1VJNA

Crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
209
structure length
194
Chain Sequence
HMKITWFGHACFALEMEGKTIVTDPFDPIPNVTADVVTESHQHNAHHLVKGNFRVIDRPGAYTVNGVKIKGVETFHDGKNIVFVFEGEGIKVCHLGDLGHVLTPAQVEEIGEIDVLLVPVGGTYTIGPKEAKEVADLLNAKVIIPMHYKTKYLKFNLLPVDDFLKLFDSYERVGNILELFEKPKERKVVVMEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Zn-dependent hydrolase of metallo-beta-lactamase superfamily (TM0207) from Thermotoga maritima at 2.00 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords Zn-dependent hydrolase of metallo-beta-lactamase superfamily
total genus 43
structure length 194
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1vjnA00
3TP9A 4RAWA 2YZ3A 4CHLA 5LSCA 3WXCA 2YNWA 2OHHA 3PG4A 1BMCA 3ZQ4A 1P9EA 5ACXA 5EHTA 1YCGA 4EYBA 4D1WA 4Z5ZA 1JT1A 2BGAA 3FAIA 4TYFA 3A4YA 2QDSA 5EVKA 5LCHA 3L6NA 2BG7A 3PY5A 2WYMC 5LE1A 5FQCA 5FQAA 3I13A 2E7YA 4PVTA 5HISA 3VQZA 4NQ2A 2CBNA 4F6HA 2BR6A 4D1UA 4D02A 2ZZIA 2FU6A 4GCWA 1KO2A 1KR3A 2QINA 2YNVA 4DILA 5A87A 2BG6A 5LS3A 3AF6A 1JJEA 3X30A 4C1GA 2A7MA 3SW3A 3I14A 2P97A 1QH5A 3ZNBA 5HIOA 1DDKA 4EXYA 2FU7A 2GCUA 2YNVB 5FQBA 5KIKA 4UWSB 3IEKA 1QH3A 5ACUA 1WRAA 4C09A 5ACRA 2ZO4A 2YNTB 2NYPA 2GKLA 4ZEJA 4HL2A 5B15A 1K07A 2QDTA 4EYLA 5HIPA 3PY6A 5AXRA 5LMCA 3ZR9A 1E5DA 1WUOA 5ACWA 4TZBA 3I0VA 3DH8A 4NQ5A 5ACSA 2BG2A 3SPUA 4C1CA 5AYAA 2FHXB 4EYFA 2BMIA 4C1HA 2WYLA 2FU9A 1XM8A 4HL1A 2I7XA 5EV6A 1KO3A 3T3NA 4ZO3A 4Z6XA 5LCAA 5K4MA 2NZEA 2Q0IA 3H3EA 1YCFA 2XR1A 2QEDA 4ZNBA 5A5ZA 5EVDA 4FEKA 2WRSA 2DOOA 2I7TA 2H6AA 3RKJA 4XWWA 2Q42A 2R2DA 5HH4A 3T9MA 2BIBA 5AXOA 3ADRA 3RPCA 1HLKA 1ZNBA 1A8TA 3IE2A 4YSLA 4C1DA 2WHGA 3VPEA 2QJSA 4V0HA 4O98A 2AIOA 3DHCA 3FCZA 4B87A 2BFZB 2P4ZA 5K0WA 2HB9A 2BC2A 4TZFA 2DKFA 1XTOA 4RM5A 4RAMA 5EW0A 4BP0A 3AF5A 2FM6A 4Z60A 2FK6A 3SD9A 2ZWRA 2YCBA 3KNRA 4GYUA 4PVOA 4RBSA 4UAMA 4TYTA 2FHXA 5EH9A 5ACPA 1WUPA 4KEQA 1A7TA 2NZFA 3KL7A 4GYQA 3JXPA 3SFPA 2P1EA 4XUKA 4YSBA 2GFJA 1VGNA 3F9OA 1X8HA 3LVZA 5HH5A 2BFZA 4D1TA 3BC2A 3MD7A 1YCHA 3I15A 2GMNA 5EV8A 1L9YA 1X8IA 2I7VA 2GFKA 3KNSA 4XWTA 2NXAA 5DPXA 3X2ZA 5HH6A 4UWPB 5A0TA 3IE1A 4P62A 4TZEA 4NQ4A 5HIQA 4AD9A 4FSBA 2YNUA 2ZNBA 5K4NA 3ZWFA 2Y8AA 5EVBA 2BTNA 4AX0B 4EXSA 3T3OA 4C1EA 3BV6A 2BG8A 5AEBA 4RL0A 1BVTA 1M2XA 2M5DA 3BK1A 4F6ZA 5KILA 5ACVA 1MQOA 4YSKA 4U4LA 3X2XA 1JJTA 3AJ3A 4J5HA 2AZ4A 2P18A 4NQ6A 5B1UA 4RL2A 4DIKA 1X8GA 4UWRB 5EWAA 3IEMA 4UBQA 4Z5YA 2YNTA 4H0DA 4EFZA 2OHJA 2Y87A 5K4KA 4FR7A 1ZKPA 2Q9UA 4Z67A 4WD6A 5LCFA 5B3RA 5AHOA 5A0VA 4LE6A 1ZTCA 2BFLA 4KEPA 2FU8A 3G1PA 2BG8B 3X2YA 2OHIA 5ACQA 4UA4A 1DXKA 3P2UA 1DD6A 5IQKA 3IDZA 5LM6A 4TZ9A 3IELA 1BC2A 3IOGA 4J5FA 4UWOB 4AWYB 3Q6VA 1SMLA 2XF4A 4HKYA 2Q0JA 3IOFA 5ACTA 3RKKA 3DHBA 2M5CA 3I11A 3IE0A 1WW1A 3DHAA 3QH8A 3S0ZA 2Y8BA 2VW8A 2BFKA 1VMEA 3SRXA 5LLDA 4AWZA 1VJNA 4Z7RA 3ESHA 4ZO2A 4BZ3A 4C1FA 2WYMA 4D1VA 4JO0A 3R2UA 5AHRA 3SBLA 4EY2A 3BK2A 1Y44A 2UYXA 4AX1B
chains in the Genus database with same CATH superfamily
3TP9A 4RAWA 2YZ3A 4CHLA 5LSCA 3WXCA 2YNWA 2OHHA 3PG4A 1BMCA 3ZQ4A 1P9EA 5ACXA 5EHTA 1YCGA 4EYBA 4D1WA 4Z5ZA 1JT1A 2BGAA 3FAIA 4TYFA 3A4YA 2QDSA 5EVKA 5LCHA 3L6NA 2BG7A 3PY5A 2WYMC 5LE1A 5FQCA 5FQAA 3I13A 2E7YA 4PVTA 5HISA 3VQZA 4NQ2A 2CBNA 4F6HA 2BR6A 4D1UA 4D02A 2ZZIA 2FU6A 4GCWA 1KO2A 1KR3A 2QINA 2YNVA 4DILA 5A87A 2BG6A 5LS3A 3AF6A 1JJEA 3X30A 4C1GA 2A7MA 3SW3A 3I14A 2P97A 1QH5A 3ZNBA 5HIOA 1DDKA 4EXYA 2FU7A 2GCUA 2YNVB 5FQBA 5KIKA 4UWSB 3IEKA 1QH3A 5ACUA 1WRAA 4C09A 5ACRA 2ZO4A 2YNTB 2NYPA 2GKLA 4ZEJA 4HL2A 5B15A 1K07A 2QDTA 4EYLA 5HIPA 3PY6A 5AXRA 5LMCA 2CFUA 3ZR9A 1E5DA 1WUOA 5ACWA 4TZBA 3I0VA 4AXHA 3DH8A 4NQ5A 5ACSA 2BG2A 3SPUA 4C1CA 5AYAA 2FHXB 2CG3A 4EYFA 2BMIA 4C1HA 2WYLA 2FU9A 1XM8A 4HL1A 2I7XA 5EV6A 1KO3A 3T3NA 4ZO3A 4Z6XA 5LCAA 5K4MA 2NZEA 2Q0IA 3H3EA 1YCFA 2XR1A 2QEDA 4ZNBA 5A5ZA 5EVDA 4FEKA 4PDXA 2WRSA 2DOOA 2I7TA 2H6AA 3RKJA 5AJLA 4XWWA 2Q42A 2R2DA 5HH4A 3T9MA 2BIBA 5AXOA 3ADRA 3RPCA 1HLKA 1ZNBA 1A8TA 3IE2A 4YSLA 4C1DA 2WHGA 3VPEA 2QJSA 4V0HA 4O98A 2AIOA 3DHCA 3FCZA 4B87A 2BFZB 2P4ZA 5K0WA 2HB9A 2BC2A 4TZFA 2DKFA 5A23A 1XTOA 4RM5A 4RAMA 5EW0A 4BP0A 3AF5A 2FM6A 4Z60A 2FK6A 3SD9A 2ZWRA 2YCBA 3KNRA 4GYUA 4PVOA 4RBSA 4UAMA 4TYTA 2FHXA 5EH9A 5ACPA 5AIJA 1WUPA 4KEQA 2CFZA 1A7TA 2NZFA 3KL7A 4GYQA 3JXPA 3SFPA 2P1EA 4XUKA 4YSBA 2GFJA 1VGNA 3F9OA 1X8HA 2YHEA 3LVZA 5HH5A 2BFZA 4D1TA 3BC2A 3MD7A 1YCHA 3I15A 2GMNA 5EV8A 1L9YA 1X8IA 2I7VA 2GFKA 3KNSA 4XWTA 2NXAA 5DPXA 3X2ZA 5HH6A 4UWPB 5A0TA 3IE1A 4P62A 4TZEA 4NQ4A 5HIQA 4AD9A 4FSBA 2YNUA 2ZNBA 5K4NA 3ZWFA 2Y8AA 5EVBA 2BTNA 4AX0B 4EXSA 3T3OA 4C1EA 3BV6A 2BG8A 5AEBA 4RL0A 1BVTA 1M2XA 2M5DA 3BK1A 4F6ZA 5KILA 5ACVA 1MQOA 4YSKA 4U4LA 3X2XA 1JJTA 3AJ3A 4J5HA 2AZ4A 2P18A 4NQ6A 5B1UA 4RL2A 4DIKA 1X8GA 4UWRB 5EWAA 3IEMA 4UBQA 4Z5YA 2YNTA 4H0DA 4EFZA 2OHJA 2Y87A 5K4KA 4FR7A 1ZKPA 2Q9UA 4Z67A 4WD6A 5LCFA 5B3RA 5AHOA 5A0VA 4LE6A 1ZTCA 2BFLA 4KEPA 2FU8A 3G1PA 2BG8B 3X2YA 2OHIA 5ACQA 4UA4A 1DXKA 3P2UA 1DD6A 5IQKA 3IDZA 5LM6A 4TZ9A 3IELA 4NURA 1BC2A 3IOGA 4J5FA 4UWOB 4AWYB 3Q6VA 1SMLA 2XF4A 4HKYA 2Q0JA 3IOFA 5ACTA 3RKKA 3DHBA 2M5CA 3I11A 3IE0A 1WW1A 3DHAA 3QH8A 3S0ZA 2Y8BA 2VW8A 2BFKA 1VMEA 3SRXA 5LLDA 4AWZA 1VJNA 4Z7RA 3ESHA 4ZO2A 2CG2A 4BZ3A 4C1FA 2WYMA 4D1VA 4JO0A 3R2UA 5AHRA 3SBLA 4EY2A 3BK2A 4AV7A 1Y44A 2UYXA 4AX1B
chains in the Genus database with same CATH topology
3TP9A 4RAWA 2YZ3A 4CHLA 5LSCA 3WXCA 2YNWA 2OHHA 3PG4A 1BMCA 3ZQ4A 1P9EA 5ACXA 5EHTA 1YCGA 4EYBA 4D1WA 4Z5ZA 1JT1A 2BGAA 3FAIA 4TYFA 3A4YA 2QDSA 5EVKA 5LCHA 3L6NA 2BG7A 3PY5A 2WYMC 5LE1A 5FQCA 5FQAA 3I13A 2E7YA 4PVTA 5HISA 3VQZA 4NQ2A 2CBNA 4F6HA 2BR6A 4D1UA 4D02A 2ZZIA 2FU6A 4GCWA 1KO2A 1KR3A 2QINA 2YNVA 4DILA 5A87A 2BG6A 5LS3A 3AF6A 1JJEA 3X30A 4C1GA 2A7MA 3SW3A 3I14A 2P97A 1QH5A 3ZNBA 5HIOA 1DDKA 4EXYA 2FU7A 2GCUA 2YNVB 5FQBA 5KIKA 4UWSB 3IEKA 1QH3A 5ACUA 1WRAA 4C09A 5ACRA 2ZO4A 2YNTB 2NYPA 2GKLA 4ZEJA 4HL2A 5B15A 1K07A 2QDTA 4EYLA 5HIPA 3PY6A 5AXRA 5LMCA 3ZR9A 1E5DA 1WUOA 5ACWA 4TZBA 3I0VA 3DH8A 4NQ5A 5ACSA 2BG2A 3SPUA 4C1CA 5AYAA 2FHXB 4EYFA 2BMIA 4C1HA 2WYLA 2FU9A 1XM8A 4HL1A 2I7XA 5EV6A 1KO3A 3T3NA 4ZO3A 4Z6XA 5LCAA 5K4MA 2NZEA 2Q0IA 3H3EA 1YCFA 2XR1A 2QEDA 4ZNBA 5A5ZA 5EVDA 4FEKA 2WRSA 2DOOA 2I7TA 2H6AA 3RKJA 4XWWA 2Q42A 2R2DA 5HH4A 3T9MA 2BIBA 5AXOA 3ADRA 3RPCA 1HLKA 1ZNBA 1A8TA 3IE2A 4YSLA 4C1DA 2WHGA 3VPEA 2QJSA 4V0HA 4O98A 2AIOA 3DHCA 3FCZA 4B87A 2BFZB 2P4ZA 5K0WA 2HB9A 2BC2A 4TZFA 2DKFA 1XTOA 4RM5A 4RAMA 5EW0A 4BP0A 3AF5A 2FM6A 4Z60A 2FK6A 3SD9A 2ZWRA 2YCBA 3KNRA 4GYUA 4PVOA 4RBSA 4UAMA 4TYTA 2FHXA 5EH9A 5ACPA 1WUPA 4KEQA 1A7TA 2NZFA 3KL7A 4GYQA 3JXPA 3SFPA 2P1EA 4XUKA 4YSBA 2GFJA 1VGNA 3F9OA 1X8HA 3LVZA 5HH5A 2BFZA 4D1TA 3BC2A 3MD7A 1YCHA 3I15A 2GMNA 5EV8A 1L9YA 1X8IA 2I7VA 2GFKA 3KNSA 4XWTA 2NXAA 5DPXA 3X2ZA 5HH6A 4UWPB 5A0TA 3IE1A 4P62A 4TZEA 4NQ4A 5HIQA 4AD9A 4FSBA 2YNUA 2ZNBA 5K4NA 3ZWFA 2Y8AA 5EVBA 2BTNA 4AX0B 4EXSA 3T3OA 4C1EA 3BV6A 2BG8A 5AEBA 4RL0A 1BVTA 1M2XA 2M5DA 3BK1A 4F6ZA 5KILA 5ACVA 1MQOA 4YSKA 4U4LA 3X2XA 1JJTA 3AJ3A 4J5HA 2AZ4A 2P18A 4NQ6A 5B1UA 4RL2A 4DIKA 1X8GA 4UWRB 5EWAA 3IEMA 4UBQA 4Z5YA 2YNTA 4H0DA 4EFZA 2OHJA 2Y87A 5K4KA 4FR7A 1ZKPA 2Q9UA 4Z67A 4WD6A 5LCFA 5B3RA 5AHOA 5A0VA 4LE6A 1ZTCA 2BFLA 4KEPA 2FU8A 3G1PA 2BG8B 3X2YA 2OHIA 5ACQA 4UA4A 1DXKA 3P2UA 1DD6A 5IQKA 3IDZA 5LM6A 4TZ9A 3IELA 1BC2A 3IOGA 4J5FA 4UWOB 4AWYB 3Q6VA 1SMLA 2XF4A 4HKYA 2Q0JA 3IOFA 5ACTA 3RKKA 3DHBA 2M5CA 3I11A 3IE0A 1WW1A 3DHAA 3QH8A 3S0ZA 2Y8BA 2VW8A 2BFKA 1VMEA 3SRXA 5LLDA 4AWZA 1VJNA 4Z7RA 3ESHA 4ZO2A 4BZ3A 4C1FA 2WYMA 4D1VA 4JO0A 3R2UA 5AHRA 3SBLA 4EY2A 3BK2A 1Y44A 2UYXA 4AX1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TP9 A;  4RAW A;  2YZ3 A;  4CHL A;  5LSC A;  3WXC A;  2YNW A;  2OHH A;  3PG4 A;  1BMC A;  3ZQ4 A;  1P9E A;  5ACX A;  5EHT A;  1YCG A;  4EYB A;  4D1W A;  4Z5Z A;  1JT1 A;  2BGA A;  3FAI A;  4TYF A;  3A4Y A;  2QDS A;  5EVK A;  5LCH A;  3L6N A;  2BG7 A;  3PY5 A;  2WYM C;  5LE1 A;  5FQC A;  5FQA A;  3I13 A;  2E7Y A;  4PVT A;  5HIS A;  3VQZ A;  4NQ2 A;  2CBN A;  4F6H A;  2BR6 A;  4D1U A;  4D02 A;  2ZZI A;  2FU6 A;  4GCW A;  1KO2 A;  1KR3 A;  2QIN A;  2YNV A;  4DIL A;  5A87 A;  2BG6 A;  5LS3 A;  3AF6 A;  1JJE A;  3X30 A;  4C1G A;  2A7M A;  3SW3 A;  3I14 A;  2P97 A;  1QH5 A;  3ZNB A;  5HIO A;  1DDK A;  4EXY A;  2FU7 A;  2GCU A;  2YNV B;  5FQB A;  5KIK A;  4UWS B;  3IEK A;  1QH3 A;  5ACU A;  1WRA A;  4C09 A;  5ACR A;  2ZO4 A;  2YNT B;  2NYP A;  2GKL A;  4ZEJ A;  4HL2 A;  5B15 A;  1K07 A;  2QDT A;  4EYL A;  5HIP A;  3PY6 A;  5AXR A;  5LMC A;  3ZR9 A;  1E5D A;  1WUO A;  5ACW A;  4TZB A;  3I0V A;  3DH8 A;  4NQ5 A;  5ACS A;  2BG2 A;  3SPU A;  4C1C A;  5AYA A;  2FHX B;  4EYF A;  2BMI A;  4C1H A;  2WYL A;  2FU9 A;  1XM8 A;  4HL1 A;  2I7X A;  5EV6 A;  1KO3 A;  3T3N A;  4ZO3 A;  4Z6X A;  5LCA A;  5K4M A;  2NZE A;  2Q0I A;  3H3E A;  1YCF A;  2XR1 A;  2QED A;  4ZNB A;  5A5Z A;  5EVD A;  4FEK A;  2WRS A;  2DOO A;  2I7T A;  2H6A A;  3RKJ A;  4XWW A;  2Q42 A;  2R2D A;  5HH4 A;  3T9M A;  2BIB A;  5AXO A;  3ADR A;  3RPC A;  1HLK A;  1ZNB A;  1A8T A;  3IE2 A;  4YSL A;  4C1D A;  2WHG A;  3VPE A;  2QJS A;  4V0H A;  4O98 A;  2AIO A;  3DHC A;  3FCZ A;  4B87 A;  2BFZ B;  2P4Z A;  5K0W A;  2HB9 A;  2BC2 A;  4TZF A;  2DKF A;  1XTO A;  4RM5 A;  4RAM A;  5EW0 A;  4BP0 A;  3AF5 A;  2FM6 A;  4Z60 A;  2FK6 A;  3SD9 A;  2ZWR A;  2YCB A;  3KNR A;  4GYU A;  4PVO A;  4RBS A;  4UAM A;  4TYT A;  2FHX A;  5EH9 A;  5ACP A;  1WUP A;  4KEQ A;  1A7T A;  2NZF A;  3KL7 A;  4GYQ A;  3JXP A;  3SFP A;  2P1E A;  4XUK A;  4YSB A;  2GFJ A;  1VGN A;  3F9O A;  1X8H A;  3LVZ A;  5HH5 A;  2BFZ A;  4D1T A;  3BC2 A;  3MD7 A;  1YCH A;  3I15 A;  2GMN A;  5EV8 A;  1L9Y A;  1X8I A;  2I7V A;  2GFK A;  3KNS A;  4XWT A;  2NXA A;  5DPX A;  3X2Z A;  5HH6 A;  4UWP B;  5A0T A;  3IE1 A;  4P62 A;  4TZE A;  4NQ4 A;  5HIQ A;  4AD9 A;  4FSB A;  2YNU A;  2ZNB A;  5K4N A;  3ZWF A;  2Y8A A;  5EVB A;  2BTN A;  4AX0 B;  4EXS A;  3T3O A;  4C1E A;  3BV6 A;  2BG8 A;  5AEB A;  4RL0 A;  1BVT A;  1M2X A;  2M5D A;  3BK1 A;  4F6Z A;  5KIL A;  5ACV A;  1MQO A;  4YSK A;  4U4L A;  3X2X A;  1JJT A;  3AJ3 A;  4J5H A;  2AZ4 A;  2P18 A;  4NQ6 A;  5B1U A;  4RL2 A;  4DIK A;  1X8G A;  4UWR B;  5EWA A;  3IEM A;  4UBQ A;  4Z5Y A;  2YNT A;  4H0D A;  4EFZ A;  2OHJ A;  2Y87 A;  5K4K A;  4FR7 A;  1ZKP A;  2Q9U A;  4Z67 A;  4WD6 A;  5LCF A;  5B3R A;  5AHO A;  5A0V A;  4LE6 A;  1ZTC A;  2BFL A;  4KEP A;  2FU8 A;  3G1P A;  2BG8 B;  3X2Y A;  2OHI A;  5ACQ A;  4UA4 A;  1DXK A;  3P2U A;  1DD6 A;  5IQK A;  3IDZ A;  5LM6 A;  4TZ9 A;  3IEL A;  1BC2 A;  3IOG A;  4J5F A;  4UWO B;  4AWY B;  3Q6V A;  1SML A;  2XF4 A;  4HKY A;  2Q0J A;  3IOF A;  5ACT A;  3RKK A;  3DHB A;  2M5C A;  3I11 A;  3IE0 A;  1WW1 A;  3DHA A;  3QH8 A;  3S0Z A;  2Y8B A;  2VW8 A;  2BFK A;  1VME A;  3SRX A;  5LLD A;  4AWZ A;  1VJN A;  4Z7R A;  3ESH A;  4ZO2 A;  4BZ3 A;  4C1F A;  2WYM A;  4D1V A;  4JO0 A;  3R2U A;  5AHR A;  3SBL A;  4EY2 A;  3BK2 A;  1Y44 A;  2UYX A;  4AX1 B; 
#chains in the Genus database with same CATH topology
 3TP9 A;  4RAW A;  2YZ3 A;  4CHL A;  5LSC A;  3WXC A;  2YNW A;  2OHH A;  3PG4 A;  1BMC A;  3ZQ4 A;  1P9E A;  5ACX A;  5EHT A;  1YCG A;  4EYB A;  4D1W A;  4Z5Z A;  1JT1 A;  2BGA A;  3FAI A;  4TYF A;  3A4Y A;  2QDS A;  5EVK A;  5LCH A;  3L6N A;  2BG7 A;  3PY5 A;  2WYM C;  5LE1 A;  5FQC A;  5FQA A;  3I13 A;  2E7Y A;  4PVT A;  5HIS A;  3VQZ A;  4NQ2 A;  2CBN A;  4F6H A;  2BR6 A;  4D1U A;  4D02 A;  2ZZI A;  2FU6 A;  4GCW A;  1KO2 A;  1KR3 A;  2QIN A;  2YNV A;  4DIL A;  5A87 A;  2BG6 A;  5LS3 A;  3AF6 A;  1JJE A;  3X30 A;  4C1G A;  2A7M A;  3SW3 A;  3I14 A;  2P97 A;  1QH5 A;  3ZNB A;  5HIO A;  1DDK A;  4EXY A;  2FU7 A;  2GCU A;  2YNV B;  5FQB A;  5KIK A;  4UWS B;  3IEK A;  1QH3 A;  5ACU A;  1WRA A;  4C09 A;  5ACR A;  2ZO4 A;  2YNT B;  2NYP A;  2GKL A;  4ZEJ A;  4HL2 A;  5B15 A;  1K07 A;  2QDT A;  4EYL A;  5HIP A;  3PY6 A;  5AXR A;  5LMC A;  2CFU A;  3ZR9 A;  1E5D A;  1WUO A;  5ACW A;  4TZB A;  3I0V A;  4AXH A;  3DH8 A;  4NQ5 A;  5ACS A;  2BG2 A;  3SPU A;  4C1C A;  5AYA A;  2FHX B;  2CG3 A;  4EYF A;  2BMI A;  4C1H A;  2WYL A;  2FU9 A;  1XM8 A;  4HL1 A;  2I7X A;  5EV6 A;  1KO3 A;  3T3N A;  4ZO3 A;  4Z6X A;  5LCA A;  5K4M A;  2NZE A;  2Q0I A;  3H3E A;  1YCF A;  2XR1 A;  2QED A;  4ZNB A;  5A5Z A;  5EVD A;  4FEK A;  4PDX A;  2WRS A;  2DOO A;  2I7T A;  2H6A A;  3RKJ A;  5AJL A;  4XWW A;  2Q42 A;  2R2D A;  5HH4 A;  3T9M A;  2BIB A;  5AXO A;  3ADR A;  3RPC A;  1HLK A;  1ZNB A;  1A8T A;  3IE2 A;  4YSL A;  4C1D A;  2WHG A;  3VPE A;  2QJS A;  4V0H A;  4O98 A;  2AIO A;  3DHC A;  3FCZ A;  4B87 A;  2BFZ B;  2P4Z A;  5K0W A;  2HB9 A;  2BC2 A;  4TZF A;  2DKF A;  5A23 A;  1XTO A;  4RM5 A;  4RAM A;  5EW0 A;  4BP0 A;  3AF5 A;  2FM6 A;  4Z60 A;  2FK6 A;  3SD9 A;  2ZWR A;  2YCB A;  3KNR A;  4GYU A;  4PVO A;  4RBS A;  4UAM A;  4TYT A;  2FHX A;  5EH9 A;  5ACP A;  5AIJ A;  1WUP A;  4KEQ A;  2CFZ A;  1A7T A;  2NZF A;  3KL7 A;  4GYQ A;  3JXP A;  3SFP A;  2P1E A;  4XUK A;  4YSB A;  2GFJ A;  1VGN A;  3F9O A;  1X8H A;  2YHE A;  3LVZ A;  5HH5 A;  2BFZ A;  4D1T A;  3BC2 A;  3MD7 A;  1YCH A;  3I15 A;  2GMN A;  5EV8 A;  1L9Y A;  1X8I A;  2I7V A;  2GFK A;  3KNS A;  4XWT A;  2NXA A;  5DPX A;  3X2Z A;  5HH6 A;  4UWP B;  5A0T A;  3IE1 A;  4P62 A;  4TZE A;  4NQ4 A;  5HIQ A;  4AD9 A;  4FSB A;  2YNU A;  2ZNB A;  5K4N A;  3ZWF A;  2Y8A A;  5EVB A;  2BTN A;  4AX0 B;  4EXS A;  3T3O A;  4C1E A;  3BV6 A;  2BG8 A;  5AEB A;  4RL0 A;  1BVT A;  1M2X A;  2M5D A;  3BK1 A;  4F6Z A;  5KIL A;  5ACV A;  1MQO A;  4YSK A;  4U4L A;  3X2X A;  1JJT A;  3AJ3 A;  4J5H A;  2AZ4 A;  2P18 A;  4NQ6 A;  5B1U A;  4RL2 A;  4DIK A;  1X8G A;  4UWR B;  5EWA A;  3IEM A;  4UBQ A;  4Z5Y A;  2YNT A;  4H0D A;  4EFZ A;  2OHJ A;  2Y87 A;  5K4K A;  4FR7 A;  1ZKP A;  2Q9U A;  4Z67 A;  4WD6 A;  5LCF A;  5B3R A;  5AHO A;  5A0V A;  4LE6 A;  1ZTC A;  2BFL A;  4KEP A;  2FU8 A;  3G1P A;  2BG8 B;  3X2Y A;  2OHI A;  5ACQ A;  4UA4 A;  1DXK A;  3P2U A;  1DD6 A;  5IQK A;  3IDZ A;  5LM6 A;  4TZ9 A;  3IEL A;  4NUR A;  1BC2 A;  3IOG A;  4J5F A;  4UWO B;  4AWY B;  3Q6V A;  1SML A;  2XF4 A;  4HKY A;  2Q0J A;  3IOF A;  5ACT A;  3RKK A;  3DHB A;  2M5C A;  3I11 A;  3IE0 A;  1WW1 A;  3DHA A;  3QH8 A;  3S0Z A;  2Y8B A;  2VW8 A;  2BFK A;  1VME A;  3SRX A;  5LLD A;  4AWZ A;  1VJN A;  4Z7R A;  3ESH A;  4ZO2 A;  2CG2 A;  4BZ3 A;  4C1F A;  2WYM A;  4D1V A;  4JO0 A;  3R2U A;  5AHR A;  3SBL A;  4EY2 A;  3BK2 A;  4AV7 A;  1Y44 A;  2UYX A;  4AX1 B; 
#chains in the Genus database with same CATH homology
 3TP9 A;  4RAW A;  2YZ3 A;  4CHL A;  5LSC A;  3WXC A;  2YNW A;  2OHH A;  3PG4 A;  1BMC A;  3ZQ4 A;  1P9E A;  5ACX A;  5EHT A;  1YCG A;  4EYB A;  4D1W A;  4Z5Z A;  1JT1 A;  2BGA A;  3FAI A;  4TYF A;  3A4Y A;  2QDS A;  5EVK A;  5LCH A;  3L6N A;  2BG7 A;  3PY5 A;  2WYM C;  5LE1 A;  5FQC A;  5FQA A;  3I13 A;  2E7Y A;  4PVT A;  5HIS A;  3VQZ A;  4NQ2 A;  2CBN A;  4F6H A;  2BR6 A;  4D1U A;  4D02 A;  2ZZI A;  2FU6 A;  4GCW A;  1KO2 A;  1KR3 A;  2QIN A;  2YNV A;  4DIL A;  5A87 A;  2BG6 A;  5LS3 A;  3AF6 A;  1JJE A;  3X30 A;  4C1G A;  2A7M A;  3SW3 A;  3I14 A;  2P97 A;  1QH5 A;  3ZNB A;  5HIO A;  1DDK A;  4EXY A;  2FU7 A;  2GCU A;  2YNV B;  5FQB A;  5KIK A;  4UWS B;  3IEK A;  1QH3 A;  5ACU A;  1WRA A;  4C09 A;  5ACR A;  2ZO4 A;  2YNT B;  2NYP A;  2GKL A;  4ZEJ A;  4HL2 A;  5B15 A;  1K07 A;  2QDT A;  4EYL A;  5HIP A;  3PY6 A;  5AXR A;  5LMC A;  3ZR9 A;  1E5D A;  1WUO A;  5ACW A;  4TZB A;  3I0V A;  3DH8 A;  4NQ5 A;  5ACS A;  2BG2 A;  3SPU A;  4C1C A;  5AYA A;  2FHX B;  4EYF A;  2BMI A;  4C1H A;  2WYL A;  2FU9 A;  1XM8 A;  4HL1 A;  2I7X A;  5EV6 A;  1KO3 A;  3T3N A;  4ZO3 A;  4Z6X A;  5LCA A;  5K4M A;  2NZE A;  2Q0I A;  3H3E A;  1YCF A;  2XR1 A;  2QED A;  4ZNB A;  5A5Z A;  5EVD A;  4FEK A;  2WRS A;  2DOO A;  2I7T A;  2H6A A;  3RKJ A;  4XWW A;  2Q42 A;  2R2D A;  5HH4 A;  3T9M A;  2BIB A;  5AXO A;  3ADR A;  3RPC A;  1HLK A;  1ZNB A;  1A8T A;  3IE2 A;  4YSL A;  4C1D A;  2WHG A;  3VPE A;  2QJS A;  4V0H A;  4O98 A;  2AIO A;  3DHC A;  3FCZ A;  4B87 A;  2BFZ B;  2P4Z A;  5K0W A;  2HB9 A;  2BC2 A;  4TZF A;  2DKF A;  1XTO A;  4RM5 A;  4RAM A;  5EW0 A;  4BP0 A;  3AF5 A;  2FM6 A;  4Z60 A;  2FK6 A;  3SD9 A;  2ZWR A;  2YCB A;  3KNR A;  4GYU A;  4PVO A;  4RBS A;  4UAM A;  4TYT A;  2FHX A;  5EH9 A;  5ACP A;  1WUP A;  4KEQ A;  1A7T A;  2NZF A;  3KL7 A;  4GYQ A;  3JXP A;  3SFP A;  2P1E A;  4XUK A;  4YSB A;  2GFJ A;  1VGN A;  3F9O A;  1X8H A;  3LVZ A;  5HH5 A;  2BFZ A;  4D1T A;  3BC2 A;  3MD7 A;  1YCH A;  3I15 A;  2GMN A;  5EV8 A;  1L9Y A;  1X8I A;  2I7V A;  2GFK A;  3KNS A;  4XWT A;  2NXA A;  5DPX A;  3X2Z A;  5HH6 A;  4UWP B;  5A0T A;  3IE1 A;  4P62 A;  4TZE A;  4NQ4 A;  5HIQ A;  4AD9 A;  4FSB A;  2YNU A;  2ZNB A;  5K4N A;  3ZWF A;  2Y8A A;  5EVB A;  2BTN A;  4AX0 B;  4EXS A;  3T3O A;  4C1E A;  3BV6 A;  2BG8 A;  5AEB A;  4RL0 A;  1BVT A;  1M2X A;  2M5D A;  3BK1 A;  4F6Z A;  5KIL A;  5ACV A;  1MQO A;  4YSK A;  4U4L A;  3X2X A;  1JJT A;  3AJ3 A;  4J5H A;  2AZ4 A;  2P18 A;  4NQ6 A;  5B1U A;  4RL2 A;  4DIK A;  1X8G A;  4UWR B;  5EWA A;  3IEM A;  4UBQ A;  4Z5Y A;  2YNT A;  4H0D A;  4EFZ A;  2OHJ A;  2Y87 A;  5K4K A;  4FR7 A;  1ZKP A;  2Q9U A;  4Z67 A;  4WD6 A;  5LCF A;  5B3R A;  5AHO A;  5A0V A;  4LE6 A;  1ZTC A;  2BFL A;  4KEP A;  2FU8 A;  3G1P A;  2BG8 B;  3X2Y A;  2OHI A;  5ACQ A;  4UA4 A;  1DXK A;  3P2U A;  1DD6 A;  5IQK A;  3IDZ A;  5LM6 A;  4TZ9 A;  3IEL A;  1BC2 A;  3IOG A;  4J5F A;  4UWO B;  4AWY B;  3Q6V A;  1SML A;  2XF4 A;  4HKY A;  2Q0J A;  3IOF A;  5ACT A;  3RKK A;  3DHB A;  2M5C A;  3I11 A;  3IE0 A;  1WW1 A;  3DHA A;  3QH8 A;  3S0Z A;  2Y8B A;  2VW8 A;  2BFK A;  1VME A;  3SRX A;  5LLD A;  4AWZ A;  1VJN A;  4Z7R A;  3ESH A;  4ZO2 A;  4BZ3 A;  4C1F A;  2WYM A;  4D1V A;  4JO0 A;  3R2U A;  5AHR A;  3SBL A;  4EY2 A;  3BK2 A;  1Y44 A;  2UYX A;  4AX1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...