1VJNA

Crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
209
structure length
194
Chain Sequence
HMKITWFGHACFALEMEGKTIVTDPFDPIPNVTADVVTESHQHNAHHLVKGNFRVIDRPGAYTVNGVKIKGVETFHDGKNIVFVFEGEGIKVCHLGDLGHVLTPAQVEEIGEIDVLLVPVGGTYTIGPKEAKEVADLLNAKVIIPMHYKTKYLKFNLLPVDDFLKLFDSYERVGNILELFEKPKERKVVVMEVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zn-dependent hydrolase of metallo-beta-lactamase superfamily
publication title Crystal structure of Zn-dependent hydrolase of metallo-beta-lactamase superfamily (TM0207) from Thermotoga maritima at 2.00 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 43
structure length 194
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1vjnA00
2Y8AA 1WRAA 2I7TA 3T9MA 2YNVB 3IE1A 5LS3A 2Q9UA 2M5DA 1ZNBA 4Z5ZA 5ACUA 4TZ9A 1JJTA 2R2DA 1A7TA 5K4MA 1VMEA 1Y44A 5FQCA 4FSBA 4JO0A 5A0VA 5ACPA 3BK2A 3LVZA 2BTNA 5EHTA 2BFLA 4EXYA 3FCZA 3X2YA 4FR7A 3F9OA 4C1HA 2FK6A 2BC2A 2FU7A 3ZR9A 2GFJA 2QJSA 5B3RA 2GCUA 3ZWFA 2OHJA 3Q6VA 4ZO3A 2YCBA 2YNVA 4XWTA 4J5HA 1QH3A 3BC2A 2WYMA 4GCWA 3SW3A 5HISA 5LCHA 3I15A 3IE0A 1WUPA 4Z67A 1JJEA 1VGNA 1HLKA 1JT1A 3IE2A 2BR6A 4C1GA 4EYLA 2FM6A 2E7YA 4CHLA 3G1PA 4C09A 5FQAA 2FHXB 4AD9A 4Z5YA 2WRSA 5HH4A 4D1VA 3MD7A 3BV6A 3H3EA 2CBNA 3IOFA 1MQOA 1ZKPA 4RL2A 2QDSA 5AXOA 2OHHA 5ACXA 3X30A 2FU8A 4Z7RA 4LE6A 5K0WA 2WYLA 5EVKA 1P9EA 5LLDA 5LE1A 2BFKA 5A87A 4H0DA 1BC2A 5AEBA 3IEMA 5A0TA 1X8GA 5AYAA 5HIQA 1YCGA 4UWPB 2BG2A 4AX0B 5B1UA 3QH8A 4UWOB 4DILA 3DH8A 4PVOA 5ACSA 4O98A 4EYFA 1KO2A 4NQ2A 5HIPA 2NXAA 4RAWA 5EW0A 4HL1A 4FEKA 2Q0IA 5ACWA 3VQZA 2AZ4A 2BMIA 2HB9A 5ACVA 1SMLA 2I7XA 1WUOA 3RKKA 2XR1A 4TZBA 2I7VA 3IELA 2QEDA 5A5ZA 2GFKA 1DDKA 4GYUA 2DKFA 5ACQA 1L9YA 2ZO4A 4C1DA 3VPEA 2GMNA 2H6AA 4UWSB 3ADRA 2A7MA 2YNTB 5DPXA 3PG4A 3SFPA 4ZEJA 3SPUA 3PY5A 4C1CA 2FU6A 2WYMC 1KR3A 4BZ3A 3RKJA 2BG8B 4RAMA 3DHCA 5EVDA 2BIBA 4V0HA 2Q0JA 4PVTA 2Q42A 5EWAA 4C1EA 1X8IA 5IQKA 5LSCA 5FQBA 2UYXA 4NQ6A 4F6HA 3X2XA 3P2UA 3A4YA 3AF5A 1XTOA 2VW8A 5B15A 4UBQA 4TZEA 5EV6A 3RPCA 5HIOA 2ZNBA 2P97A 2BG8A 4NQ5A 3I0VA 1E5DA 1BMCA 3JXPA 5AHOA 3T3OA 2FHXA 4Z6XA 2DOOA 3IDZA 4D1WA 4EYBA 3IOGA 2M5CA 1XM8A 5K4NA 4TYFA 3DHBA 4D1UA 3FAIA 2OHIA 4UA4A 5AXRA 2XF4A 4C1FA 1K07A 2P18A 4NQ4A 5AHRA 5K4KA 5HH6A 4HL2A 5EV8A 1QH5A 1WW1A 4UAMA 3T3NA 3AF6A 3WXCA 3ZNBA 4TZFA 4D02A 2QINA 4UWRB 4ZNBA 3R2UA 4GYQA 4YSBA 4EFZA 5LCAA 3BK1A 5ACRA 5KILA 4P62A 2BG7A 3KL7A 4AX1B 4KEPA 1VJNA 4DIKA 3TP9A 2YZ3A 3SBLA 3S0ZA 4YSKA 1DXKA 4EY2A 4EXSA 2FU9A 1DD6A 5LCFA 5LM6A 3I13A 4TYTA 5LMCA 4U4LA 3AJ3A 2QDTA 3KNRA 2ZZIA 3KNSA 3PY6A 2BG6A 1A8TA 3I14A 2YNUA 4Z60A 2P4ZA 3DHAA 2WHGA 2P1EA 2AIOA 4D1TA 4AWYB 5KIKA 4RM5A 2BFZB 2YNTA 2YNWA 4XWWA 5ACTA 3SD9A 2GKLA 1YCFA 3ESHA 4HKYA 4WD6A 4ZO2A 2NYPA 4F6ZA 1YCHA 4AWZA 1BVTA 4RBSA 4RL0A 4YSLA 5EVBA 3SRXA 3I11A 4BP0A 1X8HA 2BGAA 2Y8BA 2NZFA 3ZQ4A 2Y87A 1ZTCA 3L6NA 5HH5A 4J5FA 2NZEA 3X2ZA 1M2XA 1KO3A 5EH9A 2ZWRA 4XUKA 2BFZA 4B87A 4KEQA 3IEKA
chains in the Genus database with same CATH superfamily
2Y8AA 1WRAA 2I7TA 3T9MA 2YNVB 3IE1A 5LS3A 2Q9UA 2M5DA 1ZNBA 4Z5ZA 5ACUA 4TZ9A 1JJTA 2R2DA 1A7TA 5K4MA 1VMEA 1Y44A 5FQCA 4FSBA 4JO0A 5A0VA 5ACPA 3BK2A 3LVZA 2BTNA 5EHTA 2BFLA 4EXYA 3FCZA 3X2YA 4FR7A 3F9OA 4C1HA 2FK6A 2BC2A 2FU7A 3ZR9A 2GFJA 2QJSA 5B3RA 2GCUA 3ZWFA 2OHJA 3Q6VA 4ZO3A 2YCBA 2YNVA 4XWTA 4J5HA 1QH3A 3BC2A 2WYMA 4GCWA 3SW3A 2CG3A 5HISA 5LCHA 3I15A 3IE0A 1WUPA 4Z67A 1JJEA 1VGNA 1HLKA 1JT1A 3IE2A 2BR6A 4C1GA 4EYLA 2FM6A 2E7YA 4CHLA 3G1PA 4C09A 5FQAA 2FHXB 4AD9A 4Z5YA 2WRSA 5HH4A 4D1VA 3MD7A 3BV6A 3H3EA 2CBNA 3IOFA 1MQOA 1ZKPA 4RL2A 2QDSA 5AXOA 2OHHA 5ACXA 3X30A 2FU8A 4Z7RA 4LE6A 5K0WA 2WYLA 5EVKA 1P9EA 5AJLA 5LLDA 5LE1A 2BFKA 5A87A 4H0DA 1BC2A 5AEBA 3IEMA 5A0TA 1X8GA 5AYAA 5HIQA 1YCGA 4UWPB 2BG2A 4AX0B 5B1UA 3QH8A 4UWOB 4DILA 4AV7A 3DH8A 4PVOA 5ACSA 4O98A 4EYFA 1KO2A 4NQ2A 5HIPA 2NXAA 4RAWA 5EW0A 4HL1A 4FEKA 2Q0IA 5ACWA 3VQZA 2AZ4A 2BMIA 2HB9A 5ACVA 1SMLA 2I7XA 1WUOA 3RKKA 2XR1A 4TZBA 2I7VA 3IELA 2QEDA 5A5ZA 2GFKA 1DDKA 4GYUA 2DKFA 5ACQA 1L9YA 2ZO4A 4C1DA 3VPEA 2GMNA 2H6AA 4UWSB 3ADRA 2A7MA 2YNTB 5DPXA 3PG4A 3SFPA 4ZEJA 3SPUA 3PY5A 4C1CA 2FU6A 2WYMC 1KR3A 4BZ3A 3RKJA 2BG8B 4RAMA 3DHCA 5EVDA 2BIBA 4V0HA 2Q0JA 4PVTA 2Q42A 5EWAA 4C1EA 1X8IA 5AIJA 5IQKA 5LSCA 5FQBA 2UYXA 4NQ6A 4F6HA 3X2XA 3P2UA 3A4YA 3AF5A 4NURA 1XTOA 2VW8A 5B15A 4UBQA 4TZEA 5EV6A 3RPCA 5HIOA 2ZNBA 2P97A 2BG8A 4NQ5A 3I0VA 1E5DA 1BMCA 3JXPA 5AHOA 3T3OA 2CG2A 2FHXA 4Z6XA 2DOOA 3IDZA 4D1WA 4EYBA 3IOGA 2M5CA 2YHEA 1XM8A 5K4NA 4TYFA 3DHBA 4D1UA 3FAIA 2OHIA 4UA4A 5AXRA 2XF4A 4C1FA 1K07A 2P18A 4NQ4A 5AHRA 5K4KA 5HH6A 4HL2A 5EV8A 1QH5A 1WW1A 4UAMA 3T3NA 3AF6A 3WXCA 3ZNBA 4TZFA 4D02A 2CFUA 2QINA 4UWRB 4ZNBA 3R2UA 4GYQA 4YSBA 4EFZA 5LCAA 3BK1A 5ACRA 5KILA 4P62A 2BG7A 3KL7A 4AX1B 4KEPA 1VJNA 4DIKA 3TP9A 2YZ3A 3SBLA 3S0ZA 4YSKA 1DXKA 4EY2A 4EXSA 2FU9A 1DD6A 5LCFA 2CFZA 5LM6A 3I13A 4TYTA 5LMCA 4AXHA 4U4LA 3AJ3A 2QDTA 5A23A 3KNRA 2ZZIA 3KNSA 3PY6A 2BG6A 1A8TA 3I14A 2YNUA 4Z60A 2P4ZA 3DHAA 2WHGA 2P1EA 2AIOA 4D1TA 4AWYB 5KIKA 4RM5A 2BFZB 2YNTA 2YNWA 4XWWA 5ACTA 3SD9A 2GKLA 1YCFA 3ESHA 4HKYA 4WD6A 4ZO2A 2NYPA 4F6ZA 1YCHA 4AWZA 4PDXA 1BVTA 4RBSA 4RL0A 4YSLA 5EVBA 3SRXA 3I11A 4BP0A 1X8HA 2BGAA 2Y8BA 2NZFA 3ZQ4A 2Y87A 1ZTCA 3L6NA 5HH5A 4J5FA 2NZEA 3X2ZA 1M2XA 1KO3A 5EH9A 2ZWRA 4XUKA 2BFZA 4B87A 4KEQA 3IEKA
chains in the Genus database with same CATH topology
2Y8AA 1WRAA 2I7TA 3T9MA 2YNVB 3IE1A 5LS3A 2Q9UA 2M5DA 1ZNBA 4Z5ZA 5ACUA 4TZ9A 1JJTA 2R2DA 1A7TA 5K4MA 1VMEA 1Y44A 5FQCA 4FSBA 4JO0A 5A0VA 5ACPA 3BK2A 3LVZA 2BTNA 5EHTA 2BFLA 4EXYA 3FCZA 3X2YA 4FR7A 3F9OA 4C1HA 2FK6A 2BC2A 2FU7A 3ZR9A 2GFJA 2QJSA 5B3RA 2GCUA 3ZWFA 2OHJA 3Q6VA 4ZO3A 2YCBA 2YNVA 4XWTA 4J5HA 1QH3A 3BC2A 2WYMA 4GCWA 3SW3A 5HISA 5LCHA 3I15A 3IE0A 1WUPA 4Z67A 1JJEA 1VGNA 1HLKA 1JT1A 3IE2A 2BR6A 4C1GA 4EYLA 2FM6A 2E7YA 4CHLA 3G1PA 4C09A 5FQAA 2FHXB 4AD9A 4Z5YA 2WRSA 5HH4A 4D1VA 3MD7A 3BV6A 3H3EA 2CBNA 3IOFA 1MQOA 1ZKPA 4RL2A 2QDSA 5AXOA 2OHHA 5ACXA 3X30A 2FU8A 4Z7RA 4LE6A 5K0WA 2WYLA 5EVKA 1P9EA 5LLDA 5LE1A 2BFKA 5A87A 4H0DA 1BC2A 5AEBA 3IEMA 5A0TA 1X8GA 5AYAA 5HIQA 1YCGA 4UWPB 2BG2A 4AX0B 5B1UA 3QH8A 4UWOB 4DILA 3DH8A 4PVOA 5ACSA 4O98A 4EYFA 1KO2A 4NQ2A 5HIPA 2NXAA 4RAWA 5EW0A 4HL1A 4FEKA 2Q0IA 5ACWA 3VQZA 2AZ4A 2BMIA 2HB9A 5ACVA 1SMLA 2I7XA 1WUOA 3RKKA 2XR1A 4TZBA 2I7VA 3IELA 2QEDA 5A5ZA 2GFKA 1DDKA 4GYUA 2DKFA 5ACQA 1L9YA 2ZO4A 4C1DA 3VPEA 2GMNA 2H6AA 4UWSB 3ADRA 2A7MA 2YNTB 5DPXA 3PG4A 3SFPA 4ZEJA 3SPUA 3PY5A 4C1CA 2FU6A 2WYMC 1KR3A 4BZ3A 3RKJA 2BG8B 4RAMA 3DHCA 5EVDA 2BIBA 4V0HA 2Q0JA 4PVTA 2Q42A 5EWAA 4C1EA 1X8IA 5IQKA 5LSCA 5FQBA 2UYXA 4NQ6A 4F6HA 3X2XA 3P2UA 3A4YA 3AF5A 1XTOA 2VW8A 5B15A 4UBQA 4TZEA 5EV6A 3RPCA 5HIOA 2ZNBA 2P97A 2BG8A 4NQ5A 3I0VA 1E5DA 1BMCA 3JXPA 5AHOA 3T3OA 2FHXA 4Z6XA 2DOOA 3IDZA 4D1WA 4EYBA 3IOGA 2M5CA 1XM8A 5K4NA 4TYFA 3DHBA 4D1UA 3FAIA 2OHIA 4UA4A 5AXRA 2XF4A 4C1FA 1K07A 2P18A 4NQ4A 5AHRA 5K4KA 5HH6A 4HL2A 5EV8A 1QH5A 1WW1A 4UAMA 3T3NA 3AF6A 3WXCA 3ZNBA 4TZFA 4D02A 2QINA 4UWRB 4ZNBA 3R2UA 4GYQA 4YSBA 4EFZA 5LCAA 3BK1A 5ACRA 5KILA 4P62A 2BG7A 3KL7A 4AX1B 4KEPA 1VJNA 4DIKA 3TP9A 2YZ3A 3SBLA 3S0ZA 4YSKA 1DXKA 4EY2A 4EXSA 2FU9A 1DD6A 5LCFA 5LM6A 3I13A 4TYTA 5LMCA 4U4LA 3AJ3A 2QDTA 3KNRA 2ZZIA 3KNSA 3PY6A 2BG6A 1A8TA 3I14A 2YNUA 4Z60A 2P4ZA 3DHAA 2WHGA 2P1EA 2AIOA 4D1TA 4AWYB 5KIKA 4RM5A 2BFZB 2YNTA 2YNWA 4XWWA 5ACTA 3SD9A 2GKLA 1YCFA 3ESHA 4HKYA 4WD6A 4ZO2A 2NYPA 4F6ZA 1YCHA 4AWZA 1BVTA 4RBSA 4RL0A 4YSLA 5EVBA 3SRXA 3I11A 4BP0A 1X8HA 2BGAA 2Y8BA 2NZFA 3ZQ4A 2Y87A 1ZTCA 3L6NA 5HH5A 4J5FA 2NZEA 3X2ZA 1M2XA 1KO3A 5EH9A 2ZWRA 4XUKA 2BFZA 4B87A 4KEQA 3IEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y8A A;  1WRA A;  2I7T A;  3T9M A;  2YNV B;  3IE1 A;  5LS3 A;  2Q9U A;  2M5D A;  1ZNB A;  4Z5Z A;  5ACU A;  4TZ9 A;  1JJT A;  2R2D A;  1A7T A;  5K4M A;  1VME A;  1Y44 A;  5FQC A;  4FSB A;  4JO0 A;  5A0V A;  5ACP A;  3BK2 A;  3LVZ A;  2BTN A;  5EHT A;  2BFL A;  4EXY A;  3FCZ A;  3X2Y A;  4FR7 A;  3F9O A;  4C1H A;  2FK6 A;  2BC2 A;  2FU7 A;  3ZR9 A;  2GFJ A;  2QJS A;  5B3R A;  2GCU A;  3ZWF A;  2OHJ A;  3Q6V A;  4ZO3 A;  2YCB A;  2YNV A;  4XWT A;  4J5H A;  1QH3 A;  3BC2 A;  2WYM A;  4GCW A;  3SW3 A;  5HIS A;  5LCH A;  3I15 A;  3IE0 A;  1WUP A;  4Z67 A;  1JJE A;  1VGN A;  1HLK A;  1JT1 A;  3IE2 A;  2BR6 A;  4C1G A;  4EYL A;  2FM6 A;  2E7Y A;  4CHL A;  3G1P A;  4C09 A;  5FQA A;  2FHX B;  4AD9 A;  4Z5Y A;  2WRS A;  5HH4 A;  4D1V A;  3MD7 A;  3BV6 A;  3H3E A;  2CBN A;  3IOF A;  1MQO A;  1ZKP A;  4RL2 A;  2QDS A;  5AXO A;  2OHH A;  5ACX A;  3X30 A;  2FU8 A;  4Z7R A;  4LE6 A;  5K0W A;  2WYL A;  5EVK A;  1P9E A;  5LLD A;  5LE1 A;  2BFK A;  5A87 A;  4H0D A;  1BC2 A;  5AEB A;  3IEM A;  5A0T A;  1X8G A;  5AYA A;  5HIQ A;  1YCG A;  4UWP B;  2BG2 A;  4AX0 B;  5B1U A;  3QH8 A;  4UWO B;  4DIL A;  3DH8 A;  4PVO A;  5ACS A;  4O98 A;  4EYF A;  1KO2 A;  4NQ2 A;  5HIP A;  2NXA A;  4RAW A;  5EW0 A;  4HL1 A;  4FEK A;  2Q0I A;  5ACW A;  3VQZ A;  2AZ4 A;  2BMI A;  2HB9 A;  5ACV A;  1SML A;  2I7X A;  1WUO A;  3RKK A;  2XR1 A;  4TZB A;  2I7V A;  3IEL A;  2QED A;  5A5Z A;  2GFK A;  1DDK A;  4GYU A;  2DKF A;  5ACQ A;  1L9Y A;  2ZO4 A;  4C1D A;  3VPE A;  2GMN A;  2H6A A;  4UWS B;  3ADR A;  2A7M A;  2YNT B;  5DPX A;  3PG4 A;  3SFP A;  4ZEJ A;  3SPU A;  3PY5 A;  4C1C A;  2FU6 A;  2WYM C;  1KR3 A;  4BZ3 A;  3RKJ A;  2BG8 B;  4RAM A;  3DHC A;  5EVD A;  2BIB A;  4V0H A;  2Q0J A;  4PVT A;  2Q42 A;  5EWA A;  4C1E A;  1X8I A;  5IQK A;  5LSC A;  5FQB A;  2UYX A;  4NQ6 A;  4F6H A;  3X2X A;  3P2U A;  3A4Y A;  3AF5 A;  1XTO A;  2VW8 A;  5B15 A;  4UBQ A;  4TZE A;  5EV6 A;  3RPC A;  5HIO A;  2ZNB A;  2P97 A;  2BG8 A;  4NQ5 A;  3I0V A;  1E5D A;  1BMC A;  3JXP A;  5AHO A;  3T3O A;  2FHX A;  4Z6X A;  2DOO A;  3IDZ A;  4D1W A;  4EYB A;  3IOG A;  2M5C A;  1XM8 A;  5K4N A;  4TYF A;  3DHB A;  4D1U A;  3FAI A;  2OHI A;  4UA4 A;  5AXR A;  2XF4 A;  4C1F A;  1K07 A;  2P18 A;  4NQ4 A;  5AHR A;  5K4K A;  5HH6 A;  4HL2 A;  5EV8 A;  1QH5 A;  1WW1 A;  4UAM A;  3T3N A;  3AF6 A;  3WXC A;  3ZNB A;  4TZF A;  4D02 A;  2QIN A;  4UWR B;  4ZNB A;  3R2U A;  4GYQ A;  4YSB A;  4EFZ A;  5LCA A;  3BK1 A;  5ACR A;  5KIL A;  4P62 A;  2BG7 A;  3KL7 A;  4AX1 B;  4KEP A;  1VJN A;  4DIK A;  3TP9 A;  2YZ3 A;  3SBL A;  3S0Z A;  4YSK A;  1DXK A;  4EY2 A;  4EXS A;  2FU9 A;  1DD6 A;  5LCF A;  5LM6 A;  3I13 A;  4TYT A;  5LMC A;  4U4L A;  3AJ3 A;  2QDT A;  3KNR A;  2ZZI A;  3KNS A;  3PY6 A;  2BG6 A;  1A8T A;  3I14 A;  2YNU A;  4Z60 A;  2P4Z A;  3DHA A;  2WHG A;  2P1E A;  2AIO A;  4D1T A;  4AWY B;  5KIK A;  4RM5 A;  2BFZ B;  2YNT A;  2YNW A;  4XWW A;  5ACT A;  3SD9 A;  2GKL A;  1YCF A;  3ESH A;  4HKY A;  4WD6 A;  4ZO2 A;  2NYP A;  4F6Z A;  1YCH A;  4AWZ A;  1BVT A;  4RBS A;  4RL0 A;  4YSL A;  5EVB A;  3SRX A;  3I11 A;  4BP0 A;  1X8H A;  2BGA A;  2Y8B A;  2NZF A;  3ZQ4 A;  2Y87 A;  1ZTC A;  3L6N A;  5HH5 A;  4J5F A;  2NZE A;  3X2Z A;  1M2X A;  1KO3 A;  5EH9 A;  2ZWR A;  4XUK A;  2BFZ A;  4B87 A;  4KEQ A;  3IEK A; 
#chains in the Genus database with same CATH topology
 2Y8A A;  1WRA A;  2I7T A;  3T9M A;  2YNV B;  3IE1 A;  5LS3 A;  2Q9U A;  2M5D A;  1ZNB A;  4Z5Z A;  5ACU A;  4TZ9 A;  1JJT A;  2R2D A;  1A7T A;  5K4M A;  1VME A;  1Y44 A;  5FQC A;  4FSB A;  4JO0 A;  5A0V A;  5ACP A;  3BK2 A;  3LVZ A;  2BTN A;  5EHT A;  2BFL A;  4EXY A;  3FCZ A;  3X2Y A;  4FR7 A;  3F9O A;  4C1H A;  2FK6 A;  2BC2 A;  2FU7 A;  3ZR9 A;  2GFJ A;  2QJS A;  5B3R A;  2GCU A;  3ZWF A;  2OHJ A;  3Q6V A;  4ZO3 A;  2YCB A;  2YNV A;  4XWT A;  4J5H A;  1QH3 A;  3BC2 A;  2WYM A;  4GCW A;  3SW3 A;  2CG3 A;  5HIS A;  5LCH A;  3I15 A;  3IE0 A;  1WUP A;  4Z67 A;  1JJE A;  1VGN A;  1HLK A;  1JT1 A;  3IE2 A;  2BR6 A;  4C1G A;  4EYL A;  2FM6 A;  2E7Y A;  4CHL A;  3G1P A;  4C09 A;  5FQA A;  2FHX B;  4AD9 A;  4Z5Y A;  2WRS A;  5HH4 A;  4D1V A;  3MD7 A;  3BV6 A;  3H3E A;  2CBN A;  3IOF A;  1MQO A;  1ZKP A;  4RL2 A;  2QDS A;  5AXO A;  2OHH A;  5ACX A;  3X30 A;  2FU8 A;  4Z7R A;  4LE6 A;  5K0W A;  2WYL A;  5EVK A;  1P9E A;  5AJL A;  5LLD A;  5LE1 A;  2BFK A;  5A87 A;  4H0D A;  1BC2 A;  5AEB A;  3IEM A;  5A0T A;  1X8G A;  5AYA A;  5HIQ A;  1YCG A;  4UWP B;  2BG2 A;  4AX0 B;  5B1U A;  3QH8 A;  4UWO B;  4DIL A;  4AV7 A;  3DH8 A;  4PVO A;  5ACS A;  4O98 A;  4EYF A;  1KO2 A;  4NQ2 A;  5HIP A;  2NXA A;  4RAW A;  5EW0 A;  4HL1 A;  4FEK A;  2Q0I A;  5ACW A;  3VQZ A;  2AZ4 A;  2BMI A;  2HB9 A;  5ACV A;  1SML A;  2I7X A;  1WUO A;  3RKK A;  2XR1 A;  4TZB A;  2I7V A;  3IEL A;  2QED A;  5A5Z A;  2GFK A;  1DDK A;  4GYU A;  2DKF A;  5ACQ A;  1L9Y A;  2ZO4 A;  4C1D A;  3VPE A;  2GMN A;  2H6A A;  4UWS B;  3ADR A;  2A7M A;  2YNT B;  5DPX A;  3PG4 A;  3SFP A;  4ZEJ A;  3SPU A;  3PY5 A;  4C1C A;  2FU6 A;  2WYM C;  1KR3 A;  4BZ3 A;  3RKJ A;  2BG8 B;  4RAM A;  3DHC A;  5EVD A;  2BIB A;  4V0H A;  2Q0J A;  4PVT A;  2Q42 A;  5EWA A;  4C1E A;  1X8I A;  5AIJ A;  5IQK A;  5LSC A;  5FQB A;  2UYX A;  4NQ6 A;  4F6H A;  3X2X A;  3P2U A;  3A4Y A;  3AF5 A;  4NUR A;  1XTO A;  2VW8 A;  5B15 A;  4UBQ A;  4TZE A;  5EV6 A;  3RPC A;  5HIO A;  2ZNB A;  2P97 A;  2BG8 A;  4NQ5 A;  3I0V A;  1E5D A;  1BMC A;  3JXP A;  5AHO A;  3T3O A;  2CG2 A;  2FHX A;  4Z6X A;  2DOO A;  3IDZ A;  4D1W A;  4EYB A;  3IOG A;  2M5C A;  2YHE A;  1XM8 A;  5K4N A;  4TYF A;  3DHB A;  4D1U A;  3FAI A;  2OHI A;  4UA4 A;  5AXR A;  2XF4 A;  4C1F A;  1K07 A;  2P18 A;  4NQ4 A;  5AHR A;  5K4K A;  5HH6 A;  4HL2 A;  5EV8 A;  1QH5 A;  1WW1 A;  4UAM A;  3T3N A;  3AF6 A;  3WXC A;  3ZNB A;  4TZF A;  4D02 A;  2CFU A;  2QIN A;  4UWR B;  4ZNB A;  3R2U A;  4GYQ A;  4YSB A;  4EFZ A;  5LCA A;  3BK1 A;  5ACR A;  5KIL A;  4P62 A;  2BG7 A;  3KL7 A;  4AX1 B;  4KEP A;  1VJN A;  4DIK A;  3TP9 A;  2YZ3 A;  3SBL A;  3S0Z A;  4YSK A;  1DXK A;  4EY2 A;  4EXS A;  2FU9 A;  1DD6 A;  5LCF A;  2CFZ A;  5LM6 A;  3I13 A;  4TYT A;  5LMC A;  4AXH A;  4U4L A;  3AJ3 A;  2QDT A;  5A23 A;  3KNR A;  2ZZI A;  3KNS A;  3PY6 A;  2BG6 A;  1A8T A;  3I14 A;  2YNU A;  4Z60 A;  2P4Z A;  3DHA A;  2WHG A;  2P1E A;  2AIO A;  4D1T A;  4AWY B;  5KIK A;  4RM5 A;  2BFZ B;  2YNT A;  2YNW A;  4XWW A;  5ACT A;  3SD9 A;  2GKL A;  1YCF A;  3ESH A;  4HKY A;  4WD6 A;  4ZO2 A;  2NYP A;  4F6Z A;  1YCH A;  4AWZ A;  4PDX A;  1BVT A;  4RBS A;  4RL0 A;  4YSL A;  5EVB A;  3SRX A;  3I11 A;  4BP0 A;  1X8H A;  2BGA A;  2Y8B A;  2NZF A;  3ZQ4 A;  2Y87 A;  1ZTC A;  3L6N A;  5HH5 A;  4J5F A;  2NZE A;  3X2Z A;  1M2X A;  1KO3 A;  5EH9 A;  2ZWR A;  4XUK A;  2BFZ A;  4B87 A;  4KEQ A;  3IEK A; 
#chains in the Genus database with same CATH homology
 2Y8A A;  1WRA A;  2I7T A;  3T9M A;  2YNV B;  3IE1 A;  5LS3 A;  2Q9U A;  2M5D A;  1ZNB A;  4Z5Z A;  5ACU A;  4TZ9 A;  1JJT A;  2R2D A;  1A7T A;  5K4M A;  1VME A;  1Y44 A;  5FQC A;  4FSB A;  4JO0 A;  5A0V A;  5ACP A;  3BK2 A;  3LVZ A;  2BTN A;  5EHT A;  2BFL A;  4EXY A;  3FCZ A;  3X2Y A;  4FR7 A;  3F9O A;  4C1H A;  2FK6 A;  2BC2 A;  2FU7 A;  3ZR9 A;  2GFJ A;  2QJS A;  5B3R A;  2GCU A;  3ZWF A;  2OHJ A;  3Q6V A;  4ZO3 A;  2YCB A;  2YNV A;  4XWT A;  4J5H A;  1QH3 A;  3BC2 A;  2WYM A;  4GCW A;  3SW3 A;  5HIS A;  5LCH A;  3I15 A;  3IE0 A;  1WUP A;  4Z67 A;  1JJE A;  1VGN A;  1HLK A;  1JT1 A;  3IE2 A;  2BR6 A;  4C1G A;  4EYL A;  2FM6 A;  2E7Y A;  4CHL A;  3G1P A;  4C09 A;  5FQA A;  2FHX B;  4AD9 A;  4Z5Y A;  2WRS A;  5HH4 A;  4D1V A;  3MD7 A;  3BV6 A;  3H3E A;  2CBN A;  3IOF A;  1MQO A;  1ZKP A;  4RL2 A;  2QDS A;  5AXO A;  2OHH A;  5ACX A;  3X30 A;  2FU8 A;  4Z7R A;  4LE6 A;  5K0W A;  2WYL A;  5EVK A;  1P9E A;  5LLD A;  5LE1 A;  2BFK A;  5A87 A;  4H0D A;  1BC2 A;  5AEB A;  3IEM A;  5A0T A;  1X8G A;  5AYA A;  5HIQ A;  1YCG A;  4UWP B;  2BG2 A;  4AX0 B;  5B1U A;  3QH8 A;  4UWO B;  4DIL A;  3DH8 A;  4PVO A;  5ACS A;  4O98 A;  4EYF A;  1KO2 A;  4NQ2 A;  5HIP A;  2NXA A;  4RAW A;  5EW0 A;  4HL1 A;  4FEK A;  2Q0I A;  5ACW A;  3VQZ A;  2AZ4 A;  2BMI A;  2HB9 A;  5ACV A;  1SML A;  2I7X A;  1WUO A;  3RKK A;  2XR1 A;  4TZB A;  2I7V A;  3IEL A;  2QED A;  5A5Z A;  2GFK A;  1DDK A;  4GYU A;  2DKF A;  5ACQ A;  1L9Y A;  2ZO4 A;  4C1D A;  3VPE A;  2GMN A;  2H6A A;  4UWS B;  3ADR A;  2A7M A;  2YNT B;  5DPX A;  3PG4 A;  3SFP A;  4ZEJ A;  3SPU A;  3PY5 A;  4C1C A;  2FU6 A;  2WYM C;  1KR3 A;  4BZ3 A;  3RKJ A;  2BG8 B;  4RAM A;  3DHC A;  5EVD A;  2BIB A;  4V0H A;  2Q0J A;  4PVT A;  2Q42 A;  5EWA A;  4C1E A;  1X8I A;  5IQK A;  5LSC A;  5FQB A;  2UYX A;  4NQ6 A;  4F6H A;  3X2X A;  3P2U A;  3A4Y A;  3AF5 A;  1XTO A;  2VW8 A;  5B15 A;  4UBQ A;  4TZE A;  5EV6 A;  3RPC A;  5HIO A;  2ZNB A;  2P97 A;  2BG8 A;  4NQ5 A;  3I0V A;  1E5D A;  1BMC A;  3JXP A;  5AHO A;  3T3O A;  2FHX A;  4Z6X A;  2DOO A;  3IDZ A;  4D1W A;  4EYB A;  3IOG A;  2M5C A;  1XM8 A;  5K4N A;  4TYF A;  3DHB A;  4D1U A;  3FAI A;  2OHI A;  4UA4 A;  5AXR A;  2XF4 A;  4C1F A;  1K07 A;  2P18 A;  4NQ4 A;  5AHR A;  5K4K A;  5HH6 A;  4HL2 A;  5EV8 A;  1QH5 A;  1WW1 A;  4UAM A;  3T3N A;  3AF6 A;  3WXC A;  3ZNB A;  4TZF A;  4D02 A;  2QIN A;  4UWR B;  4ZNB A;  3R2U A;  4GYQ A;  4YSB A;  4EFZ A;  5LCA A;  3BK1 A;  5ACR A;  5KIL A;  4P62 A;  2BG7 A;  3KL7 A;  4AX1 B;  4KEP A;  1VJN A;  4DIK A;  3TP9 A;  2YZ3 A;  3SBL A;  3S0Z A;  4YSK A;  1DXK A;  4EY2 A;  4EXS A;  2FU9 A;  1DD6 A;  5LCF A;  5LM6 A;  3I13 A;  4TYT A;  5LMC A;  4U4L A;  3AJ3 A;  2QDT A;  3KNR A;  2ZZI A;  3KNS A;  3PY6 A;  2BG6 A;  1A8T A;  3I14 A;  2YNU A;  4Z60 A;  2P4Z A;  3DHA A;  2WHG A;  2P1E A;  2AIO A;  4D1T A;  4AWY B;  5KIK A;  4RM5 A;  2BFZ B;  2YNT A;  2YNW A;  4XWW A;  5ACT A;  3SD9 A;  2GKL A;  1YCF A;  3ESH A;  4HKY A;  4WD6 A;  4ZO2 A;  2NYP A;  4F6Z A;  1YCH A;  4AWZ A;  1BVT A;  4RBS A;  4RL0 A;  4YSL A;  5EVB A;  3SRX A;  3I11 A;  4BP0 A;  1X8H A;  2BGA A;  2Y8B A;  2NZF A;  3ZQ4 A;  2Y87 A;  1ZTC A;  3L6N A;  5HH5 A;  4J5F A;  2NZE A;  3X2Z A;  1M2X A;  1KO3 A;  5EH9 A;  2ZWR A;  4XUK A;  2BFZ A;  4B87 A;  4KEQ A;  3IEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...