5LS3A

Crystal structure of metallo-beta-lactamase spm-1 with y58c mutation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
239
Chain Sequence
b'DHVDLPYNLTATKIDSDVFVVTDRDFCSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase IMP-1
publication title (19) F-NMR Reveals the Role of Mobile Loops in Product and Inhibitor Binding by the Sao Paulo Metallo-beta-Lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 80
structure length 239
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ls3A00
4HKYA 4UWPB 4U4LA 3I15A 1A7TA 2P18A 1WUOA 4Z6XA 5ACVA 1DD6A 2GFJA 4EY2A 2ZWRA 5KILA 2OHIA 4ZO2A 5ACQA 3P2UA 5HH6A 2YNTB 5K4NA 4C1EA 2BMIA 5A5ZA 4UWRB 4RM5A 2VW8A 3IE0A 2QINA 2NZFA 3T3NA 4NQ2A 4D1TA 2R2DA 4UAMA 3RPCA 2FU7A 5FQAA 3I13A 1KO2A 4YSKA 4CHLA 1VJNA 4AD9A 2XR1A 5B3RA 3FAIA 5LLDA 2M5DA 2QEDA 2NZEA 3IEKA 3BK2A 4Z7RA 4RAWA 5B15A 2BFKA 3BK1A 2FU6A 3KNRA 5HISA 3IELA 2BG8A 3L6NA 1SMLA 4H0DA 4AX1B 4Z67A 1A8TA 2OHJA 2Q42A 4F6ZA 2Y8BA 4AX0B 3ESHA 4O98A 3I11A 4RL2A 3ZR9A 4XWWA 3SD9A 3PG4A 1VGNA 3A4YA 5ACWA 4F6HA 1DXKA 5K4KA 5EW0A 4Z5YA 5AHOA 1BVTA 5IQKA 2Q9UA 1KR3A 5EVKA 2DKFA 4TZBA 5A0TA 2CBNA 4FR7A 4EYBA 1WUPA 2YNUA 1ZNBA 3IE1A 2WYMA 4KEQA 3SW3A 1BC2A 3RKJA 3I14A 2FM6A 4NQ4A 1BMCA 3AF5A 3SPUA 1YCHA 4EYLA 2BG2A 3IOGA 5LS3A 1YCGA 4PVTA 3PY6A 2BG6A 5ACRA 1M2XA 2YNWA 2GFKA 5ACSA 4FEKA 4C1FA 1WW1A 2BC2A 4D1UA 2P4ZA 4D1VA 5EVDA 2Q0JA 5K4MA 2GKLA 1HLKA 4UA4A 4YSBA 4EFZA 2M5CA 2Q0IA 1X8GA 3LVZA 2QDTA 4HL2A 2GCUA 3SRXA 1ZKPA 1VMEA 3X2YA 4Z60A 3IOFA 2WRSA 4XUKA 5AXOA 1JJTA 5HIPA 2BG8B 5AXRA 1JT1A 4J5FA 5LSCA 5LCAA 4PVOA 3S0ZA 1JJEA 4C1DA 2YNVA 2AZ4A 5LCFA 4DILA 3ZWFA 4EXSA 4RAMA 3AJ3A 4ZO3A 1Y44A 4RL0A 2P1EA 1QH5A 2I7TA 3JXPA 3KNSA 5EV8A 4ZEJA 1DDKA 3IEMA 3FCZA 3T3OA 2E7YA 2HB9A 2GMNA 4J5HA 2YCBA 2I7XA 4AWYB 2UYXA 5EVBA 4C1GA 1ZTCA 4NQ5A 4RBSA 3KL7A 4C1CA 3DHCA 2I7VA 4TYFA 2P97A 1P9EA 4BP0A 3I0VA 5K0WA 2BGAA 1E5DA 3R2UA 3VPEA 2WHGA 3IE2A 3SFPA 5HH4A 4GCWA 5AYAA 4LE6A 5A0VA 5AEBA 5EHTA 3TP9A 2FU8A 2A7MA 2NYPA 4TZ9A 3AF6A 2BFZA 3T9MA 5A87A 2FU9A 2ZO4A 3PY5A 4JO0A 4TZEA 1XM8A 4GYUA 1X8HA 4UWOB 2YZ3A 5FQCA 2AIOA 3IDZA 5LM6A 4HL1A 3WXCA 2QDSA 3G1PA 3VQZA 5LMCA 4D1WA 4BZ3A 4EXYA 5HIOA 5DPXA 4UWSB 2YNTA 5ACTA 3DH8A 3BV6A 3ZNBA 2Y87A 4EYFA 3RKKA 3DHBA 4AWZA 2DOOA 2ZZIA 2BFLA 4YSLA 3F9OA 3Q6VA 5ACUA 2YNVB 4ZNBA 4V0HA 5AHRA 4WD6A 4Z5ZA 1XTOA 4NQ6A 5FQBA 2FK6A 4C09A 4TYTA 2ZNBA 2NXAA 2H6AA 5HH5A 3X2XA 4B87A 3BC2A 5EWAA 4D02A 5ACPA 2BTNA 5EH9A 2BR6A 2FHXB 1YCFA 5KIKA 3X30A 3ZQ4A 2FHXA 1X8IA 4P62A 1WRAA 4FSBA 3SBLA 3QH8A 5EV6A 1KO3A 5B1UA 1K07A 4DIKA 2XF4A 4UBQA 5HIQA 2WYMC 4TZFA 2WYLA 2BG7A 4XWTA 3X2ZA 2Y8AA 1MQOA 2BFZB 4C1HA 1QH3A 1L9YA 5LE1A 3MD7A 4GYQA 2OHHA 2BIBA 3ADRA 2QJSA 3H3EA 4KEPA 3DHAA 5ACXA 5LCHA
chains in the Genus database with same CATH superfamily
4HKYA 4UWPB 4U4LA 3I15A 1A7TA 2P18A 1WUOA 4Z6XA 5ACVA 1DD6A 2GFJA 5AIJA 4EY2A 2ZWRA 5KILA 2OHIA 4ZO2A 5ACQA 3P2UA 5HH6A 2YNTB 2CFUA 5K4NA 4C1EA 2BMIA 5A5ZA 4UWRB 4RM5A 2VW8A 3IE0A 2QINA 2NZFA 3T3NA 4NQ2A 4D1TA 2R2DA 4UAMA 3RPCA 2FU7A 5FQAA 3I13A 1KO2A 4YSKA 4CHLA 1VJNA 4AD9A 2XR1A 5B3RA 3FAIA 5LLDA 2M5DA 2QEDA 2NZEA 3IEKA 3BK2A 4Z7RA 4RAWA 5B15A 2BFKA 3BK1A 2FU6A 3KNRA 5AJLA 5HISA 3IELA 2BG8A 3L6NA 1SMLA 4H0DA 4AX1B 4Z67A 1A8TA 2OHJA 2Q42A 4NURA 4F6ZA 2Y8BA 4AX0B 3ESHA 4O98A 3I11A 4RL2A 3ZR9A 4XWWA 3SD9A 3PG4A 1VGNA 3A4YA 5ACWA 4F6HA 1DXKA 5K4KA 5EW0A 4Z5YA 5AHOA 1BVTA 5IQKA 2Q9UA 1KR3A 5EVKA 2DKFA 4TZBA 5A0TA 2CBNA 4FR7A 4EYBA 1WUPA 2YNUA 1ZNBA 3IE1A 2WYMA 4KEQA 3SW3A 1BC2A 3RKJA 3I14A 2FM6A 4NQ4A 1BMCA 3AF5A 3SPUA 1YCHA 4EYLA 2BG2A 3IOGA 5LS3A 1YCGA 4PVTA 3PY6A 2BG6A 5ACRA 1M2XA 2YNWA 2GFKA 5ACSA 4FEKA 2CG3A 4C1FA 1WW1A 2BC2A 4D1UA 2P4ZA 4D1VA 5EVDA 2Q0JA 5K4MA 2GKLA 1HLKA 4UA4A 4YSBA 4EFZA 2M5CA 2Q0IA 1X8GA 3LVZA 2QDTA 4HL2A 4AXHA 2GCUA 3SRXA 1ZKPA 1VMEA 3X2YA 4Z60A 3IOFA 2WRSA 2CFZA 4XUKA 5AXOA 1JJTA 5HIPA 2BG8B 5AXRA 1JT1A 4J5FA 5LSCA 5LCAA 4PVOA 3S0ZA 1JJEA 4C1DA 2YNVA 2AZ4A 5LCFA 4DILA 3ZWFA 4EXSA 4RAMA 3AJ3A 4ZO3A 1Y44A 4RL0A 2P1EA 1QH5A 2I7TA 3JXPA 3KNSA 5EV8A 4ZEJA 1DDKA 3IEMA 3FCZA 5A23A 3T3OA 2E7YA 2HB9A 2GMNA 4J5HA 4AV7A 2YCBA 2I7XA 4AWYB 2UYXA 2YHEA 5EVBA 4C1GA 1ZTCA 4NQ5A 4RBSA 3KL7A 4C1CA 3DHCA 2I7VA 4TYFA 2P97A 1P9EA 4BP0A 3I0VA 5K0WA 2BGAA 1E5DA 3R2UA 3VPEA 2WHGA 3IE2A 3SFPA 5HH4A 4GCWA 5AYAA 4LE6A 5A0VA 5AEBA 5EHTA 3TP9A 2FU8A 2A7MA 2NYPA 4TZ9A 3AF6A 2BFZA 3T9MA 5A87A 2FU9A 2ZO4A 3PY5A 4JO0A 4TZEA 1XM8A 4GYUA 1X8HA 4UWOB 2YZ3A 5FQCA 2AIOA 3IDZA 5LM6A 4HL1A 3WXCA 2QDSA 3G1PA 3VQZA 5LMCA 4D1WA 4BZ3A 4EXYA 5HIOA 5DPXA 4UWSB 2YNTA 5ACTA 3DH8A 2CG2A 3BV6A 3ZNBA 2Y87A 3RKKA 4EYFA 3DHBA 4AWZA 2DOOA 2ZZIA 2BFLA 4YSLA 3F9OA 3Q6VA 5ACUA 2YNVB 4ZNBA 4V0HA 5AHRA 4WD6A 4Z5ZA 1XTOA 4NQ6A 5FQBA 2FK6A 4C09A 4TYTA 2ZNBA 2NXAA 2H6AA 5HH5A 3X2XA 4B87A 3BC2A 5EWAA 4D02A 5ACPA 2BTNA 5EH9A 2BR6A 2FHXB 1YCFA 5KIKA 3X30A 3ZQ4A 2FHXA 1X8IA 4P62A 1WRAA 4FSBA 3SBLA 4PDXA 3QH8A 5EV6A 1KO3A 5B1UA 1K07A 4DIKA 2XF4A 4UBQA 5HIQA 2WYMC 4TZFA 2WYLA 2BG7A 4XWTA 3X2ZA 2Y8AA 1MQOA 2BFZB 4C1HA 1QH3A 1L9YA 5LE1A 3MD7A 4GYQA 2OHHA 2BIBA 3ADRA 2QJSA 3H3EA 4KEPA 3DHAA 5ACXA 5LCHA
chains in the Genus database with same CATH topology
4HKYA 4UWPB 4U4LA 3I15A 1A7TA 2P18A 1WUOA 4Z6XA 5ACVA 1DD6A 2GFJA 4EY2A 2ZWRA 5KILA 2OHIA 4ZO2A 5ACQA 3P2UA 5HH6A 2YNTB 5K4NA 4C1EA 2BMIA 5A5ZA 4UWRB 4RM5A 2VW8A 3IE0A 2QINA 2NZFA 3T3NA 4NQ2A 4D1TA 2R2DA 4UAMA 3RPCA 2FU7A 5FQAA 3I13A 1KO2A 4YSKA 4CHLA 1VJNA 4AD9A 2XR1A 5B3RA 3FAIA 5LLDA 2M5DA 2QEDA 2NZEA 3IEKA 3BK2A 4Z7RA 4RAWA 5B15A 2BFKA 3BK1A 2FU6A 3KNRA 5HISA 3IELA 2BG8A 3L6NA 1SMLA 4H0DA 4AX1B 4Z67A 1A8TA 2OHJA 2Q42A 4F6ZA 2Y8BA 4AX0B 3ESHA 4O98A 3I11A 4RL2A 3ZR9A 4XWWA 3SD9A 3PG4A 1VGNA 3A4YA 5ACWA 4F6HA 1DXKA 5K4KA 5EW0A 4Z5YA 5AHOA 1BVTA 5IQKA 2Q9UA 1KR3A 5EVKA 2DKFA 4TZBA 5A0TA 2CBNA 4FR7A 4EYBA 1WUPA 2YNUA 1ZNBA 3IE1A 2WYMA 4KEQA 3SW3A 1BC2A 3RKJA 3I14A 2FM6A 4NQ4A 1BMCA 3AF5A 3SPUA 1YCHA 4EYLA 2BG2A 3IOGA 5LS3A 1YCGA 4PVTA 3PY6A 2BG6A 5ACRA 1M2XA 2YNWA 2GFKA 5ACSA 4FEKA 4C1FA 1WW1A 2BC2A 4D1UA 2P4ZA 4D1VA 5EVDA 2Q0JA 5K4MA 2GKLA 1HLKA 4UA4A 4YSBA 4EFZA 2M5CA 2Q0IA 1X8GA 3LVZA 2QDTA 4HL2A 2GCUA 3SRXA 1ZKPA 1VMEA 3X2YA 4Z60A 3IOFA 2WRSA 4XUKA 5AXOA 1JJTA 5HIPA 2BG8B 5AXRA 1JT1A 4J5FA 5LSCA 5LCAA 4PVOA 3S0ZA 1JJEA 4C1DA 2YNVA 2AZ4A 5LCFA 4DILA 3ZWFA 4EXSA 4RAMA 3AJ3A 4ZO3A 1Y44A 4RL0A 2P1EA 1QH5A 2I7TA 3JXPA 3KNSA 5EV8A 4ZEJA 1DDKA 3IEMA 3FCZA 3T3OA 2E7YA 2HB9A 2GMNA 4J5HA 2YCBA 2I7XA 4AWYB 2UYXA 5EVBA 4C1GA 1ZTCA 4NQ5A 4RBSA 3KL7A 4C1CA 3DHCA 2I7VA 4TYFA 2P97A 1P9EA 4BP0A 3I0VA 5K0WA 2BGAA 1E5DA 3R2UA 3VPEA 2WHGA 3IE2A 3SFPA 5HH4A 4GCWA 5AYAA 4LE6A 5A0VA 5AEBA 5EHTA 3TP9A 2FU8A 2A7MA 2NYPA 4TZ9A 3AF6A 2BFZA 3T9MA 5A87A 2FU9A 2ZO4A 3PY5A 4JO0A 4TZEA 1XM8A 4GYUA 1X8HA 4UWOB 2YZ3A 5FQCA 2AIOA 3IDZA 5LM6A 4HL1A 3WXCA 2QDSA 3G1PA 3VQZA 5LMCA 4D1WA 4BZ3A 4EXYA 5HIOA 5DPXA 4UWSB 2YNTA 5ACTA 3DH8A 3BV6A 3ZNBA 2Y87A 4EYFA 3RKKA 3DHBA 4AWZA 2DOOA 2ZZIA 2BFLA 4YSLA 3F9OA 3Q6VA 5ACUA 2YNVB 4ZNBA 4V0HA 5AHRA 4WD6A 4Z5ZA 1XTOA 4NQ6A 5FQBA 2FK6A 4C09A 4TYTA 2ZNBA 2NXAA 2H6AA 5HH5A 3X2XA 4B87A 3BC2A 5EWAA 4D02A 5ACPA 2BTNA 5EH9A 2BR6A 2FHXB 1YCFA 5KIKA 3X30A 3ZQ4A 2FHXA 1X8IA 4P62A 1WRAA 4FSBA 3SBLA 3QH8A 5EV6A 1KO3A 5B1UA 1K07A 4DIKA 2XF4A 4UBQA 5HIQA 2WYMC 4TZFA 2WYLA 2BG7A 4XWTA 3X2ZA 2Y8AA 1MQOA 2BFZB 4C1HA 1QH3A 1L9YA 5LE1A 3MD7A 4GYQA 2OHHA 2BIBA 3ADRA 2QJSA 3H3EA 4KEPA 3DHAA 5ACXA 5LCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKY A;  4UWP B;  4U4L A;  3I15 A;  1A7T A;  2P18 A;  1WUO A;  4Z6X A;  5ACV A;  1DD6 A;  2GFJ A;  4EY2 A;  2ZWR A;  5KIL A;  2OHI A;  4ZO2 A;  5ACQ A;  3P2U A;  5HH6 A;  2YNT B;  5K4N A;  4C1E A;  2BMI A;  5A5Z A;  4UWR B;  4RM5 A;  2VW8 A;  3IE0 A;  2QIN A;  2NZF A;  3T3N A;  4NQ2 A;  4D1T A;  2R2D A;  4UAM A;  3RPC A;  2FU7 A;  5FQA A;  3I13 A;  1KO2 A;  4YSK A;  4CHL A;  1VJN A;  4AD9 A;  2XR1 A;  5B3R A;  3FAI A;  5LLD A;  2M5D A;  2QED A;  2NZE A;  3IEK A;  3BK2 A;  4Z7R A;  4RAW A;  5B15 A;  2BFK A;  3BK1 A;  2FU6 A;  3KNR A;  5HIS A;  3IEL A;  2BG8 A;  3L6N A;  1SML A;  4H0D A;  4AX1 B;  4Z67 A;  1A8T A;  2OHJ A;  2Q42 A;  4F6Z A;  2Y8B A;  4AX0 B;  3ESH A;  4O98 A;  3I11 A;  4RL2 A;  3ZR9 A;  4XWW A;  3SD9 A;  3PG4 A;  1VGN A;  3A4Y A;  5ACW A;  4F6H A;  1DXK A;  5K4K A;  5EW0 A;  4Z5Y A;  5AHO A;  1BVT A;  5IQK A;  2Q9U A;  1KR3 A;  5EVK A;  2DKF A;  4TZB A;  5A0T A;  2CBN A;  4FR7 A;  4EYB A;  1WUP A;  2YNU A;  1ZNB A;  3IE1 A;  2WYM A;  4KEQ A;  3SW3 A;  1BC2 A;  3RKJ A;  3I14 A;  2FM6 A;  4NQ4 A;  1BMC A;  3AF5 A;  3SPU A;  1YCH A;  4EYL A;  2BG2 A;  3IOG A;  5LS3 A;  1YCG A;  4PVT A;  3PY6 A;  2BG6 A;  5ACR A;  1M2X A;  2YNW A;  2GFK A;  5ACS A;  4FEK A;  4C1F A;  1WW1 A;  2BC2 A;  4D1U A;  2P4Z A;  4D1V A;  5EVD A;  2Q0J A;  5K4M A;  2GKL A;  1HLK A;  4UA4 A;  4YSB A;  4EFZ A;  2M5C A;  2Q0I A;  1X8G A;  3LVZ A;  2QDT A;  4HL2 A;  2GCU A;  3SRX A;  1ZKP A;  1VME A;  3X2Y A;  4Z60 A;  3IOF A;  2WRS A;  4XUK A;  5AXO A;  1JJT A;  5HIP A;  2BG8 B;  5AXR A;  1JT1 A;  4J5F A;  5LSC A;  5LCA A;  4PVO A;  3S0Z A;  1JJE A;  4C1D A;  2YNV A;  2AZ4 A;  5LCF A;  4DIL A;  3ZWF A;  4EXS A;  4RAM A;  3AJ3 A;  4ZO3 A;  1Y44 A;  4RL0 A;  2P1E A;  1QH5 A;  2I7T A;  3JXP A;  3KNS A;  5EV8 A;  4ZEJ A;  1DDK A;  3IEM A;  3FCZ A;  3T3O A;  2E7Y A;  2HB9 A;  2GMN A;  4J5H A;  2YCB A;  2I7X A;  4AWY B;  2UYX A;  5EVB A;  4C1G A;  1ZTC A;  4NQ5 A;  4RBS A;  3KL7 A;  4C1C A;  3DHC A;  2I7V A;  4TYF A;  2P97 A;  1P9E A;  4BP0 A;  3I0V A;  5K0W A;  2BGA A;  1E5D A;  3R2U A;  3VPE A;  2WHG A;  3IE2 A;  3SFP A;  5HH4 A;  4GCW A;  5AYA A;  4LE6 A;  5A0V A;  5AEB A;  5EHT A;  3TP9 A;  2FU8 A;  2A7M A;  2NYP A;  4TZ9 A;  3AF6 A;  2BFZ A;  3T9M A;  5A87 A;  2FU9 A;  2ZO4 A;  3PY5 A;  4JO0 A;  4TZE A;  1XM8 A;  4GYU A;  1X8H A;  4UWO B;  2YZ3 A;  5FQC A;  2AIO A;  3IDZ A;  5LM6 A;  4HL1 A;  3WXC A;  2QDS A;  3G1P A;  3VQZ A;  5LMC A;  4D1W A;  4BZ3 A;  4EXY A;  5HIO A;  5DPX A;  4UWS B;  2YNT A;  5ACT A;  3DH8 A;  3BV6 A;  3ZNB A;  2Y87 A;  4EYF A;  3RKK A;  3DHB A;  4AWZ A;  2DOO A;  2ZZI A;  2BFL A;  4YSL A;  3F9O A;  3Q6V A;  5ACU A;  2YNV B;  4ZNB A;  4V0H A;  5AHR A;  4WD6 A;  4Z5Z A;  1XTO A;  4NQ6 A;  5FQB A;  2FK6 A;  4C09 A;  4TYT A;  2ZNB A;  2NXA A;  2H6A A;  5HH5 A;  3X2X A;  4B87 A;  3BC2 A;  5EWA A;  4D02 A;  5ACP A;  2BTN A;  5EH9 A;  2BR6 A;  2FHX B;  1YCF A;  5KIK A;  3X30 A;  3ZQ4 A;  2FHX A;  1X8I A;  4P62 A;  1WRA A;  4FSB A;  3SBL A;  3QH8 A;  5EV6 A;  1KO3 A;  5B1U A;  1K07 A;  4DIK A;  2XF4 A;  4UBQ A;  5HIQ A;  2WYM C;  4TZF A;  2WYL A;  2BG7 A;  4XWT A;  3X2Z A;  2Y8A A;  1MQO A;  2BFZ B;  4C1H A;  1QH3 A;  1L9Y A;  5LE1 A;  3MD7 A;  4GYQ A;  2OHH A;  2BIB A;  3ADR A;  2QJS A;  3H3E A;  4KEP A;  3DHA A;  5ACX A;  5LCH A; 
#chains in the Genus database with same CATH topology
 4HKY A;  4UWP B;  4U4L A;  3I15 A;  1A7T A;  2P18 A;  1WUO A;  4Z6X A;  5ACV A;  1DD6 A;  2GFJ A;  5AIJ A;  4EY2 A;  2ZWR A;  5KIL A;  2OHI A;  4ZO2 A;  5ACQ A;  3P2U A;  5HH6 A;  2YNT B;  2CFU A;  5K4N A;  4C1E A;  2BMI A;  5A5Z A;  4UWR B;  4RM5 A;  2VW8 A;  3IE0 A;  2QIN A;  2NZF A;  3T3N A;  4NQ2 A;  4D1T A;  2R2D A;  4UAM A;  3RPC A;  2FU7 A;  5FQA A;  3I13 A;  1KO2 A;  4YSK A;  4CHL A;  1VJN A;  4AD9 A;  2XR1 A;  5B3R A;  3FAI A;  5LLD A;  2M5D A;  2QED A;  2NZE A;  3IEK A;  3BK2 A;  4Z7R A;  4RAW A;  5B15 A;  2BFK A;  3BK1 A;  2FU6 A;  3KNR A;  5AJL A;  5HIS A;  3IEL A;  2BG8 A;  3L6N A;  1SML A;  4H0D A;  4AX1 B;  4Z67 A;  1A8T A;  2OHJ A;  2Q42 A;  4NUR A;  4F6Z A;  2Y8B A;  4AX0 B;  3ESH A;  4O98 A;  3I11 A;  4RL2 A;  3ZR9 A;  4XWW A;  3SD9 A;  3PG4 A;  1VGN A;  3A4Y A;  5ACW A;  4F6H A;  1DXK A;  5K4K A;  5EW0 A;  4Z5Y A;  5AHO A;  1BVT A;  5IQK A;  2Q9U A;  1KR3 A;  5EVK A;  2DKF A;  4TZB A;  5A0T A;  2CBN A;  4FR7 A;  4EYB A;  1WUP A;  2YNU A;  1ZNB A;  3IE1 A;  2WYM A;  4KEQ A;  3SW3 A;  1BC2 A;  3RKJ A;  3I14 A;  2FM6 A;  4NQ4 A;  1BMC A;  3AF5 A;  3SPU A;  1YCH A;  4EYL A;  2BG2 A;  3IOG A;  5LS3 A;  1YCG A;  4PVT A;  3PY6 A;  2BG6 A;  5ACR A;  1M2X A;  2YNW A;  2GFK A;  5ACS A;  4FEK A;  2CG3 A;  4C1F A;  1WW1 A;  2BC2 A;  4D1U A;  2P4Z A;  4D1V A;  5EVD A;  2Q0J A;  5K4M A;  2GKL A;  1HLK A;  4UA4 A;  4YSB A;  4EFZ A;  2M5C A;  2Q0I A;  1X8G A;  3LVZ A;  2QDT A;  4HL2 A;  4AXH A;  2GCU A;  3SRX A;  1ZKP A;  1VME A;  3X2Y A;  4Z60 A;  3IOF A;  2WRS A;  2CFZ A;  4XUK A;  5AXO A;  1JJT A;  5HIP A;  2BG8 B;  5AXR A;  1JT1 A;  4J5F A;  5LSC A;  5LCA A;  4PVO A;  3S0Z A;  1JJE A;  4C1D A;  2YNV A;  2AZ4 A;  5LCF A;  4DIL A;  3ZWF A;  4EXS A;  4RAM A;  3AJ3 A;  4ZO3 A;  1Y44 A;  4RL0 A;  2P1E A;  1QH5 A;  2I7T A;  3JXP A;  3KNS A;  5EV8 A;  4ZEJ A;  1DDK A;  3IEM A;  3FCZ A;  5A23 A;  3T3O A;  2E7Y A;  2HB9 A;  2GMN A;  4J5H A;  4AV7 A;  2YCB A;  2I7X A;  4AWY B;  2UYX A;  2YHE A;  5EVB A;  4C1G A;  1ZTC A;  4NQ5 A;  4RBS A;  3KL7 A;  4C1C A;  3DHC A;  2I7V A;  4TYF A;  2P97 A;  1P9E A;  4BP0 A;  3I0V A;  5K0W A;  2BGA A;  1E5D A;  3R2U A;  3VPE A;  2WHG A;  3IE2 A;  3SFP A;  5HH4 A;  4GCW A;  5AYA A;  4LE6 A;  5A0V A;  5AEB A;  5EHT A;  3TP9 A;  2FU8 A;  2A7M A;  2NYP A;  4TZ9 A;  3AF6 A;  2BFZ A;  3T9M A;  5A87 A;  2FU9 A;  2ZO4 A;  3PY5 A;  4JO0 A;  4TZE A;  1XM8 A;  4GYU A;  1X8H A;  4UWO B;  2YZ3 A;  5FQC A;  2AIO A;  3IDZ A;  5LM6 A;  4HL1 A;  3WXC A;  2QDS A;  3G1P A;  3VQZ A;  5LMC A;  4D1W A;  4BZ3 A;  4EXY A;  5HIO A;  5DPX A;  4UWS B;  2YNT A;  5ACT A;  3DH8 A;  2CG2 A;  3BV6 A;  3ZNB A;  2Y87 A;  3RKK A;  4EYF A;  3DHB A;  4AWZ A;  2DOO A;  2ZZI A;  2BFL A;  4YSL A;  3F9O A;  3Q6V A;  5ACU A;  2YNV B;  4ZNB A;  4V0H A;  5AHR A;  4WD6 A;  4Z5Z A;  1XTO A;  4NQ6 A;  5FQB A;  2FK6 A;  4C09 A;  4TYT A;  2ZNB A;  2NXA A;  2H6A A;  5HH5 A;  3X2X A;  4B87 A;  3BC2 A;  5EWA A;  4D02 A;  5ACP A;  2BTN A;  5EH9 A;  2BR6 A;  2FHX B;  1YCF A;  5KIK A;  3X30 A;  3ZQ4 A;  2FHX A;  1X8I A;  4P62 A;  1WRA A;  4FSB A;  3SBL A;  4PDX A;  3QH8 A;  5EV6 A;  1KO3 A;  5B1U A;  1K07 A;  4DIK A;  2XF4 A;  4UBQ A;  5HIQ A;  2WYM C;  4TZF A;  2WYL A;  2BG7 A;  4XWT A;  3X2Z A;  2Y8A A;  1MQO A;  2BFZ B;  4C1H A;  1QH3 A;  1L9Y A;  5LE1 A;  3MD7 A;  4GYQ A;  2OHH A;  2BIB A;  3ADR A;  2QJS A;  3H3E A;  4KEP A;  3DHA A;  5ACX A;  5LCH A; 
#chains in the Genus database with same CATH homology
 4HKY A;  4UWP B;  4U4L A;  3I15 A;  1A7T A;  2P18 A;  1WUO A;  4Z6X A;  5ACV A;  1DD6 A;  2GFJ A;  4EY2 A;  2ZWR A;  5KIL A;  2OHI A;  4ZO2 A;  5ACQ A;  3P2U A;  5HH6 A;  2YNT B;  5K4N A;  4C1E A;  2BMI A;  5A5Z A;  4UWR B;  4RM5 A;  2VW8 A;  3IE0 A;  2QIN A;  2NZF A;  3T3N A;  4NQ2 A;  4D1T A;  2R2D A;  4UAM A;  3RPC A;  2FU7 A;  5FQA A;  3I13 A;  1KO2 A;  4YSK A;  4CHL A;  1VJN A;  4AD9 A;  2XR1 A;  5B3R A;  3FAI A;  5LLD A;  2M5D A;  2QED A;  2NZE A;  3IEK A;  3BK2 A;  4Z7R A;  4RAW A;  5B15 A;  2BFK A;  3BK1 A;  2FU6 A;  3KNR A;  5HIS A;  3IEL A;  2BG8 A;  3L6N A;  1SML A;  4H0D A;  4AX1 B;  4Z67 A;  1A8T A;  2OHJ A;  2Q42 A;  4F6Z A;  2Y8B A;  4AX0 B;  3ESH A;  4O98 A;  3I11 A;  4RL2 A;  3ZR9 A;  4XWW A;  3SD9 A;  3PG4 A;  1VGN A;  3A4Y A;  5ACW A;  4F6H A;  1DXK A;  5K4K A;  5EW0 A;  4Z5Y A;  5AHO A;  1BVT A;  5IQK A;  2Q9U A;  1KR3 A;  5EVK A;  2DKF A;  4TZB A;  5A0T A;  2CBN A;  4FR7 A;  4EYB A;  1WUP A;  2YNU A;  1ZNB A;  3IE1 A;  2WYM A;  4KEQ A;  3SW3 A;  1BC2 A;  3RKJ A;  3I14 A;  2FM6 A;  4NQ4 A;  1BMC A;  3AF5 A;  3SPU A;  1YCH A;  4EYL A;  2BG2 A;  3IOG A;  5LS3 A;  1YCG A;  4PVT A;  3PY6 A;  2BG6 A;  5ACR A;  1M2X A;  2YNW A;  2GFK A;  5ACS A;  4FEK A;  4C1F A;  1WW1 A;  2BC2 A;  4D1U A;  2P4Z A;  4D1V A;  5EVD A;  2Q0J A;  5K4M A;  2GKL A;  1HLK A;  4UA4 A;  4YSB A;  4EFZ A;  2M5C A;  2Q0I A;  1X8G A;  3LVZ A;  2QDT A;  4HL2 A;  2GCU A;  3SRX A;  1ZKP A;  1VME A;  3X2Y A;  4Z60 A;  3IOF A;  2WRS A;  4XUK A;  5AXO A;  1JJT A;  5HIP A;  2BG8 B;  5AXR A;  1JT1 A;  4J5F A;  5LSC A;  5LCA A;  4PVO A;  3S0Z A;  1JJE A;  4C1D A;  2YNV A;  2AZ4 A;  5LCF A;  4DIL A;  3ZWF A;  4EXS A;  4RAM A;  3AJ3 A;  4ZO3 A;  1Y44 A;  4RL0 A;  2P1E A;  1QH5 A;  2I7T A;  3JXP A;  3KNS A;  5EV8 A;  4ZEJ A;  1DDK A;  3IEM A;  3FCZ A;  3T3O A;  2E7Y A;  2HB9 A;  2GMN A;  4J5H A;  2YCB A;  2I7X A;  4AWY B;  2UYX A;  5EVB A;  4C1G A;  1ZTC A;  4NQ5 A;  4RBS A;  3KL7 A;  4C1C A;  3DHC A;  2I7V A;  4TYF A;  2P97 A;  1P9E A;  4BP0 A;  3I0V A;  5K0W A;  2BGA A;  1E5D A;  3R2U A;  3VPE A;  2WHG A;  3IE2 A;  3SFP A;  5HH4 A;  4GCW A;  5AYA A;  4LE6 A;  5A0V A;  5AEB A;  5EHT A;  3TP9 A;  2FU8 A;  2A7M A;  2NYP A;  4TZ9 A;  3AF6 A;  2BFZ A;  3T9M A;  5A87 A;  2FU9 A;  2ZO4 A;  3PY5 A;  4JO0 A;  4TZE A;  1XM8 A;  4GYU A;  1X8H A;  4UWO B;  2YZ3 A;  5FQC A;  2AIO A;  3IDZ A;  5LM6 A;  4HL1 A;  3WXC A;  2QDS A;  3G1P A;  3VQZ A;  5LMC A;  4D1W A;  4BZ3 A;  4EXY A;  5HIO A;  5DPX A;  4UWS B;  2YNT A;  5ACT A;  3DH8 A;  3BV6 A;  3ZNB A;  2Y87 A;  4EYF A;  3RKK A;  3DHB A;  4AWZ A;  2DOO A;  2ZZI A;  2BFL A;  4YSL A;  3F9O A;  3Q6V A;  5ACU A;  2YNV B;  4ZNB A;  4V0H A;  5AHR A;  4WD6 A;  4Z5Z A;  1XTO A;  4NQ6 A;  5FQB A;  2FK6 A;  4C09 A;  4TYT A;  2ZNB A;  2NXA A;  2H6A A;  5HH5 A;  3X2X A;  4B87 A;  3BC2 A;  5EWA A;  4D02 A;  5ACP A;  2BTN A;  5EH9 A;  2BR6 A;  2FHX B;  1YCF A;  5KIK A;  3X30 A;  3ZQ4 A;  2FHX A;  1X8I A;  4P62 A;  1WRA A;  4FSB A;  3SBL A;  3QH8 A;  5EV6 A;  1KO3 A;  5B1U A;  1K07 A;  4DIK A;  2XF4 A;  4UBQ A;  5HIQ A;  2WYM C;  4TZF A;  2WYL A;  2BG7 A;  4XWT A;  3X2Z A;  2Y8A A;  1MQO A;  2BFZ B;  4C1H A;  1QH3 A;  1L9Y A;  5LE1 A;  3MD7 A;  4GYQ A;  2OHH A;  2BIB A;  3ADR A;  2QJS A;  3H3E A;  4KEP A;  3DHA A;  5ACX A;  5LCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...