Y44A 1DD6A 4NQ6A 4NQ2A 3JXPA 3I14A 4TYFA 4PVOA 4AWZA 4EY2A 3QH8A 1L9YA 4PVTA 4F6HA 3KL7A 1ZKPA 2FM6A 1JJTA 2BC2A 4Z60A 4FSBA 4UWRB 5HISA 2YNWA 4ZEJA 2QEDA 1YCGA 1XTOA 5HIPA 4AX0B 4GCWA 1WW1A 4HL1A 4GYQA 1M2XA 2M5CA 4WD6A 3IDZA 1VGNA 5AEBA 1K07A 4TZFA 5K4MA 3FCZA 2WYMA 2YNUA 2BG2A 2QJSA 2I7TA 3SBLA 1BC2A 1JJEA 1KO3A 4H0DA 4UWSB 3PY5A 2BR6A 1YCHA 4J5HA 5EHTA 2BIBA 2BG6A 3P2UA 3SPUA 3SW3A 2Q0IA 2YCBA 3KNRA 2BG8B 4EXYA 3BK1A 4D1UA 3AF5A 5HH6A 3ZNBA 5B1UA 4RBSA 3IE0A 1ZTCA 3Q6VA 5ACUA 3AF6A 3IELA 5EVDA 3DHCA 2BG7A 3F9OA 2XR1A 3IE2A 3X2ZA 2ZO4A 4DIKA 4XUKA 4ZO3A 2GMNA 3T9MA 3VPEA 5AXOA 5K0WA 5LE1A 5KIKA 4AX1B 4EFZA 1MQOA 4O98A 4EYLA 4ZO2A 3PY6A 1ZNBA 3SFPA 3I0VA 2BFLA 4XWWA 2Y87A 5KILA 4TZ9A 2GFJA 5ACPA 5FQBA 3DH8A 1BVTA 1KR3A 1JT1A 1VMEA 2WYMC 4BP0A 4C1FA 4C1EA 3L6NA 4C1HA 2AIOA 1A7TA 5LM6A 3IE1A 2WHGA 2XF4A 2YNVB 2ZNBA 2BFKA 3I15A 3G1PA 4J5FA 5A5ZA 2OHIA 2P97A 4TYTA 2NZFA 2NZEA 2YNTB 3DHAA 5A87A 5LMCA 2WRSA 5HIOA 5HH4A 2QINA 5LSCA 4RM5A 5LCAA 5K4KA 3AJ3A 2BMIA 2AZ4A 3WXCA 2WYLA 2FU6A 4RAMA 3RKJA 3ZQ4A 5FQAA 4YSLA 4CHLA 5FQCA 3ADRA 5HIQA 4C09A 3ESHA 5LS3A 5B3RA 3VQZA 4Z5YA 2P1EA 4EYFA 3PG4A 4HL2A 2HB9A 2Q0JA 1WUOA 1QH5A 3RPCA 2BFZB 4D02A 2M5DA 4RL2A 4KEPA 2NXAA 2BTNA 3S0ZA 3FAIA 4DILA 5EW0A 5ACRA 2BGAA 2ZWRA 2BG8A 5ACVA 5AYAA 2GFKA 4C1GA 2DOOA 3LVZA 2FU7A 4P62A 1X8GA 3T3OA 2GKLA 4U4LA 3IOGA 2P18A 4ZNBA 3I13A 2GCUA 4NQ4A 3KNSA 2FHXB 1BMCA 5A0TA 4F6ZA 1DDKA 5EV8A 3IOFA 1X8IA 2QDSA 4EYBA 4C1DA 4Z7RA 1KO2A 3MD7A 1DXKA 5K4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EV6 A;  3X2Y A;  5B15 A;  1HLK A;  2FU8 A;  5AXR A;  4BZ3 A;  3ZR9 A;  4Z67 A;  4D1W A;  5LCF A;  5AHO A;  2OHJ A;  2Q42 A;  3RKK A;  5EWA A;  4UA4 A;  5ACS A;  2I7V A;  2NYP A;  2ZZI A;  4YSK A;  2DKF A;  2YNV A;  3BC2 A;  5EVK A;  2VW8 A;  1E5D A;  2A7M A;  5AHR A;  5EH9 A;  5EVB A;  2Y8A A;  4NQ5 A;  4TZB A;  5ACW A;  4D1T A;  2YNT A;  4KEQ A;  4AD9 A;  3T3N A;  1QH3 A;  5ACQ A;  3IEM A;  3TP9 A;  5A0V A;  3SD9 A;  4UWP B;  1XM8 A;  3I11 A;  2R2D A;  4V0H A;  4HKY A;  1VJN A;  4RL0 A;  4B87 A;  3R2U A;  5HH5 A;  3BV6 A;  2H6A A;  3BK2 A;  2FU9 A;  2I7X A;  2E7Y A;  4AWY B;  1A8T A;  2P4Z A;  4C1C A;  4UWO B;  2CBN A;  2Y8B A;  1YCF A;  3ZWF A;  4FEK A;  4D1V A;  2BFZ A;  3A4Y A;  4JO0 A;  3DHB A;  5DPX A;  2FK6 A;  1WUP A;  5ACT A;  4EXS A;  2YZ3 A;  3SRX A;  4LE6 A;  2Q9U A;  4UAM A;  1X8H A;  5LLD A;  4GYU A;  3X2X A;  3X30 A;  5ACX A;  4XWT A;  4Z6X A;  4RAW A;  4FR7 A;  1SML A;  3IEK A;  5IQK A;  5LCH A;  4UBQ A;  2UYX A;  2FHX A;  1WRA A;  3H3E A;  4YSB A;  2QDT A;  1P9E A;  2OHH A;  4TZE A;  4Z5Z A;  1Y44 A;  1DD6 A;  4NQ6 A;  4NQ2 A;  3JXP A;  3I14 A;  4TYF A;  4PVO A;  4AWZ A;  4EY2 A;  3QH8 A;  1L9Y A;  4PVT A;  4F6H A;  3KL7 A;  1ZKP A;  2FM6 A;  1JJT A;  2BC2 A;  4Z60 A;  4FSB A;  4UWR B;  5HIS A;  2YNW A;  4ZEJ A;  2QED A;  1YCG A;  1XTO A;  5HIP A;  4AX0 B;  4GCW A;  1WW1 A;  4HL1 A;  4GYQ A;  1M2X A;  2M5C A;  4WD6 A;  3IDZ A;  1VGN A;  5AEB A;  1K07 A;  4TZF A;  5K4M A;  3FCZ A;  2WYM A;  2YNU A;  2BG2 A;  2QJS A;  2I7T A;  3SBL A;  1BC2 A;  1JJE A;  1KO3 A;  4H0D A;  4UWS B;  3PY5 A;  2BR6 A;  1YCH A;  4J5H A;  5EHT A;  2BIB A;  2BG6 A;  3P2U A;  3SPU A;  3SW3 A;  2Q0I A;  2YCB A;  3KNR A;  2BG8 B;  4EXY A;  3BK1 A;  4D1U A;  3AF5 A;  5HH6 A;  3ZNB A;  5B1U A;  4RBS A;  3IE0 A;  1ZTC A;  3Q6V A;  5ACU A;  3AF6 A;  3IEL A;  5EVD A;  3DHC A;  2BG7 A;  3F9O A;  2XR1 A;  3IE2 A;  3X2Z A;  2ZO4 A;  4DIK A;  4XUK A;  4ZO3 A;  2GMN A;  3T9M A;  3VPE A;  5AXO A;  5K0W A;  5LE1 A;  5KIK A;  4AX1 B;  4EFZ A;  1MQO A;  4O98 A;  4EYL A;  4ZO2 A;  3PY6 A;  1ZNB A;  3SFP A;  3I0V A;  2BFL A;  4XWW A;  2Y87 A;  5KIL A;  4TZ9 A;  2GFJ A;  5ACP A;  5FQB A;  3DH8 A;  1BVT A;  1KR3 A;  1JT1 A;  1VME A;  2WYM C;  4BP0 A;  4C1F A;  4C1E A;  3L6N A;  4C1H A;  2AIO A;  1A7T A;  5LM6 A;  3IE1 A;  2WHG A;  2XF4 A;  2YNV B;  2ZNB A;  2BFK A;  3I15 A;  3G1P A;  4J5F A;  5A5Z A;  2OHI A;  2P97 A;  4TYT A;  2NZF A;  2NZE A;  2YNT B;  3DHA A;  5A87 A;  5LMC A;  2WRS A;  5HIO A;  5HH4 A;  2QIN A;  5LSC A;  4RM5 A;  5LCA A;  5K4K A;  3AJ3 A;  2BMI A;  2AZ4 A;  3WXC A;  2WYL A;  2FU6 A;  4RAM A;  3RKJ A;  3ZQ4 A;  5FQA A;  4YSL A;  4CHL A;  5FQC A;  3ADR A;  5HIQ A;  4C09 A;  3ESH A;  5LS3 A;  5B3R A;  3VQZ A;  4Z5Y A;  2P1E A;  4EYF A;  3PG4 A;  4HL2 A;  2HB9 A;  2Q0J A;  1WUO A;  1QH5 A;  3RPC A;  2BFZ B;  4D02 A;  2M5D A;  4RL2 A;  4KEP A;  2NXA A;  2BTN A;  3S0Z A;  3FAI A;  4DIL A;  5EW0 A;  5ACR A;  2BGA A;  2ZWR A;  2BG8 A;  5ACV A;  5AYA A;  2GFK A;  4C1G A;  2DOO A;  3LVZ A;  2FU7 A;  4P62 A;  1X8G A;  3T3O A;  2GKL A;  4U4L A;  3IOG A;  2P18 A;  4ZNB A;  3I13 A;  2GCU A;  4NQ4 A;  3KNS A;  2FHX B;  1BMC A;  5A0T A;  4F6Z A;  1DDK A;  5EV8 A;  3IOF A;  1X8I A;  2QDS A;  4EYB A;  4C1D A;  4Z7R A;  1KO2 A;  3MD7 A;  1DXK A;  5K4N A; 
#chains in the Genus database with same CATH topology
 5EV6 A;  3X2Y A;  5B15 A;  1HLK A;  2FU8 A;  5AXR A;  4BZ3 A;  3ZR9 A;  4Z67 A;  4NUR A;  4D1W A;  4PDX A;  5LCF A;  5AHO A;  2OHJ A;  2Q42 A;  3RKK A;  5EWA A;  4UA4 A;  5ACS A;  2I7V A;  2NYP A;  2ZZI A;  4YSK A;  2DKF A;  2YNV A;  3BC2 A;  5EVK A;  2VW8 A;  1E5D A;  2A7M A;  5AHR A;  5EH9 A;  5EVB A;  2Y8A A;  4NQ5 A;  4TZB A;  5ACW A;  4D1T A;  2YNT A;  4KEQ A;  4AD9 A;  3T3N A;  1QH3 A;  5ACQ A;  3IEM A;  3TP9 A;  5A0V A;  3SD9 A;  4UWP B;  1XM8 A;  3I11 A;  2R2D A;  4V0H A;  4HKY A;  1VJN A;  4RL0 A;  4B87 A;  3R2U A;  5HH5 A;  3BV6 A;  2H6A A;  3BK2 A;  2FU9 A;  2I7X A;  2E7Y A;  4AWY B;  1A8T A;  2P4Z A;  4C1C A;  4UWO B;  2CBN A;  2Y8B A;  1YCF A;  3ZWF A;  4FEK A;  4D1V A;  2BFZ A;  3A4Y A;  4JO0 A;  4AV7 A;  3DHB A;  2CFU A;  5DPX A;  2FK6 A;  1WUP A;  5ACT A;  4EXS A;  2YZ3 A;  3SRX A;  4LE6 A;  2Q9U A;  4UAM A;  1X8H A;  5LLD A;  4GYU A;  3X2X A;  3X30 A;  5ACX A;  4XWT A;  4Z6X A;  4RAW A;  4FR7 A;  1SML A;  3IEK A;  5IQK A;  5LCH A;  4UBQ A;  2UYX A;  2FHX A;  1WRA A;  3H3E A;  4YSB A;  2QDT A;  1P9E A;  2OHH A;  4TZE A;  4Z5Z A;  1Y44 A;  1DD6 A;  4NQ6 A;  4NQ2 A;  3JXP A;  3I14 A;  4AXH A;  2CG2 A;  4TYF A;  4PVO A;  4AWZ A;  4EY2 A;  3QH8 A;  1L9Y A;  4PVT A;  4F6H A;  3KL7 A;  1ZKP A;  2FM6 A;  1JJT A;  2BC2 A;  5A23 A;  4Z60 A;  4FSB A;  4UWR B;  5HIS A;  2YNW A;  4ZEJ A;  2QED A;  1YCG A;  1XTO A;  5HIP A;  4AX0 B;  4GCW A;  1WW1 A;  4HL1 A;  4GYQ A;  1M2X A;  2M5C A;  4WD6 A;  3IDZ A;  1VGN A;  5AEB A;  1K07 A;  4TZF A;  5K4M A;  3FCZ A;  2WYM A;  2YNU A;  2BG2 A;  2QJS A;  2I7T A;  3SBL A;  1BC2 A;  1JJE A;  1KO3 A;  4H0D A;  4UWS B;  3PY5 A;  2BR6 A;  1YCH A;  4J5H A;  5EHT A;  2BIB A;  2BG6 A;  3P2U A;  3SPU A;  3SW3 A;  2Q0I A;  2YCB A;  3KNR A;  2BG8 B;  4EXY A;  3BK1 A;  4D1U A;  3AF5 A;  5HH6 A;  3ZNB A;  5B1U A;  4RBS A;  3IE0 A;  1ZTC A;  3Q6V A;  5ACU A;  3AF6 A;  3IEL A;  5EVD A;  3DHC A;  2BG7 A;  3F9O A;  2XR1 A;  3IE2 A;  3X2Z A;  2ZO4 A;  4DIK A;  4XUK A;  4ZO3 A;  2GMN A;  3T9M A;  3VPE A;  5AXO A;  5K0W A;  5LE1 A;  5KIK A;  4AX1 B;  4EFZ A;  1MQO A;  4O98 A;  4EYL A;  4ZO2 A;  3PY6 A;  5AJL A;  1ZNB A;  3SFP A;  3I0V A;  2BFL A;  4XWW A;  2Y87 A;  5KIL A;  4TZ9 A;  2GFJ A;  5ACP A;  5FQB A;  3DH8 A;  1BVT A;  1KR3 A;  1JT1 A;  1VME A;  2WYM C;  4BP0 A;  4C1F A;  4C1E A;  3L6N A;  4C1H A;  2AIO A;  1A7T A;  5LM6 A;  3IE1 A;  2WHG A;  2XF4 A;  2YNV B;  2ZNB A;  2BFK A;  3I15 A;  5AIJ A;  3G1P A;  4J5F A;  5A5Z A;  2OHI A;  2P97 A;  4TYT A;  2NZF A;  2NZE A;  2YNT B;  3DHA A;  5A87 A;  5LMC A;  2WRS A;  5HIO A;  5HH4 A;  2QIN A;  5LSC A;  4RM5 A;  5LCA A;  5K4K A;  2YHE A;  3AJ3 A;  2BMI A;  2AZ4 A;  3WXC A;  2WYL A;  2FU6 A;  4RAM A;  3RKJ A;  3ZQ4 A;  5FQA A;  4YSL A;  4CHL A;  5FQC A;  3ADR A;  5HIQ A;  4C09 A;  3ESH A;  5LS3 A;  5B3R A;  3VQZ A;  4Z5Y A;  2P1E A;  4EYF A;  2CFZ A;  3PG4 A;  4HL2 A;  2HB9 A;  2Q0J A;  1WUO A;  1QH5 A;  3RPC A;  2BFZ B;  4D02 A;  2M5D A;  4RL2 A;  4KEP A;  2NXA A;  2BTN A;  3S0Z A;  3FAI A;  4DIL A;  5EW0 A;  5ACR A;  2BGA A;  2ZWR A;  2BG8 A;  5ACV A;  5AYA A;  2GFK A;  4C1G A;  2DOO A;  3LVZ A;  2FU7 A;  2CG3 A;  4P62 A;  1X8G A;  3T3O A;  2GKL A;  4U4L A;  3IOG A;  2P18 A;  4ZNB A;  3I13 A;  2GCU A;  4NQ4 A;  3KNS A;  2FHX B;  1BMC A;  5A0T A;  4F6Z A;  1DDK A;  5EV8 A;  3IOF A;  1X8I A;  2QDS A;  4EYB A;  4C1D A;  4Z7R A;  1KO2 A;  3MD7 A;  1DXK A;  5K4N A; 
#chains in the Genus database with same CATH homology
 5EV6 A;  3X2Y A;  5B15 A;  1HLK A;  2FU8 A;  5AXR A;  4BZ3 A;  3ZR9 A;  4Z67 A;  4D1W A;  5LCF A;  5AHO A;  2OHJ A;  2Q42 A;  3RKK A;  5EWA A;  4UA4 A;  5ACS A;  2I7V A;  2NYP A;  2ZZI A;  4YSK A;  2DKF A;  2YNV A;  3BC2 A;  5EVK A;  2VW8 A;  1E5D A;  2A7M A;  5AHR A;  5EH9 A;  5EVB A;  2Y8A A;  4NQ5 A;  4TZB A;  5ACW A;  4D1T A;  2YNT A;  4KEQ A;  4AD9 A;  3T3N A;  1QH3 A;  5ACQ A;  3IEM A;  3TP9 A;  5A0V A;  3SD9 A;  4UWP B;  1XM8 A;  3I11 A;  2R2D A;  4V0H A;  4HKY A;  1VJN A;  4RL0 A;  4B87 A;  3R2U A;  5HH5 A;  3BV6 A;  2H6A A;  3BK2 A;  2FU9 A;  2I7X A;  2E7Y A;  4AWY B;  1A8T A;  2P4Z A;  4C1C A;  4UWO B;  2CBN A;  2Y8B A;  1YCF A;  3ZWF A;  4FEK A;  4D1V A;  2BFZ A;  3A4Y A;  4JO0 A;  3DHB A;  5DPX A;  2FK6 A;  1WUP A;  5ACT A;  4EXS A;  2YZ3 A;  3SRX A;  4LE6 A;  2Q9U A;  4UAM A;  1X8H A;  5LLD A;  4GYU A;  3X2X A;  3X30 A;  5ACX A;  4XWT A;  4Z6X A;  4RAW A;  4FR7 A;  1SML A;  3IEK A;  5IQK A;  5LCH A;  4UBQ A;  2UYX A;  2FHX A;  1WRA A;  3H3E A;  4YSB A;  2QDT A;  1P9E A;  2OHH A;  4TZE A;  4Z5Z A;  1Y44 A;  1DD6 A;  4NQ6 A;  4NQ2 A;  3JXP A;  3I14 A;  4TYF A;  4PVO A;  4AWZ A;  4EY2 A;  3QH8 A;  1L9Y A;  4PVT A;  4F6H A;  3KL7 A;  1ZKP A;  2FM6 A;  1JJT A;  2BC2 A;  4Z60 A;  4FSB A;  4UWR B;  5HIS A;  2YNW A;  4ZEJ A;  2QED A;  1YCG A;  1XTO A;  5HIP A;  4AX0 B;  4GCW A;  1WW1 A;  4HL1 A;  4GYQ A;  1M2X A;  2M5C A;  4WD6 A;  3IDZ A;  1VGN A;  5AEB A;  1K07 A;  4TZF A;  5K4M A;  3FCZ A;  2WYM A;  2YNU A;  2BG2 A;  2QJS A;  2I7T A;  3SBL A;  1BC2 A;  1JJE A;  1KO3 A;  4H0D A;  4UWS B;  3PY5 A;  2BR6 A;  1YCH A;  4J5H A;  5EHT A;  2BIB A;  2BG6 A;  3P2U A;  3SPU A;  3SW3 A;  2Q0I A;  2YCB A;  3KNR A;  2BG8 B;  4EXY A;  3BK1 A;  4D1U A;  3AF5 A;  5HH6 A;  3ZNB A;  5B1U A;  4RBS A;  3IE0 A;  1ZTC A;  3Q6V A;  5ACU A;  3AF6 A;  3IEL A;  5EVD A;  3DHC A;  2BG7 A;  3F9O A;  2XR1 A;  3IE2 A;  3X2Z A;  2ZO4 A;  4DIK A;  4XUK A;  4ZO3 A;  2GMN A;  3T9M A;  3VPE A;  5AXO A;  5K0W A;  5LE1 A;  5KIK A;  4AX1 B;  4EFZ A;  1MQO A;  4O98 A;  4EYL A;  4ZO2 A;  3PY6 A;  1ZNB A;  3SFP A;  3I0V A;  2BFL A;  4XWW A;  2Y87 A;  5KIL A;  4TZ9 A;  2GFJ A;  5ACP A;  5FQB A;  3DH8 A;  1BVT A;  1KR3 A;  1JT1 A;  1VME A;  2WYM C;  4BP0 A;  4C1F A;  4C1E A;  3L6N A;  4C1H A;  2AIO A;  1A7T A;  5LM6 A;  3IE1 A;  2WHG A;  2XF4 A;  2YNV B;  2ZNB A;  2BFK A;  3I15 A;  3G1P A;  4J5F A;  5A5Z A;  2OHI A;  2P97 A;  4TYT A;  2NZF A;  2NZE A;  2YNT B;  3DHA A;  5A87 A;  5LMC A;  2WRS A;  5HIO A;  5HH4 A;  2QIN A;  5LSC A;  4RM5 A;  5LCA A;  5K4K A;  3AJ3 A;  2BMI A;  2AZ4 A;  3WXC A;  2WYL A;  2FU6 A;  4RAM A;  3RKJ A;  3ZQ4 A;  5FQA A;  4YSL A;  4CHL A;  5FQC A;  3ADR A;  5HIQ A;  4C09 A;  3ESH A;  5LS3 A;  5B3R A;  3VQZ A;  4Z5Y A;  2P1E A;  4EYF A;  3PG4 A;  4HL2 A;  2HB9 A;  2Q0J A;  1WUO A;  1QH5 A;  3RPC A;  2BFZ B;  4D02 A;  2M5D A;  4RL2 A;  4KEP A;  2NXA A;  2BTN A;  3S0Z A;  3FAI A;  4DIL A;  5EW0 A;  5ACR A;  2BGA A;  2ZWR A;  2BG8 A;  5ACV A;  5AYA A;  2GFK A;  4C1G A;  2DOO A;  3LVZ A;  2FU7 A;  4P62 A;  1X8G A;  3T3O A;  2GKL A;  4U4L A;  3IOG A;  2P18 A;  4ZNB A;  3I13 A;  2GCU A;  4NQ4 A;  3KNS A;  2FHX B;  1BMC A;  5A0T A;  4F6Z A;  1DDK A;  5EV8 A;  3IOF A;  1X8I A;  2QDS A;  4EYB A;  4C1D A;  4Z7R A;  1KO2 A;  3MD7 A;  1DXK A;  5K4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...