5LS3A

Crystal structure of metallo-beta-lactamase spm-1 with y58c mutation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
239
Chain Sequence
DHVDLPYNLTATKIDSDVFVVTDRDFCSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
publication title (19) F-NMR Reveals the Role of Mobile Loops in Product and Inhibitor Binding by the Sao Paulo Metallo-beta-Lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 80
structure length 239
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ls3A00
3G1PA 5AXOA 2GMNA 2FU9A 3I15A 5B15A 3ZR9A 4EYFA 1YCGA 3AF5A 4P62A 3FCZA 3WXCA 2OHHA 5HIOA 4RL0A 2WYMA 3PG4A 4GCWA 4RBSA 4XUKA 1X8GA 1BC2A 1MQOA 2YZ3A 5IQKA 1VMEA 1WRAA 3IEKA 5A5ZA 1JJEA 2Y8AA 3DHCA 5EVDA 2BG8A 1M2XA 5KILA 3IE2A 2Y87A 3RPCA 3SD9A 1A8TA 1A7TA 2BR6A 4TYTA 2BIBA 3KL7A 4D1TA 3IEMA 3T9MA 2A7MA 5LCAA 4NQ4A 3R2UA 1HLKA 5LCHA 1VJNA 3IE0A 3SW3A 2I7VA 4TZFA 4UWOB 2VW8A 2WYLA 4C1DA 4EY2A 4AX0B 5ACRA 1WW1A 1QH3A 2FU8A 3AJ3A 5LMCA 4U4LA 2BMIA 4ZO2A 3AF6A 2FU6A 4H0DA 2P4ZA 5HIPA 5K4NA 1JT1A 4J5FA 2P18A 4TYFA 3IOFA 2FU7A 5AHRA 4Z7RA 2QDTA 2YNVB 4YSBA 2GKLA 3ESHA 4HL1A 4WD6A 4Z5ZA 5FQBA 4AD9A 3I14A 3SPUA 4NQ5A 4NQ6A 5AHOA 1WUOA 3PY6A 1YCFA 3LVZA 5EVBA 5EV8A 5AEBA 3IE1A 2FK6A 3BK1A 5LM6A 5FQAA 4C09A 4V0HA 4YSLA 2YNUA 4FEKA 3BC2A 5EV6A 2M5CA 5LCFA 2R2DA 5K4MA 5LE1A 4GYUA 1DDKA 3I13A 4LE6A 4B87A 2M5DA 5ACPA 5EWAA 2ZO4A 2Y8BA 2NZFA 3FAIA 5ACUA 3SRXA 5FQCA 1BVTA 2QDSA 2ZNBA 1KO3A 2ZZIA 2WHGA 4XWTA 2NXAA 4DIKA 4C1GA 4EXSA 3MD7A 1DXKA 3IELA 1ZNBA 2BG6A 3RKKA 3A4YA 2DKFA 4AX1B 4PVTA 5ACQA 2NYPA 5HIQA 3KNSA 3SBLA 5AYAA 1SMLA 1XTOA 4KEQA 4ZO3A 2ZWRA 2FHXB 4EYLA 4ZEJA 2Q42A 4TZEA 1XM8A 2UYXA 3DHBA 2YNVA 4HL2A 3F9OA 4BZ3A 1YCHA 4HKYA 2GFJA 3T3OA 1VGNA 5KIKA 4Z6XA 3P2UA 3ADRA 4UWPB 2QJSA 4FR7A 4DILA 4RAMA 2OHIA 3VQZA 4EXYA 5HH4A 2Q0IA 5ACTA 1X8IA 4GYQA 4O98A 1ZKPA 2OHJA 4J5HA 3X2XA 2Q0JA 1WUPA 2AZ4A 4KEPA 4NQ2A 3QH8A 3BK2A 1E5DA 5LSCA 4D02A 3KNRA 3IDZA 2XR1A 5EHTA 5EW0A 4D1WA 4RL2A 2I7TA 4Z60A 4RM5A 4Z67A 4FSBA 4TZBA 3VPEA 3X30A 1DD6A 5LLDA 5ACXA 1X8HA 4CHLA 3ZWFA 2FHXA 3SFPA 4XWWA 4AWZA 3IOGA 4UAMA 5LS3A 2YNTB 4BP0A 4D1VA 1KO2A 4EFZA 1KR3A 4UA4A 1K07A 2Q9UA 4D1UA 2XF4A 2BFKA 1QH5A 4F6ZA 3PY5A 2YNWA 4UWSB 2BFLA 3DH8A 5DPXA 5EH9A 5HISA 4TZ9A 4C1FA 1L9YA 4C1CA 4RAWA 1JJTA 4JO0A 2YCBA 5ACVA 3DHAA 4PVOA 1ZTCA 5B1UA 2NZEA 1Y44A 2GCUA 4C1EA 2I7XA 3JXPA 4UBQA 5EVKA 5K0WA 2BG7A 3BV6A 5AXRA 2QEDA 2E7YA 4YSKA 2H6AA 5HH5A 5B3RA 2BG8B 2DOOA 2QINA 5A0VA 2FM6A 1BMCA 4Z5YA 4C1HA 3I0VA 4UWRB 3H3EA 2P1EA 2BFZA 2BC2A 2CBNA 3T3NA 5A87A 3ZNBA 2BG2A 5ACSA 4AWYB 3S0ZA 4ZNBA 2WYMC 2P97A 2BTNA 2BGAA 3ZQ4A 5HH6A 5K4KA 3TP9A 1P9EA 3Q6VA 2AIOA 4F6HA 2YNTA 2WRSA 5ACWA 3L6NA 3I11A 2BFZB 3X2ZA 5A0TA 2GFKA 4EYBA 3X2YA 3RKJA 2HB9A
chains in the Genus database with same CATH superfamily
3G1PA 5AXOA 2GMNA 2FU9A 3I15A 5B15A 3ZR9A 4EYFA 1YCGA 3AF5A 4P62A 3FCZA 3WXCA 2OHHA 5HIOA 4RL0A 2WYMA 3PG4A 4GCWA 4RBSA 4XUKA 1X8GA 1BC2A 1MQOA 2YZ3A 2CG3A 5IQKA 1VMEA 1WRAA 3IEKA 5A5ZA 1JJEA 2Y8AA 3DHCA 5EVDA 2BG8A 1M2XA 5KILA 3IE2A 2Y87A 3RPCA 3SD9A 1A8TA 1A7TA 2BR6A 4TYTA 2BIBA 3KL7A 4D1TA 3IEMA 3T9MA 2YHEA 2A7MA 5LCAA 4NQ4A 3R2UA 1HLKA 5LCHA 1VJNA 3IE0A 3SW3A 2I7VA 4TZFA 4UWOB 2VW8A 2WYLA 4C1DA 4EY2A 4AX0B 5ACRA 1WW1A 1QH3A 2FU8A 3AJ3A 5LMCA 4U4LA 2BMIA 4ZO2A 3AF6A 2FU6A 4H0DA 2P4ZA 5HIPA 5K4NA 1JT1A 4J5FA 2P18A 4TYFA 4AV7A 3IOFA 2FU7A 5AHRA 4Z7RA 4AXHA 2QDTA 2YNVB 4YSBA 2GKLA 3ESHA 4HL1A 4WD6A 4Z5ZA 5FQBA 4AD9A 3I14A 3SPUA 4NQ5A 4NQ6A 5AHOA 1WUOA 3PY6A 1YCFA 3LVZA 5EVBA 5EV8A 5AEBA 3IE1A 2FK6A 3BK1A 5LM6A 5FQAA 4C09A 4V0HA 4YSLA 2YNUA 4FEKA 3BC2A 5EV6A 2M5CA 5LCFA 2R2DA 5K4MA 5LE1A 4GYUA 1DDKA 3I13A 4LE6A 4B87A 2M5DA 5ACPA 5EWAA 2ZO4A 2Y8BA 2NZFA 3FAIA 5ACUA 3SRXA 5FQCA 1BVTA 4PDXA 2QDSA 2ZNBA 5AJLA 1KO3A 2ZZIA 2WHGA 4XWTA 2NXAA 4DIKA 4C1GA 4EXSA 3MD7A 1DXKA 3IELA 1ZNBA 2BG6A 3RKKA 3A4YA 2DKFA 2CG2A 4AX1B 4PVTA 5ACQA 2NYPA 5HIQA 2CFUA 3KNSA 3SBLA 5AYAA 1SMLA 1XTOA 4KEQA 4ZO3A 2ZWRA 2FHXB 4EYLA 4ZEJA 2Q42A 4TZEA 1XM8A 2UYXA 3DHBA 2YNVA 4HL2A 3F9OA 4BZ3A 1YCHA 4HKYA 2GFJA 3T3OA 1VGNA 5KIKA 4Z6XA 3P2UA 3ADRA 4UWPB 2QJSA 4FR7A 4DILA 4RAMA 2OHIA 3VQZA 4EXYA 5HH4A 2Q0IA 5ACTA 1X8IA 4GYQA 4O98A 1ZKPA 4NURA 2OHJA 4J5HA 3X2XA 2Q0JA 1WUPA 2AZ4A 4KEPA 4NQ2A 3QH8A 3BK2A 1E5DA 5LSCA 4D02A 3KNRA 3IDZA 2XR1A 5EHTA 5EW0A 4D1WA 4RL2A 2I7TA 4Z60A 4RM5A 4Z67A 4FSBA 4TZBA 3VPEA 3X30A 1DD6A 5LLDA 5ACXA 1X8HA 4CHLA 3ZWFA 2FHXA 3SFPA 4XWWA 4AWZA 3IOGA 4UAMA 5LS3A 2YNTB 4BP0A 4D1VA 1KO2A 4EFZA 1KR3A 4UA4A 1K07A 2Q9UA 4D1UA 2XF4A 2BFKA 1QH5A 4F6ZA 3PY5A 2YNWA 4UWSB 2BFLA 3DH8A 5DPXA 5EH9A 5HISA 4TZ9A 4C1FA 1L9YA 4C1CA 4RAWA 1JJTA 4JO0A 2YCBA 5AIJA 5ACVA 3DHAA 4PVOA 1ZTCA 5B1UA 2NZEA 2CFZA 1Y44A 2GCUA 4C1EA 2I7XA 3JXPA 4UBQA 5EVKA 5K0WA 2BG7A 3BV6A 5AXRA 2QEDA 2E7YA 4YSKA 2H6AA 5HH5A 5B3RA 2BG8B 2DOOA 2QINA 5A0VA 2FM6A 1BMCA 4Z5YA 4C1HA 3I0VA 4UWRB 3H3EA 5A23A 2P1EA 2BFZA 2BC2A 2CBNA 3T3NA 5A87A 3ZNBA 2BG2A 5ACSA 4AWYB 3S0ZA 4ZNBA 2WYMC 2P97A 2BTNA 2BGAA 3ZQ4A 5HH6A 5K4KA 3TP9A 1P9EA 3Q6VA 2AIOA 4F6HA 2YNTA 2WRSA 5ACWA 3L6NA 3I11A 2BFZB 3X2ZA 5A0TA 2GFKA 4EYBA 3X2YA 3RKJA 2HB9A
chains in the Genus database with same CATH topology
3G1PA 5AXOA 2GMNA 2FU9A 3I15A 5B15A 3ZR9A 4EYFA 1YCGA 3AF5A 4P62A 3FCZA 3WXCA 2OHHA 5HIOA 4RL0A 2WYMA 3PG4A 4GCWA 4RBSA 4XUKA 1X8GA 1BC2A 1MQOA 2YZ3A 5IQKA 1VMEA 1WRAA 3IEKA 5A5ZA 1JJEA 2Y8AA 3DHCA 5EVDA 2BG8A 1M2XA 5KILA 3IE2A 2Y87A 3RPCA 3SD9A 1A8TA 1A7TA 2BR6A 4TYTA 2BIBA 3KL7A 4D1TA 3IEMA 3T9MA 2A7MA 5LCAA 4NQ4A 3R2UA 1HLKA 5LCHA 1VJNA 3IE0A 3SW3A 2I7VA 4TZFA 4UWOB 2VW8A 2WYLA 4C1DA 4EY2A 4AX0B 5ACRA 1WW1A 1QH3A 2FU8A 3AJ3A 5LMCA 4U4LA 2BMIA 4ZO2A 3AF6A 2FU6A 4H0DA 2P4ZA 5HIPA 5K4NA 1JT1A 4J5FA 2P18A 4TYFA 3IOFA 2FU7A 5AHRA 4Z7RA 2QDTA 2YNVB 4YSBA 2GKLA 3ESHA 4HL1A 4WD6A 4Z5ZA 5FQBA 4AD9A 3I14A 3SPUA 4NQ5A 4NQ6A 5AHOA 1WUOA 3PY6A 1YCFA 3LVZA 5EVBA 5EV8A 5AEBA 3IE1A 2FK6A 3BK1A 5LM6A 5FQAA 4C09A 4V0HA 4YSLA 2YNUA 4FEKA 3BC2A 5EV6A 2M5CA 5LCFA 2R2DA 5K4MA 5LE1A 4GYUA 1DDKA 3I13A 4LE6A 4B87A 2M5DA 5ACPA 5EWAA 2ZO4A 2Y8BA 2NZFA 3FAIA 5ACUA 3SRXA 5FQCA 1BVTA 2QDSA 2ZNBA 1KO3A 2ZZIA 2WHGA 4XWTA 2NXAA 4DIKA 4C1GA 4EXSA 3MD7A 1DXKA 3IELA 1ZNBA 2BG6A 3RKKA 3A4YA 2DKFA 4AX1B 4PVTA 5ACQA 2NYPA 5HIQA 3KNSA 3SBLA 5AYAA 1SMLA 1XTOA 4KEQA 4ZO3A 2ZWRA 2FHXB 4EYLA 4ZEJA 2Q42A 4TZEA 1XM8A 2UYXA 3DHBA 2YNVA 4HL2A 3F9OA 4BZ3A 1YCHA 4HKYA 2GFJA 3T3OA 1VGNA 5KIKA 4Z6XA 3P2UA 3ADRA 4UWPB 2QJSA 4FR7A 4DILA 4RAMA 2OHIA 3VQZA 4EXYA 5HH4A 2Q0IA 5ACTA 1X8IA 4GYQA 4O98A 1ZKPA 2OHJA 4J5HA 3X2XA 2Q0JA 1WUPA 2AZ4A 4KEPA 4NQ2A 3QH8A 3BK2A 1E5DA 5LSCA 4D02A 3KNRA 3IDZA 2XR1A 5EHTA 5EW0A 4D1WA 4RL2A 2I7TA 4Z60A 4RM5A 4Z67A 4FSBA 4TZBA 3VPEA 3X30A 1DD6A 5LLDA 5ACXA 1X8HA 4CHLA 3ZWFA 2FHXA 3SFPA 4XWWA 4AWZA 3IOGA 4UAMA 5LS3A 2YNTB 4BP0A 4D1VA 1KO2A 4EFZA 1KR3A 4UA4A 1K07A 2Q9UA 4D1UA 2XF4A 2BFKA 1QH5A 4F6ZA 3PY5A 2YNWA 4UWSB 2BFLA 3DH8A 5DPXA 5EH9A 5HISA 4TZ9A 4C1FA 1L9YA 4C1CA 4RAWA 1JJTA 4JO0A 2YCBA 5ACVA 3DHAA 4PVOA 1ZTCA 5B1UA 2NZEA 1Y44A 2GCUA 4C1EA 2I7XA 3JXPA 4UBQA 5EVKA 5K0WA 2BG7A 3BV6A 5AXRA 2QEDA 2E7YA 4YSKA 2H6AA 5HH5A 5B3RA 2BG8B 2DOOA 2QINA 5A0VA 2FM6A 1BMCA 4Z5YA 4C1HA 3I0VA 4UWRB 3H3EA 2P1EA 2BFZA 2BC2A 2CBNA 3T3NA 5A87A 3ZNBA 2BG2A 5ACSA 4AWYB 3S0ZA 4ZNBA 2WYMC 2P97A 2BTNA 2BGAA 3ZQ4A 5HH6A 5K4KA 3TP9A 1P9EA 3Q6VA 2AIOA 4F6HA 2YNTA 2WRSA 5ACWA 3L6NA 3I11A 2BFZB 3X2ZA 5A0TA 2GFKA 4EYBA 3X2YA 3RKJA 2HB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1P A;  5AXO A;  2GMN A;  2FU9 A;  3I15 A;  5B15 A;  3ZR9 A;  4EYF A;  1YCG A;  3AF5 A;  4P62 A;  3FCZ A;  3WXC A;  2OHH A;  5HIO A;  4RL0 A;  2WYM A;  3PG4 A;  4GCW A;  4RBS A;  4XUK A;  1X8G A;  1BC2 A;  1MQO A;  2YZ3 A;  5IQK A;  1VME A;  1WRA A;  3IEK A;  5A5Z A;  1JJE A;  2Y8A A;  3DHC A;  5EVD A;  2BG8 A;  1M2X A;  5KIL A;  3IE2 A;  2Y87 A;  3RPC A;  3SD9 A;  1A8T A;  1A7T A;  2BR6 A;  4TYT A;  2BIB A;  3KL7 A;  4D1T A;  3IEM A;  3T9M A;  2A7M A;  5LCA A;  4NQ4 A;  3R2U A;  1HLK A;  5LCH A;  1VJN A;  3IE0 A;  3SW3 A;  2I7V A;  4TZF A;  4UWO B;  2VW8 A;  2WYL A;  4C1D A;  4EY2 A;  4AX0 B;  5ACR A;  1WW1 A;  1QH3 A;  2FU8 A;  3AJ3 A;  5LMC A;  4U4L A;  2BMI A;  4ZO2 A;  3AF6 A;  2FU6 A;  4H0D A;  2P4Z A;  5HIP A;  5K4N A;  1JT1 A;  4J5F A;  2P18 A;  4TYF A;  3IOF A;  2FU7 A;  5AHR A;  4Z7R A;  2QDT A;  2YNV B;  4YSB A;  2GKL A;  3ESH A;  4HL1 A;  4WD6 A;  4Z5Z A;  5FQB A;  4AD9 A;  3I14 A;  3SPU A;  4NQ5 A;  4NQ6 A;  5AHO A;  1WUO A;  3PY6 A;  1YCF A;  3LVZ A;  5EVB A;  5EV8 A;  5AEB A;  3IE1 A;  2FK6 A;  3BK1 A;  5LM6 A;  5FQA A;  4C09 A;  4V0H A;  4YSL A;  2YNU A;  4FEK A;  3BC2 A;  5EV6 A;  2M5C A;  5LCF A;  2R2D A;  5K4M A;  5LE1 A;  4GYU A;  1DDK A;  3I13 A;  4LE6 A;  4B87 A;  2M5D A;  5ACP A;  5EWA A;  2ZO4 A;  2Y8B A;  2NZF A;  3FAI A;  5ACU A;  3SRX A;  5FQC A;  1BVT A;  2QDS A;  2ZNB A;  1KO3 A;  2ZZI A;  2WHG A;  4XWT A;  2NXA A;  4DIK A;  4C1G A;  4EXS A;  3MD7 A;  1DXK A;  3IEL A;  1ZNB A;  2BG6 A;  3RKK A;  3A4Y A;  2DKF A;  4AX1 B;  4PVT A;  5ACQ A;  2NYP A;  5HIQ A;  3KNS A;  3SBL A;  5AYA A;  1SML A;  1XTO A;  4KEQ A;  4ZO3 A;  2ZWR A;  2FHX B;  4EYL A;  4ZEJ A;  2Q42 A;  4TZE A;  1XM8 A;  2UYX A;  3DHB A;  2YNV A;  4HL2 A;  3F9O A;  4BZ3 A;  1YCH A;  4HKY A;  2GFJ A;  3T3O A;  1VGN A;  5KIK A;  4Z6X A;  3P2U A;  3ADR A;  4UWP B;  2QJS A;  4FR7 A;  4DIL A;  4RAM A;  2OHI A;  3VQZ A;  4EXY A;  5HH4 A;  2Q0I A;  5ACT A;  1X8I A;  4GYQ A;  4O98 A;  1ZKP A;  2OHJ A;  4J5H A;  3X2X A;  2Q0J A;  1WUP A;  2AZ4 A;  4KEP A;  4NQ2 A;  3QH8 A;  3BK2 A;  1E5D A;  5LSC A;  4D02 A;  3KNR A;  3IDZ A;  2XR1 A;  5EHT A;  5EW0 A;  4D1W A;  4RL2 A;  2I7T A;  4Z60 A;  4RM5 A;  4Z67 A;  4FSB A;  4TZB A;  3VPE A;  3X30 A;  1DD6 A;  5LLD A;  5ACX A;  1X8H A;  4CHL A;  3ZWF A;  2FHX A;  3SFP A;  4XWW A;  4AWZ A;  3IOG A;  4UAM A;  5LS3 A;  2YNT B;  4BP0 A;  4D1V A;  1KO2 A;  4EFZ A;  1KR3 A;  4UA4 A;  1K07 A;  2Q9U A;  4D1U A;  2XF4 A;  2BFK A;  1QH5 A;  4F6Z A;  3PY5 A;  2YNW A;  4UWS B;  2BFL A;  3DH8 A;  5DPX A;  5EH9 A;  5HIS A;  4TZ9 A;  4C1F A;  1L9Y A;  4C1C A;  4RAW A;  1JJT A;  4JO0 A;  2YCB A;  5ACV A;  3DHA A;  4PVO A;  1ZTC A;  5B1U A;  2NZE A;  1Y44 A;  2GCU A;  4C1E A;  2I7X A;  3JXP A;  4UBQ A;  5EVK A;  5K0W A;  2BG7 A;  3BV6 A;  5AXR A;  2QED A;  2E7Y A;  4YSK A;  2H6A A;  5HH5 A;  5B3R A;  2BG8 B;  2DOO A;  2QIN A;  5A0V A;  2FM6 A;  1BMC A;  4Z5Y A;  4C1H A;  3I0V A;  4UWR B;  3H3E A;  2P1E A;  2BFZ A;  2BC2 A;  2CBN A;  3T3N A;  5A87 A;  3ZNB A;  2BG2 A;  5ACS A;  4AWY B;  3S0Z A;  4ZNB A;  2WYM C;  2P97 A;  2BTN A;  2BGA A;  3ZQ4 A;  5HH6 A;  5K4K A;  3TP9 A;  1P9E A;  3Q6V A;  2AIO A;  4F6H A;  2YNT A;  2WRS A;  5ACW A;  3L6N A;  3I11 A;  2BFZ B;  3X2Z A;  5A0T A;  2GFK A;  4EYB A;  3X2Y A;  3RKJ A;  2HB9 A; 
#chains in the Genus database with same CATH topology
 3G1P A;  5AXO A;  2GMN A;  2FU9 A;  3I15 A;  5B15 A;  3ZR9 A;  4EYF A;  1YCG A;  3AF5 A;  4P62 A;  3FCZ A;  3WXC A;  2OHH A;  5HIO A;  4RL0 A;  2WYM A;  3PG4 A;  4GCW A;  4RBS A;  4XUK A;  1X8G A;  1BC2 A;  1MQO A;  2YZ3 A;  2CG3 A;  5IQK A;  1VME A;  1WRA A;  3IEK A;  5A5Z A;  1JJE A;  2Y8A A;  3DHC A;  5EVD A;  2BG8 A;  1M2X A;  5KIL A;  3IE2 A;  2Y87 A;  3RPC A;  3SD9 A;  1A8T A;  1A7T A;  2BR6 A;  4TYT A;  2BIB A;  3KL7 A;  4D1T A;  3IEM A;  3T9M A;  2YHE A;  2A7M A;  5LCA A;  4NQ4 A;  3R2U A;  1HLK A;  5LCH A;  1VJN A;  3IE0 A;  3SW3 A;  2I7V A;  4TZF A;  4UWO B;  2VW8 A;  2WYL A;  4C1D A;  4EY2 A;  4AX0 B;  5ACR A;  1WW1 A;  1QH3 A;  2FU8 A;  3AJ3 A;  5LMC A;  4U4L A;  2BMI A;  4ZO2 A;  3AF6 A;  2FU6 A;  4H0D A;  2P4Z A;  5HIP A;  5K4N A;  1JT1 A;  4J5F A;  2P18 A;  4TYF A;  4AV7 A;  3IOF A;  2FU7 A;  5AHR A;  4Z7R A;  4AXH A;  2QDT A;  2YNV B;  4YSB A;  2GKL A;  3ESH A;  4HL1 A;  4WD6 A;  4Z5Z A;  5FQB A;  4AD9 A;  3I14 A;  3SPU A;  4NQ5 A;  4NQ6 A;  5AHO A;  1WUO A;  3PY6 A;  1YCF A;  3LVZ A;  5EVB A;  5EV8 A;  5AEB A;  3IE1 A;  2FK6 A;  3BK1 A;  5LM6 A;  5FQA A;  4C09 A;  4V0H A;  4YSL A;  2YNU A;  4FEK A;  3BC2 A;  5EV6 A;  2M5C A;  5LCF A;  2R2D A;  5K4M A;  5LE1 A;  4GYU A;  1DDK A;  3I13 A;  4LE6 A;  4B87 A;  2M5D A;  5ACP A;  5EWA A;  2ZO4 A;  2Y8B A;  2NZF A;  3FAI A;  5ACU A;  3SRX A;  5FQC A;  1BVT A;  4PDX A;  2QDS A;  2ZNB A;  5AJL A;  1KO3 A;  2ZZI A;  2WHG A;  4XWT A;  2NXA A;  4DIK A;  4C1G A;  4EXS A;  3MD7 A;  1DXK A;  3IEL A;  1ZNB A;  2BG6 A;  3RKK A;  3A4Y A;  2DKF A;  2CG2 A;  4AX1 B;  4PVT A;  5ACQ A;  2NYP A;  5HIQ A;  2CFU A;  3KNS A;  3SBL A;  5AYA A;  1SML A;  1XTO A;  4KEQ A;  4ZO3 A;  2ZWR A;  2FHX B;  4EYL A;  4ZEJ A;  2Q42 A;  4TZE A;  1XM8 A;  2UYX A;  3DHB A;  2YNV A;  4HL2 A;  3F9O A;  4BZ3 A;  1YCH A;  4HKY A;  2GFJ A;  3T3O A;  1VGN A;  5KIK A;  4Z6X A;  3P2U A;  3ADR A;  4UWP B;  2QJS A;  4FR7 A;  4DIL A;  4RAM A;  2OHI A;  3VQZ A;  4EXY A;  5HH4 A;  2Q0I A;  5ACT A;  1X8I A;  4GYQ A;  4O98 A;  1ZKP A;  4NUR A;  2OHJ A;  4J5H A;  3X2X A;  2Q0J A;  1WUP A;  2AZ4 A;  4KEP A;  4NQ2 A;  3QH8 A;  3BK2 A;  1E5D A;  5LSC A;  4D02 A;  3KNR A;  3IDZ A;  2XR1 A;  5EHT A;  5EW0 A;  4D1W A;  4RL2 A;  2I7T A;  4Z60 A;  4RM5 A;  4Z67 A;  4FSB A;  4TZB A;  3VPE A;  3X30 A;  1DD6 A;  5LLD A;  5ACX A;  1X8H A;  4CHL A;  3ZWF A;  2FHX A;  3SFP A;  4XWW A;  4AWZ A;  3IOG A;  4UAM A;  5LS3 A;  2YNT B;  4BP0 A;  4D1V A;  1KO2 A;  4EFZ A;  1KR3 A;  4UA4 A;  1K07 A;  2Q9U A;  4D1U A;  2XF4 A;  2BFK A;  1QH5 A;  4F6Z A;  3PY5 A;  2YNW A;  4UWS B;  2BFL A;  3DH8 A;  5DPX A;  5EH9 A;  5HIS A;  4TZ9 A;  4C1F A;  1L9Y A;  4C1C A;  4RAW A;  1JJT A;  4JO0 A;  2YCB A;  5AIJ A;  5ACV A;  3DHA A;  4PVO A;  1ZTC A;  5B1U A;  2NZE A;  2CFZ A;  1Y44 A;  2GCU A;  4C1E A;  2I7X A;  3JXP A;  4UBQ A;  5EVK A;  5K0W A;  2BG7 A;  3BV6 A;  5AXR A;  2QED A;  2E7Y A;  4YSK A;  2H6A A;  5HH5 A;  5B3R A;  2BG8 B;  2DOO A;  2QIN A;  5A0V A;  2FM6 A;  1BMC A;  4Z5Y A;  4C1H A;  3I0V A;  4UWR B;  3H3E A;  5A23 A;  2P1E A;  2BFZ A;  2BC2 A;  2CBN A;  3T3N A;  5A87 A;  3ZNB A;  2BG2 A;  5ACS A;  4AWY B;  3S0Z A;  4ZNB A;  2WYM C;  2P97 A;  2BTN A;  2BGA A;  3ZQ4 A;  5HH6 A;  5K4K A;  3TP9 A;  1P9E A;  3Q6V A;  2AIO A;  4F6H A;  2YNT A;  2WRS A;  5ACW A;  3L6N A;  3I11 A;  2BFZ B;  3X2Z A;  5A0T A;  2GFK A;  4EYB A;  3X2Y A;  3RKJ A;  2HB9 A; 
#chains in the Genus database with same CATH homology
 3G1P A;  5AXO A;  2GMN A;  2FU9 A;  3I15 A;  5B15 A;  3ZR9 A;  4EYF A;  1YCG A;  3AF5 A;  4P62 A;  3FCZ A;  3WXC A;  2OHH A;  5HIO A;  4RL0 A;  2WYM A;  3PG4 A;  4GCW A;  4RBS A;  4XUK A;  1X8G A;  1BC2 A;  1MQO A;  2YZ3 A;  5IQK A;  1VME A;  1WRA A;  3IEK A;  5A5Z A;  1JJE A;  2Y8A A;  3DHC A;  5EVD A;  2BG8 A;  1M2X A;  5KIL A;  3IE2 A;  2Y87 A;  3RPC A;  3SD9 A;  1A8T A;  1A7T A;  2BR6 A;  4TYT A;  2BIB A;  3KL7 A;  4D1T A;  3IEM A;  3T9M A;  2A7M A;  5LCA A;  4NQ4 A;  3R2U A;  1HLK A;  5LCH A;  1VJN A;  3IE0 A;  3SW3 A;  2I7V A;  4TZF A;  4UWO B;  2VW8 A;  2WYL A;  4C1D A;  4EY2 A;  4AX0 B;  5ACR A;  1WW1 A;  1QH3 A;  2FU8 A;  3AJ3 A;  5LMC A;  4U4L A;  2BMI A;  4ZO2 A;  3AF6 A;  2FU6 A;  4H0D A;  2P4Z A;  5HIP A;  5K4N A;  1JT1 A;  4J5F A;  2P18 A;  4TYF A;  3IOF A;  2FU7 A;  5AHR A;  4Z7R A;  2QDT A;  2YNV B;  4YSB A;  2GKL A;  3ESH A;  4HL1 A;  4WD6 A;  4Z5Z A;  5FQB A;  4AD9 A;  3I14 A;  3SPU A;  4NQ5 A;  4NQ6 A;  5AHO A;  1WUO A;  3PY6 A;  1YCF A;  3LVZ A;  5EVB A;  5EV8 A;  5AEB A;  3IE1 A;  2FK6 A;  3BK1 A;  5LM6 A;  5FQA A;  4C09 A;  4V0H A;  4YSL A;  2YNU A;  4FEK A;  3BC2 A;  5EV6 A;  2M5C A;  5LCF A;  2R2D A;  5K4M A;  5LE1 A;  4GYU A;  1DDK A;  3I13 A;  4LE6 A;  4B87 A;  2M5D A;  5ACP A;  5EWA A;  2ZO4 A;  2Y8B A;  2NZF A;  3FAI A;  5ACU A;  3SRX A;  5FQC A;  1BVT A;  2QDS A;  2ZNB A;  1KO3 A;  2ZZI A;  2WHG A;  4XWT A;  2NXA A;  4DIK A;  4C1G A;  4EXS A;  3MD7 A;  1DXK A;  3IEL A;  1ZNB A;  2BG6 A;  3RKK A;  3A4Y A;  2DKF A;  4AX1 B;  4PVT A;  5ACQ A;  2NYP A;  5HIQ A;  3KNS A;  3SBL A;  5AYA A;  1SML A;  1XTO A;  4KEQ A;  4ZO3 A;  2ZWR A;  2FHX B;  4EYL A;  4ZEJ A;  2Q42 A;  4TZE A;  1XM8 A;  2UYX A;  3DHB A;  2YNV A;  4HL2 A;  3F9O A;  4BZ3 A;  1YCH A;  4HKY A;  2GFJ A;  3T3O A;  1VGN A;  5KIK A;  4Z6X A;  3P2U A;  3ADR A;  4UWP B;  2QJS A;  4FR7 A;  4DIL A;  4RAM A;  2OHI A;  3VQZ A;  4EXY A;  5HH4 A;  2Q0I A;  5ACT A;  1X8I A;  4GYQ A;  4O98 A;  1ZKP A;  2OHJ A;  4J5H A;  3X2X A;  2Q0J A;  1WUP A;  2AZ4 A;  4KEP A;  4NQ2 A;  3QH8 A;  3BK2 A;  1E5D A;  5LSC A;  4D02 A;  3KNR A;  3IDZ A;  2XR1 A;  5EHT A;  5EW0 A;  4D1W A;  4RL2 A;  2I7T A;  4Z60 A;  4RM5 A;  4Z67 A;  4FSB A;  4TZB A;  3VPE A;  3X30 A;  1DD6 A;  5LLD A;  5ACX A;  1X8H A;  4CHL A;  3ZWF A;  2FHX A;  3SFP A;  4XWW A;  4AWZ A;  3IOG A;  4UAM A;  5LS3 A;  2YNT B;  4BP0 A;  4D1V A;  1KO2 A;  4EFZ A;  1KR3 A;  4UA4 A;  1K07 A;  2Q9U A;  4D1U A;  2XF4 A;  2BFK A;  1QH5 A;  4F6Z A;  3PY5 A;  2YNW A;  4UWS B;  2BFL A;  3DH8 A;  5DPX A;  5EH9 A;  5HIS A;  4TZ9 A;  4C1F A;  1L9Y A;  4C1C A;  4RAW A;  1JJT A;  4JO0 A;  2YCB A;  5ACV A;  3DHA A;  4PVO A;  1ZTC A;  5B1U A;  2NZE A;  1Y44 A;  2GCU A;  4C1E A;  2I7X A;  3JXP A;  4UBQ A;  5EVK A;  5K0W A;  2BG7 A;  3BV6 A;  5AXR A;  2QED A;  2E7Y A;  4YSK A;  2H6A A;  5HH5 A;  5B3R A;  2BG8 B;  2DOO A;  2QIN A;  5A0V A;  2FM6 A;  1BMC A;  4Z5Y A;  4C1H A;  3I0V A;  4UWR B;  3H3E A;  2P1E A;  2BFZ A;  2BC2 A;  2CBN A;  3T3N A;  5A87 A;  3ZNB A;  2BG2 A;  5ACS A;  4AWY B;  3S0Z A;  4ZNB A;  2WYM C;  2P97 A;  2BTN A;  2BGA A;  3ZQ4 A;  5HH6 A;  5K4K A;  3TP9 A;  1P9E A;  3Q6V A;  2AIO A;  4F6H A;  2YNT A;  2WRS A;  5ACW A;  3L6N A;  3I11 A;  2BFZ B;  3X2Z A;  5A0T A;  2GFK A;  4EYB A;  3X2Y A;  3RKJ A;  2HB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...