1VJNA

Crystal structure of a putative zn-dependent hydrolase of the metallo-beta-lactamase superfamily (tm0207) from thermotoga maritima at 2.00 a resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
209
structure length
194
Chain Sequence
b'HMKITWFGHACFALEMEGKTIVTDPFDPIPNVTADVVTESHQHNAHHLVKGNFRVIDRPGAYTVNGVKIKGVETFHDGKNIVFVFEGEGIKVCHLGDLGHVLTPAQVEEIGEIDVLLVPVGGTYTIGPKEAKEVADLLNAKVIIPMHYKTKYLKFNLLPVDDFLKLFDSYERVGNILELFEKPKERKVVVMEVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Zn-dependent hydrolase of metallo-beta-lactamase superfamily
molecule tags Hydrolase
source organism Thermotoga maritima
publication title Crystal structure of Zn-dependent hydrolase of metallo-beta-lactamase superfamily (TM0207) from Thermotoga maritima at 2.00 A resolution
rcsb
total genus 43
structure length 194
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13483 Lactamase_B_3 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1vjnA00
4AD9A 3QH8A 4NQ6A 1DXKA 2BG6A 2BIBA 5LMCA 2AZ4A 4V0HA 2GFJA 5EWAA 2YNTB 3LVZA 2Y8BA 5FQBA 4EXYA 1JT1A 2DOOA 2WHGA 3KNRA 4C09A 4DIKA 2I7XA 4NQ4A 4D1UA 4O98A 2BR6A 1E5DA 2YNVA 4J5FA 3A4YA 3PG4A 4EYFA 4UA4A 4WD6A 5K4KA 5LLDA 2BTNA 4UWPB 4Z5ZA 2YNWA 3BK2A 5KIKA 5K4NA 2Y87A 4RBSA 5HH5A 3AJ3A 2BFZA 3AF6A 3SRXA 4P62A 3T3OA 4YSKA 2BFKA 1ZNBA 3ZQ4A 2BG7A 1KO3A 3WXCA 4D1WA 5ACWA 5EVKA 4XWWA 4Z6XA 1JJEA 4DILA 2BFLA 2FK6A 4PVTA 3X2YA 4C1FA 2HB9A 4TZEA 3FAIA 2YNUA 2GCUA 5EVBA 4AWZA 3F9OA 2P18A 2AIOA 1VGNA 2FU8A 2NZFA 4LE6A 3IE1A 5KILA 4RM5A 4RAMA 4C1GA 5LCFA 2WYLA 1XM8A 2ZNBA 1WRAA 3S0ZA 4PVOA 5ACPA 5AHOA 1XTOA 3X30A 1Y44A 4EYBA 2OHHA 5EHTA 4D1TA 1WW1A 1HLKA 2FU6A 3X2ZA 2I7TA 4UWSB 2Q42A 4RL2A 2OHIA 5AEBA 2GFKA 5AHRA 2BG8B 2P1EA 5K4MA 2FM6A 4Z67A 5ACRA 2ZZIA 2GMNA 4KEPA 4HL1A 5EV6A 3ADRA 2QDSA 5ACXA 1X8IA 4Z7RA 5A0VA 3JXPA 2P4ZA 5LS3A 3SPUA 5HIQA 2BMIA 5HISA 2NXAA 3ZWFA 4J5HA 5HH6A 2P97A 3ESHA 2YNTA 4RL0A 3R2UA 2YCBA 1JJTA 4C1HA 2BG8A 3SD9A 1M2XA 5HH4A 3RKKA 3IELA 3T3NA 5B1UA 2FHXA 4JO0A 2UYXA 1QH5A 2M5CA 2FHXB 4FR7A 4C1CA 2OHJA 5ACVA 5EH9A 3I13A 2A7MA 1K07A 2CBNA 5IQKA 1A8TA 5LM6A 3DHCA 3VPEA 2ZWRA 3BK1A 5LCAA 2VW8A 5K0WA 5AXOA 1ZTCA 3I14A 2E7YA 4C1EA 1WUOA 3H3EA 3I0VA 4B87A 1YCFA 3DHAA 2FU9A 1WUPA 5EV8A 1BVTA 5A0TA 4AWYB 4UBQA 3IE2A 4FEKA 3KNSA 3SFPA 5B15A 3IEKA 5EVDA 4EY2A 1VMEA 2XF4A 5A5ZA 4UWRB 5HIOA 4D02A 1DD6A 5ACSA 2WRSA 4NQ5A 3AF5A 4EFZA 1X8GA 2DKFA 3KL7A 4BP0A 4U4LA 4EXSA 4AX1B 3L6NA 5A87A 3VQZA 3DH8A 3ZR9A 1L9YA 2ZO4A 2YZ3A 2Q0IA 2QEDA 4UWOB 2NZEA 1SMLA 3I11A 3RKJA 1A7TA 4CHLA 2I7VA 4GYQA 2WYMA 2Q9UA 1BMCA 5FQAA 3IE0A 1QH3A 5FQCA 4XWTA 2FU7A 4HL2A 1X8HA 4YSBA 1MQOA 2XR1A 3G1PA 4UAMA 2BC2A 2Y8AA 3BV6A 3IOGA 1ZKPA 3TP9A 3IDZA 1KO2A 1VJNA 4XUKA 3PY5A 3IEMA 4BZ3A 2YNVB 5EW0A 4TYFA 3SW3A 4D1VA 2QINA 3FCZA 4YSLA 2BFZB 4NQ2A 2H6AA 4TZFA 4GCWA 1YCGA 4C1DA 5ACQA 1BC2A 2Q0JA 3Q6VA 2NYPA 5HIPA 3SBLA 4EYLA 5LSCA 1KR3A 2R2DA 1P9EA 4Z60A 3P2UA 4RAWA 4AX0B 3PY6A 2QJSA 5ACTA 4TZBA 4FSBA 3MD7A 3I15A 4ZNBA 4GYUA 4Z5YA 4ZEJA 5B3RA 4F6ZA 5LCHA 3IOFA 1YCHA 3T9MA 4HKYA 3X2XA 4F6HA 4TZ9A 2BGAA 2WYMC 4ZO3A 5LE1A 1DDKA 5AXRA 2GKLA 2QDTA 3ZNBA 4KEQA 4H0DA 5AYAA 5DPXA 5ACUA 3DHBA 2M5DA 4TYTA 3RPCA 2BG2A 4ZO2A 3BC2A
chains in the Genus database with same CATH superfamily
4AD9A 3QH8A 4NQ6A 1DXKA 2BG6A 2BIBA 5LMCA 2AZ4A 4V0HA 2GFJA 5EWAA 2YNTB 3LVZA 2CG2A 2Y8BA 5FQBA 4EXYA 1JT1A 2DOOA 2WHGA 3KNRA 4C09A 4DIKA 2I7XA 4NQ4A 4D1UA 4O98A 2BR6A 1E5DA 2YNVA 4J5FA 3A4YA 2CFZA 3PG4A 4EYFA 4UA4A 4WD6A 5K4KA 5LLDA 2BTNA 4UWPB 4Z5ZA 2YNWA 3BK2A 2CFUA 5KIKA 5K4NA 2Y87A 4RBSA 5HH5A 3AJ3A 2BFZA 3AF6A 3SRXA 4P62A 3T3OA 4YSKA 2BFKA 1ZNBA 3ZQ4A 2BG7A 1KO3A 3WXCA 4D1WA 5ACWA 5EVKA 4XWWA 4Z6XA 1JJEA 4DILA 2BFLA 2FK6A 4PVTA 3X2YA 4C1FA 2HB9A 4TZEA 3FAIA 2YNUA 2GCUA 5EVBA 4AWZA 3F9OA 2P18A 2AIOA 1VGNA 2FU8A 2NZFA 4LE6A 5AIJA 3IE1A 5KILA 4RM5A 4RAMA 4C1GA 5LCFA 2WYLA 1XM8A 2ZNBA 1WRAA 3S0ZA 4PVOA 5ACPA 5AHOA 1XTOA 3X30A 1Y44A 4EYBA 2OHHA 5EHTA 4D1TA 1WW1A 1HLKA 2FU6A 3X2ZA 2I7TA 4UWSB 2YHEA 2Q42A 4RL2A 2OHIA 5AEBA 2GFKA 5AHRA 2BG8B 2P1EA 5K4MA 2FM6A 4Z67A 5ACRA 2ZZIA 2GMNA 4KEPA 4HL1A 5EV6A 3ADRA 2QDSA 5ACXA 1X8IA 4Z7RA 5A0VA 3JXPA 2P4ZA 5LS3A 3SPUA 5HIQA 2BMIA 5HISA 2NXAA 4NURA 3ZWFA 4J5HA 5HH6A 2P97A 3ESHA 2YNTA 4RL0A 3R2UA 2YCBA 1JJTA 4C1HA 2BG8A 3SD9A 1M2XA 5HH4A 3RKKA 3IELA 3T3NA 5B1UA 2FHXA 4JO0A 2UYXA 1QH5A 2M5CA 2FHXB 4FR7A 4C1CA 2OHJA 5ACVA 5EH9A 3I13A 2A7MA 4AV7A 1K07A 2CBNA 5IQKA 1A8TA 5LM6A 3DHCA 3VPEA 2ZWRA 3BK1A 5LCAA 2VW8A 5K0WA 5AXOA 1ZTCA 3I14A 2E7YA 4C1EA 1WUOA 3H3EA 3I0VA 4B87A 1YCFA 3DHAA 2FU9A 1WUPA 5EV8A 1BVTA 5A0TA 4AWYB 4PDXA 4UBQA 3IE2A 4FEKA 4AXHA 3KNSA 3SFPA 5B15A 3IEKA 5EVDA 4EY2A 1VMEA 2XF4A 5A5ZA 4UWRB 5HIOA 4D02A 1DD6A 5AJLA 5ACSA 2WRSA 4NQ5A 3AF5A 4EFZA 1X8GA 2DKFA 3KL7A 4BP0A 4U4LA 4EXSA 4AX1B 3L6NA 5A87A 3VQZA 3DH8A 3ZR9A 1L9YA 2ZO4A 2YZ3A 2Q0IA 2QEDA 4UWOB 2NZEA 1SMLA 3I11A 3RKJA 1A7TA 4CHLA 2I7VA 4GYQA 2WYMA 2Q9UA 1BMCA 5FQAA 3IE0A 1QH3A 5FQCA 4XWTA 2FU7A 4HL2A 1X8HA 4YSBA 1MQOA 2XR1A 3G1PA 4UAMA 2BC2A 2Y8AA 3BV6A 3IOGA 1ZKPA 3TP9A 3IDZA 1KO2A 1VJNA 4XUKA 3PY5A 3IEMA 5A23A 4BZ3A 2YNVB 5EW0A 4TYFA 3SW3A 4D1VA 2QINA 3FCZA 4YSLA 2BFZB 4NQ2A 2H6AA 4TZFA 4GCWA 1YCGA 4C1DA 5ACQA 1BC2A 2Q0JA 3Q6VA 2NYPA 5HIPA 3SBLA 4EYLA 5LSCA 1KR3A 2R2DA 1P9EA 4Z60A 3P2UA 4RAWA 4AX0B 3PY6A 2QJSA 5ACTA 4TZBA 4FSBA 3MD7A 3I15A 4ZNBA 4GYUA 4Z5YA 4ZEJA 5B3RA 4F6ZA 5LCHA 3IOFA 1YCHA 3T9MA 4HKYA 3X2XA 4F6HA 2CG3A 4TZ9A 2BGAA 2WYMC 4ZO3A 5LE1A 1DDKA 5AXRA 2GKLA 2QDTA 3ZNBA 4KEQA 4H0DA 5AYAA 5DPXA 5ACUA 3DHBA 2M5DA 4TYTA 3RPCA 2BG2A 4ZO2A 3BC2A
chains in the Genus database with same CATH topology
4AD9A 3QH8A 4NQ6A 1DXKA 2BG6A 2BIBA 5LMCA 2AZ4A 4V0HA 2GFJA 5EWAA 2YNTB 3LVZA 2Y8BA 5FQBA 4EXYA 1JT1A 2DOOA 2WHGA 3KNRA 4C09A 4DIKA 2I7XA 4NQ4A 4D1UA 4O98A 2BR6A 1E5DA 2YNVA 4J5FA 3A4YA 3PG4A 4EYFA 4UA4A 4WD6A 5K4KA 5LLDA 2BTNA 4UWPB 4Z5ZA 2YNWA 3BK2A 5KIKA 5K4NA 2Y87A 4RBSA 5HH5A 3AJ3A 2BFZA 3AF6A 3SRXA 4P62A 3T3OA 4YSKA 2BFKA 1ZNBA 3ZQ4A 2BG7A 1KO3A 3WXCA 4D1WA 5ACWA 5EVKA 4XWWA 4Z6XA 1JJEA 4DILA 2BFLA 2FK6A 4PVTA 3X2YA 4C1FA 2HB9A 4TZEA 3FAIA 2YNUA 2GCUA 5EVBA 4AWZA 3F9OA 2P18A 2AIOA 1VGNA 2FU8A 2NZFA 4LE6A 3IE1A 5KILA 4RM5A 4RAMA 4C1GA 5LCFA 2WYLA 1XM8A 2ZNBA 1WRAA 3S0ZA 4PVOA 5ACPA 5AHOA 1XTOA 3X30A 1Y44A 4EYBA 2OHHA 5EHTA 4D1TA 1WW1A 1HLKA 2FU6A 3X2ZA 2I7TA 4UWSB 2Q42A 4RL2A 2OHIA 5AEBA 2GFKA 5AHRA 2BG8B 2P1EA 5K4MA 2FM6A 4Z67A 5ACRA 2ZZIA 2GMNA 4KEPA 4HL1A 5EV6A 3ADRA 2QDSA 5ACXA 1X8IA 4Z7RA 5A0VA 3JXPA 2P4ZA 5LS3A 3SPUA 5HIQA 2BMIA 5HISA 2NXAA 3ZWFA 4J5HA 5HH6A 2P97A 3ESHA 2YNTA 4RL0A 3R2UA 2YCBA 1JJTA 4C1HA 2BG8A 3SD9A 1M2XA 5HH4A 3RKKA 3IELA 3T3NA 5B1UA 2FHXA 4JO0A 2UYXA 1QH5A 2M5CA 2FHXB 4FR7A 4C1CA 2OHJA 5ACVA 5EH9A 3I13A 2A7MA 1K07A 2CBNA 5IQKA 1A8TA 5LM6A 3DHCA 3VPEA 2ZWRA 3BK1A 5LCAA 2VW8A 5K0WA 5AXOA 1ZTCA 3I14A 2E7YA 4C1EA 1WUOA 3H3EA 3I0VA 4B87A 1YCFA 3DHAA 2FU9A 1WUPA 5EV8A 1BVTA 5A0TA 4AWYB 4UBQA 3IE2A 4FEKA 3KNSA 3SFPA 5B15A 3IEKA 5EVDA 4EY2A 1VMEA 2XF4A 5A5ZA 4UWRB 5HIOA 4D02A 1DD6A 5ACSA 2WRSA 4NQ5A 3AF5A 4EFZA 1X8GA 2DKFA 3KL7A 4BP0A 4U4LA 4EXSA 4AX1B 3L6NA 5A87A 3VQZA 3DH8A 3ZR9A 1L9YA 2ZO4A 2YZ3A 2Q0IA 2QEDA 4UWOB 2NZEA 1SMLA 3I11A 3RKJA 1A7TA 4CHLA 2I7VA 4GYQA 2WYMA 2Q9UA 1BMCA 5FQAA 3IE0A 1QH3A 5FQCA 4XWTA 2FU7A 4HL2A 1X8HA 4YSBA 1MQOA 2XR1A 3G1PA 4UAMA 2BC2A 2Y8AA 3BV6A 3IOGA 1ZKPA 3TP9A 3IDZA 1KO2A 1VJNA 4XUKA 3PY5A 3IEMA 4BZ3A 2YNVB 5EW0A 4TYFA 3SW3A 4D1VA 2QINA 3FCZA 4YSLA 2BFZB 4NQ2A 2H6AA 4TZFA 4GCWA 1YCGA 4C1DA 5ACQA 1BC2A 2Q0JA 3Q6VA 2NYPA 5HIPA 3SBLA 4EYLA 5LSCA 1KR3A 2R2DA 1P9EA 4Z60A 3P2UA 4RAWA 4AX0B 3PY6A 2QJSA 5ACTA 4TZBA 4FSBA 3MD7A 3I15A 4ZNBA 4GYUA 4Z5YA 4ZEJA 5B3RA 4F6ZA 5LCHA 3IOFA 1YCHA 3T9MA 4HKYA 3X2XA 4F6HA 4TZ9A 2BGAA 2WYMC 4ZO3A 5LE1A 1DDKA 5AXRA 2GKLA 2QDTA 3ZNBA 4KEQA 4H0DA 5AYAA 5DPXA 5ACUA 3DHBA 2M5DA 4TYTA 3RPCA 2BG2A 4ZO2A 3BC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AD9 A;  3QH8 A;  4NQ6 A;  1DXK A;  2BG6 A;  2BIB A;  5LMC A;  2AZ4 A;  4V0H A;  2GFJ A;  5EWA A;  2YNT B;  3LVZ A;  2Y8B A;  5FQB A;  4EXY A;  1JT1 A;  2DOO A;  2WHG A;  3KNR A;  4C09 A;  4DIK A;  2I7X A;  4NQ4 A;  4D1U A;  4O98 A;  2BR6 A;  1E5D A;  2YNV A;  4J5F A;  3A4Y A;  3PG4 A;  4EYF A;  4UA4 A;  4WD6 A;  5K4K A;  5LLD A;  2BTN A;  4UWP B;  4Z5Z A;  2YNW A;  3BK2 A;  5KIK A;  5K4N A;  2Y87 A;  4RBS A;  5HH5 A;  3AJ3 A;  2BFZ A;  3AF6 A;  3SRX A;  4P62 A;  3T3O A;  4YSK A;  2BFK A;  1ZNB A;  3ZQ4 A;  2BG7 A;  1KO3 A;  3WXC A;  4D1W A;  5ACW A;  5EVK A;  4XWW A;  4Z6X A;  1JJE A;  4DIL A;  2BFL A;  2FK6 A;  4PVT A;  3X2Y A;  4C1F A;  2HB9 A;  4TZE A;  3FAI A;  2YNU A;  2GCU A;  5EVB A;  4AWZ A;  3F9O A;  2P18 A;  2AIO A;  1VGN A;  2FU8 A;  2NZF A;  4LE6 A;  3IE1 A;  5KIL A;  4RM5 A;  4RAM A;  4C1G A;  5LCF A;  2WYL A;  1XM8 A;  2ZNB A;  1WRA A;  3S0Z A;  4PVO A;  5ACP A;  5AHO A;  1XTO A;  3X30 A;  1Y44 A;  4EYB A;  2OHH A;  5EHT A;  4D1T A;  1WW1 A;  1HLK A;  2FU6 A;  3X2Z A;  2I7T A;  4UWS B;  2Q42 A;  4RL2 A;  2OHI A;  5AEB A;  2GFK A;  5AHR A;  2BG8 B;  2P1E A;  5K4M A;  2FM6 A;  4Z67 A;  5ACR A;  2ZZI A;  2GMN A;  4KEP A;  4HL1 A;  5EV6 A;  3ADR A;  2QDS A;  5ACX A;  1X8I A;  4Z7R A;  5A0V A;  3JXP A;  2P4Z A;  5LS3 A;  3SPU A;  5HIQ A;  2BMI A;  5HIS A;  2NXA A;  3ZWF A;  4J5H A;  5HH6 A;  2P97 A;  3ESH A;  2YNT A;  4RL0 A;  3R2U A;  2YCB A;  1JJT A;  4C1H A;  2BG8 A;  3SD9 A;  1M2X A;  5HH4 A;  3RKK A;  3IEL A;  3T3N A;  5B1U A;  2FHX A;  4JO0 A;  2UYX A;  1QH5 A;  2M5C A;  2FHX B;  4FR7 A;  4C1C A;  2OHJ A;  5ACV A;  5EH9 A;  3I13 A;  2A7M A;  1K07 A;  2CBN A;  5IQK A;  1A8T A;  5LM6 A;  3DHC A;  3VPE A;  2ZWR A;  3BK1 A;  5LCA A;  2VW8 A;  5K0W A;  5AXO A;  1ZTC A;  3I14 A;  2E7Y A;  4C1E A;  1WUO A;  3H3E A;  3I0V A;  4B87 A;  1YCF A;  3DHA A;  2FU9 A;  1WUP A;  5EV8 A;  1BVT A;  5A0T A;  4AWY B;  4UBQ A;  3IE2 A;  4FEK A;  3KNS A;  3SFP A;  5B15 A;  3IEK A;  5EVD A;  4EY2 A;  1VME A;  2XF4 A;  5A5Z A;  4UWR B;  5HIO A;  4D02 A;  1DD6 A;  5ACS A;  2WRS A;  4NQ5 A;  3AF5 A;  4EFZ A;  1X8G A;  2DKF A;  3KL7 A;  4BP0 A;  4U4L A;  4EXS A;  4AX1 B;  3L6N A;  5A87 A;  3VQZ A;  3DH8 A;  3ZR9 A;  1L9Y A;  2ZO4 A;  2YZ3 A;  2Q0I A;  2QED A;  4UWO B;  2NZE A;  1SML A;  3I11 A;  3RKJ A;  1A7T A;  4CHL A;  2I7V A;  4GYQ A;  2WYM A;  2Q9U A;  1BMC A;  5FQA A;  3IE0 A;  1QH3 A;  5FQC A;  4XWT A;  2FU7 A;  4HL2 A;  1X8H A;  4YSB A;  1MQO A;  2XR1 A;  3G1P A;  4UAM A;  2BC2 A;  2Y8A A;  3BV6 A;  3IOG A;  1ZKP A;  3TP9 A;  3IDZ A;  1KO2 A;  1VJN A;  4XUK A;  3PY5 A;  3IEM A;  4BZ3 A;  2YNV B;  5EW0 A;  4TYF A;  3SW3 A;  4D1V A;  2QIN A;  3FCZ A;  4YSL A;  2BFZ B;  4NQ2 A;  2H6A A;  4TZF A;  4GCW A;  1YCG A;  4C1D A;  5ACQ A;  1BC2 A;  2Q0J A;  3Q6V A;  2NYP A;  5HIP A;  3SBL A;  4EYL A;  5LSC A;  1KR3 A;  2R2D A;  1P9E A;  4Z60 A;  3P2U A;  4RAW A;  4AX0 B;  3PY6 A;  2QJS A;  5ACT A;  4TZB A;  4FSB A;  3MD7 A;  3I15 A;  4ZNB A;  4GYU A;  4Z5Y A;  4ZEJ A;  5B3R A;  4F6Z A;  5LCH A;  3IOF A;  1YCH A;  3T9M A;  4HKY A;  3X2X A;  4F6H A;  4TZ9 A;  2BGA A;  2WYM C;  4ZO3 A;  5LE1 A;  1DDK A;  5AXR A;  2GKL A;  2QDT A;  3ZNB A;  4KEQ A;  4H0D A;  5AYA A;  5DPX A;  5ACU A;  3DHB A;  2M5D A;  4TYT A;  3RPC A;  2BG2 A;  4ZO2 A;  3BC2 A; 
#chains in the Genus database with same CATH topology
 4AD9 A;  3QH8 A;  4NQ6 A;  1DXK A;  2BG6 A;  2BIB A;  5LMC A;  2AZ4 A;  4V0H A;  2GFJ A;  5EWA A;  2YNT B;  3LVZ A;  2CG2 A;  2Y8B A;  5FQB A;  4EXY A;  1JT1 A;  2DOO A;  2WHG A;  3KNR A;  4C09 A;  4DIK A;  2I7X A;  4NQ4 A;  4D1U A;  4O98 A;  2BR6 A;  1E5D A;  2YNV A;  4J5F A;  3A4Y A;  2CFZ A;  3PG4 A;  4EYF A;  4UA4 A;  4WD6 A;  5K4K A;  5LLD A;  2BTN A;  4UWP B;  4Z5Z A;  2YNW A;  3BK2 A;  2CFU A;  5KIK A;  5K4N A;  2Y87 A;  4RBS A;  5HH5 A;  3AJ3 A;  2BFZ A;  3AF6 A;  3SRX A;  4P62 A;  3T3O A;  4YSK A;  2BFK A;  1ZNB A;  3ZQ4 A;  2BG7 A;  1KO3 A;  3WXC A;  4D1W A;  5ACW A;  5EVK A;  4XWW A;  4Z6X A;  1JJE A;  4DIL A;  2BFL A;  2FK6 A;  4PVT A;  3X2Y A;  4C1F A;  2HB9 A;  4TZE A;  3FAI A;  2YNU A;  2GCU A;  5EVB A;  4AWZ A;  3F9O A;  2P18 A;  2AIO A;  1VGN A;  2FU8 A;  2NZF A;  4LE6 A;  5AIJ A;  3IE1 A;  5KIL A;  4RM5 A;  4RAM A;  4C1G A;  5LCF A;  2WYL A;  1XM8 A;  2ZNB A;  1WRA A;  3S0Z A;  4PVO A;  5ACP A;  5AHO A;  1XTO A;  3X30 A;  1Y44 A;  4EYB A;  2OHH A;  5EHT A;  4D1T A;  1WW1 A;  1HLK A;  2FU6 A;  3X2Z A;  2I7T A;  4UWS B;  2YHE A;  2Q42 A;  4RL2 A;  2OHI A;  5AEB A;  2GFK A;  5AHR A;  2BG8 B;  2P1E A;  5K4M A;  2FM6 A;  4Z67 A;  5ACR A;  2ZZI A;  2GMN A;  4KEP A;  4HL1 A;  5EV6 A;  3ADR A;  2QDS A;  5ACX A;  1X8I A;  4Z7R A;  5A0V A;  3JXP A;  2P4Z A;  5LS3 A;  3SPU A;  5HIQ A;  2BMI A;  5HIS A;  2NXA A;  4NUR A;  3ZWF A;  4J5H A;  5HH6 A;  2P97 A;  3ESH A;  2YNT A;  4RL0 A;  3R2U A;  2YCB A;  1JJT A;  4C1H A;  2BG8 A;  3SD9 A;  1M2X A;  5HH4 A;  3RKK A;  3IEL A;  3T3N A;  5B1U A;  2FHX A;  4JO0 A;  2UYX A;  1QH5 A;  2M5C A;  2FHX B;  4FR7 A;  4C1C A;  2OHJ A;  5ACV A;  5EH9 A;  3I13 A;  2A7M A;  4AV7 A;  1K07 A;  2CBN A;  5IQK A;  1A8T A;  5LM6 A;  3DHC A;  3VPE A;  2ZWR A;  3BK1 A;  5LCA A;  2VW8 A;  5K0W A;  5AXO A;  1ZTC A;  3I14 A;  2E7Y A;  4C1E A;  1WUO A;  3H3E A;  3I0V A;  4B87 A;  1YCF A;  3DHA A;  2FU9 A;  1WUP A;  5EV8 A;  1BVT A;  5A0T A;  4AWY B;  4PDX A;  4UBQ A;  3IE2 A;  4FEK A;  4AXH A;  3KNS A;  3SFP A;  5B15 A;  3IEK A;  5EVD A;  4EY2 A;  1VME A;  2XF4 A;  5A5Z A;  4UWR B;  5HIO A;  4D02 A;  1DD6 A;  5AJL A;  5ACS A;  2WRS A;  4NQ5 A;  3AF5 A;  4EFZ A;  1X8G A;  2DKF A;  3KL7 A;  4BP0 A;  4U4L A;  4EXS A;  4AX1 B;  3L6N A;  5A87 A;  3VQZ A;  3DH8 A;  3ZR9 A;  1L9Y A;  2ZO4 A;  2YZ3 A;  2Q0I A;  2QED A;  4UWO B;  2NZE A;  1SML A;  3I11 A;  3RKJ A;  1A7T A;  4CHL A;  2I7V A;  4GYQ A;  2WYM A;  2Q9U A;  1BMC A;  5FQA A;  3IE0 A;  1QH3 A;  5FQC A;  4XWT A;  2FU7 A;  4HL2 A;  1X8H A;  4YSB A;  1MQO A;  2XR1 A;  3G1P A;  4UAM A;  2BC2 A;  2Y8A A;  3BV6 A;  3IOG A;  1ZKP A;  3TP9 A;  3IDZ A;  1KO2 A;  1VJN A;  4XUK A;  3PY5 A;  3IEM A;  5A23 A;  4BZ3 A;  2YNV B;  5EW0 A;  4TYF A;  3SW3 A;  4D1V A;  2QIN A;  3FCZ A;  4YSL A;  2BFZ B;  4NQ2 A;  2H6A A;  4TZF A;  4GCW A;  1YCG A;  4C1D A;  5ACQ A;  1BC2 A;  2Q0J A;  3Q6V A;  2NYP A;  5HIP A;  3SBL A;  4EYL A;  5LSC A;  1KR3 A;  2R2D A;  1P9E A;  4Z60 A;  3P2U A;  4RAW A;  4AX0 B;  3PY6 A;  2QJS A;  5ACT A;  4TZB A;  4FSB A;  3MD7 A;  3I15 A;  4ZNB A;  4GYU A;  4Z5Y A;  4ZEJ A;  5B3R A;  4F6Z A;  5LCH A;  3IOF A;  1YCH A;  3T9M A;  4HKY A;  3X2X A;  4F6H A;  2CG3 A;  4TZ9 A;  2BGA A;  2WYM C;  4ZO3 A;  5LE1 A;  1DDK A;  5AXR A;  2GKL A;  2QDT A;  3ZNB A;  4KEQ A;  4H0D A;  5AYA A;  5DPX A;  5ACU A;  3DHB A;  2M5D A;  4TYT A;  3RPC A;  2BG2 A;  4ZO2 A;  3BC2 A; 
#chains in the Genus database with same CATH homology
 4AD9 A;  3QH8 A;  4NQ6 A;  1DXK A;  2BG6 A;  2BIB A;  5LMC A;  2AZ4 A;  4V0H A;  2GFJ A;  5EWA A;  2YNT B;  3LVZ A;  2Y8B A;  5FQB A;  4EXY A;  1JT1 A;  2DOO A;  2WHG A;  3KNR A;  4C09 A;  4DIK A;  2I7X A;  4NQ4 A;  4D1U A;  4O98 A;  2BR6 A;  1E5D A;  2YNV A;  4J5F A;  3A4Y A;  3PG4 A;  4EYF A;  4UA4 A;  4WD6 A;  5K4K A;  5LLD A;  2BTN A;  4UWP B;  4Z5Z A;  2YNW A;  3BK2 A;  5KIK A;  5K4N A;  2Y87 A;  4RBS A;  5HH5 A;  3AJ3 A;  2BFZ A;  3AF6 A;  3SRX A;  4P62 A;  3T3O A;  4YSK A;  2BFK A;  1ZNB A;  3ZQ4 A;  2BG7 A;  1KO3 A;  3WXC A;  4D1W A;  5ACW A;  5EVK A;  4XWW A;  4Z6X A;  1JJE A;  4DIL A;  2BFL A;  2FK6 A;  4PVT A;  3X2Y A;  4C1F A;  2HB9 A;  4TZE A;  3FAI A;  2YNU A;  2GCU A;  5EVB A;  4AWZ A;  3F9O A;  2P18 A;  2AIO A;  1VGN A;  2FU8 A;  2NZF A;  4LE6 A;  3IE1 A;  5KIL A;  4RM5 A;  4RAM A;  4C1G A;  5LCF A;  2WYL A;  1XM8 A;  2ZNB A;  1WRA A;  3S0Z A;  4PVO A;  5ACP A;  5AHO A;  1XTO A;  3X30 A;  1Y44 A;  4EYB A;  2OHH A;  5EHT A;  4D1T A;  1WW1 A;  1HLK A;  2FU6 A;  3X2Z A;  2I7T A;  4UWS B;  2Q42 A;  4RL2 A;  2OHI A;  5AEB A;  2GFK A;  5AHR A;  2BG8 B;  2P1E A;  5K4M A;  2FM6 A;  4Z67 A;  5ACR A;  2ZZI A;  2GMN A;  4KEP A;  4HL1 A;  5EV6 A;  3ADR A;  2QDS A;  5ACX A;  1X8I A;  4Z7R A;  5A0V A;  3JXP A;  2P4Z A;  5LS3 A;  3SPU A;  5HIQ A;  2BMI A;  5HIS A;  2NXA A;  3ZWF A;  4J5H A;  5HH6 A;  2P97 A;  3ESH A;  2YNT A;  4RL0 A;  3R2U A;  2YCB A;  1JJT A;  4C1H A;  2BG8 A;  3SD9 A;  1M2X A;  5HH4 A;  3RKK A;  3IEL A;  3T3N A;  5B1U A;  2FHX A;  4JO0 A;  2UYX A;  1QH5 A;  2M5C A;  2FHX B;  4FR7 A;  4C1C A;  2OHJ A;  5ACV A;  5EH9 A;  3I13 A;  2A7M A;  1K07 A;  2CBN A;  5IQK A;  1A8T A;  5LM6 A;  3DHC A;  3VPE A;  2ZWR A;  3BK1 A;  5LCA A;  2VW8 A;  5K0W A;  5AXO A;  1ZTC A;  3I14 A;  2E7Y A;  4C1E A;  1WUO A;  3H3E A;  3I0V A;  4B87 A;  1YCF A;  3DHA A;  2FU9 A;  1WUP A;  5EV8 A;  1BVT A;  5A0T A;  4AWY B;  4UBQ A;  3IE2 A;  4FEK A;  3KNS A;  3SFP A;  5B15 A;  3IEK A;  5EVD A;  4EY2 A;  1VME A;  2XF4 A;  5A5Z A;  4UWR B;  5HIO A;  4D02 A;  1DD6 A;  5ACS A;  2WRS A;  4NQ5 A;  3AF5 A;  4EFZ A;  1X8G A;  2DKF A;  3KL7 A;  4BP0 A;  4U4L A;  4EXS A;  4AX1 B;  3L6N A;  5A87 A;  3VQZ A;  3DH8 A;  3ZR9 A;  1L9Y A;  2ZO4 A;  2YZ3 A;  2Q0I A;  2QED A;  4UWO B;  2NZE A;  1SML A;  3I11 A;  3RKJ A;  1A7T A;  4CHL A;  2I7V A;  4GYQ A;  2WYM A;  2Q9U A;  1BMC A;  5FQA A;  3IE0 A;  1QH3 A;  5FQC A;  4XWT A;  2FU7 A;  4HL2 A;  1X8H A;  4YSB A;  1MQO A;  2XR1 A;  3G1P A;  4UAM A;  2BC2 A;  2Y8A A;  3BV6 A;  3IOG A;  1ZKP A;  3TP9 A;  3IDZ A;  1KO2 A;  1VJN A;  4XUK A;  3PY5 A;  3IEM A;  4BZ3 A;  2YNV B;  5EW0 A;  4TYF A;  3SW3 A;  4D1V A;  2QIN A;  3FCZ A;  4YSL A;  2BFZ B;  4NQ2 A;  2H6A A;  4TZF A;  4GCW A;  1YCG A;  4C1D A;  5ACQ A;  1BC2 A;  2Q0J A;  3Q6V A;  2NYP A;  5HIP A;  3SBL A;  4EYL A;  5LSC A;  1KR3 A;  2R2D A;  1P9E A;  4Z60 A;  3P2U A;  4RAW A;  4AX0 B;  3PY6 A;  2QJS A;  5ACT A;  4TZB A;  4FSB A;  3MD7 A;  3I15 A;  4ZNB A;  4GYU A;  4Z5Y A;  4ZEJ A;  5B3R A;  4F6Z A;  5LCH A;  3IOF A;  1YCH A;  3T9M A;  4HKY A;  3X2X A;  4F6H A;  4TZ9 A;  2BGA A;  2WYM C;  4ZO3 A;  5LE1 A;  1DDK A;  5AXR A;  2GKL A;  2QDT A;  3ZNB A;  4KEQ A;  4H0D A;  5AYA A;  5DPX A;  5ACU A;  3DHB A;  2M5D A;  4TYT A;  3RPC A;  2BG2 A;  4ZO2 A;  3BC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...