5LS3A

Crystal structure of metallo-beta-lactamase spm-1 with y58c mutation
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
245
structure length
239
Chain Sequence
DHVDLPYNLTATKIDSDVFVVTDRDFCSSNVLVAKMLDGTVVIVSSPFENLGTQTLMDWVAKTMKPKKVVAINTHFHLDGTGGNEIYKKMGAETWSSDLTKQLRLEENKKDFYKNEDLKRRILSSHPVPADNVFDLKQGKVFSFSNELVEVSFPGPAHSPDNVVVYFPKKKLLFGGCMIKPKELGYLGDANVKAWPDSARRLKKFDAKIVIPGHGEWGGPEMVNKTIKVAEKAVGEMRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title (19) F-NMR Reveals the Role of Mobile Loops in Product and Inhibitor Binding by the Sao Paulo Metallo-beta-Lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
total genus 80
structure length 239
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2016-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ls3A00
2YNVB 5DPXA 5ACXA 3DHCA 3BC2A 1SMLA 3X2ZA 5AYAA 2BFZB 4Z6XA 4D1UA 2H6AA 2Y8BA 1VGNA 5EWAA 2GFKA 3T3OA 4EY2A 3AF5A 4FEKA 3SFPA 2FHXA 5ACTA 4YSBA 3ZQ4A 3FCZA 2YNVA 1BC2A 1KO3A 2BG7A 3X2XA 2WYLA 4H0DA 1QH5A 5HIQA 2VW8A 4BZ3A 4Z7RA 3X30A 5KILA 3ZNBA 3BV6A 1A7TA 2BG2A 2BMIA 2ZWRA 4UWPB 1X8HA 1BVTA 3R2UA 3IE0A 1XM8A 1VMEA 3F9OA 3WXCA 5LM6A 4ZO2A 2BIBA 2R2DA 1JJTA 3AJ3A 1WUPA 5AEBA 5ACUA 5ACWA 5LMCA 3DHAA 1P9EA 5B3RA 3SBLA 5FQCA 5HH6A 2QJSA 5A0TA 3BK2A 2XR1A 3H3EA 4O98A 3IDZA 4TZ9A 4C1FA 2BG8A 3JXPA 4C1DA 1Y44A 3DHBA 2Y8AA 4AX1B 4Z5ZA 2I7TA 1VJNA 2BFZA 4UWOB 4Z60A 2BG6A 5LCAA 4XWWA 2DOOA 1JJEA 2FU7A 4V0HA 4D1TA 4GYQA 2Q42A 5B1UA 2NZFA 4F6HA 3I14A 1KO2A 5EV6A 3G1PA 4AWZA 4C1HA 3AF6A 4F6ZA 5IQKA 1HLKA 3PY5A 4UWRB 4TZEA 4TYFA 3IELA 4ZEJA 5EH9A 4NQ2A 2XF4A 2ZO4A 4BP0A 2UYXA 1DXKA 5K4KA 1KR3A 3SD9A 1ZKPA 3FAIA 2CBNA 3IE2A 2FK6A 4NQ6A 3Q6VA 3KNSA 1K07A 5EVBA 4EXYA 4UA4A 2Q9UA 2FU9A 4TZFA 3PG4A 2YNWA 4RBSA 4UAMA 5ACVA 4ZNBA 1E5DA 4YSKA 2AZ4A 2BGAA 4PVTA 3T3NA 5HH5A 4TYTA 1A8TA 3PY6A 2Q0IA 3DH8A 4HL2A 4RL2A 1WUOA 3A4YA 3I15A 5ACSA 2NXAA 1JT1A 5EHTA 5FQAA 3SRXA 4C09A 4B87A 3VPEA 2BG8B 4NQ5A 2Q0JA 3RKJA 2Y87A 2QDSA 4D1VA 4DILA 2P97A 2P18A 2FHXB 5FQBA 2I7VA 4C1GA 4U4LA 2I7XA 5A0VA 1YCFA 4RM5A 5HIPA 4XWTA 4P62A 3IOFA 4AX0B 4UBQA 4Z67A 4UWSB 4AWYB 2NZEA 4GYUA 4C1CA 2ZNBA 3L6NA 4WD6A 2YCBA 5EV8A 4J5HA 2BR6A 2NYPA 4RAWA 4EYLA 3I11A 5EVDA 4D1WA 2WYMA 1XTOA 2DKFA 2WYMC 4GCWA 2YNUA 2YNTA 4EYFA 4NQ4A 2M5CA 3RKKA 1X8GA 4C1EA 2ZZIA 3I0VA 3S0ZA 4EFZA 4TZBA 3IEMA 1DD6A 2E7YA 4FSBA 4D02A 5HIOA 5EW0A 5HISA 2HB9A 2GKLA 4FR7A 4HL1A 1WW1A 2FM6A 3LVZA 5LSCA 5K4MA 5HH4A 5LE1A 1ZNBA 2BFKA 3IEKA 3RPCA 4ZO3A 1MQOA 4RL0A 4EYBA 5EVKA 4LE6A 1ZTCA 3ESHA 3X2YA 5B15A 1QH3A 4HKYA 5KIKA 3KNRA 2A7MA 5K0WA 3TP9A 3IOGA 3SW3A 2P1EA 2GCUA 2BTNA 3ADRA 4CHLA 5A5ZA 4KEQA 5AXRA 1YCHA 1M2XA 2QINA 2AIOA 2YNTB 5AHRA 5AHOA 4XUKA 2WRSA 2YZ3A 4YSLA 4KEPA 2BC2A 2QDTA 3P2UA 3ZWFA 4PVOA 2BFLA 5AXOA 2WHGA 2OHHA 3T9MA 3QH8A 3MD7A 1L9YA 3ZR9A 2OHIA 1DDKA 2QEDA 5LCHA 5LCFA 4AD9A 2FU6A 2M5DA 5ACRA 2GFJA 2OHJA 5A87A 2FU8A 4JO0A 3SPUA 5ACPA 3IE1A 3KL7A 2P4ZA 1BMCA 3BK1A 2GMNA 3VQZA 4DIKA 4RAMA 1X8IA 1YCGA 1WRAA 4Z5YA 5LS3A 4EXSA 5LLDA 5K4NA 3I13A 5ACQA 4J5FA
chains in the Genus database with same CATH superfamily
2YNVB 5A23A 5DPXA 5ACXA 3DHCA 3BC2A 1SMLA 3X2ZA 5AYAA 2BFZB 4Z6XA 4D1UA 2H6AA 2Y8BA 1VGNA 5EWAA 2GFKA 3T3OA 4EY2A 3AF5A 4FEKA 3SFPA 2FHXA 5ACTA 4YSBA 3ZQ4A 3FCZA 2YNVA 1BC2A 1KO3A 2BG7A 3X2XA 2WYLA 4H0DA 1QH5A 5HIQA 2VW8A 4BZ3A 4Z7RA 3X30A 3ZNBA 5KILA 3BV6A 1A7TA 2BG2A 2BMIA 2ZWRA 4UWPB 1X8HA 1BVTA 3R2UA 3IE0A 1XM8A 1VMEA 3F9OA 3WXCA 5LM6A 4ZO2A 2BIBA 2R2DA 5AIJA 1JJTA 3AJ3A 1WUPA 5AEBA 5ACUA 5ACWA 5LMCA 3DHAA 1P9EA 5B3RA 3SBLA 5FQCA 5HH6A 2QJSA 5A0TA 3BK2A 2XR1A 3H3EA 4O98A 2CFUA 3IDZA 4TZ9A 4C1FA 2BG8A 3JXPA 4C1DA 1Y44A 3DHBA 2Y8AA 4AX1B 4Z5ZA 2I7TA 1VJNA 2BFZA 4UWOB 4Z60A 2BG6A 5LCAA 4XWWA 2DOOA 1JJEA 2FU7A 4V0HA 4D1TA 4GYQA 2Q42A 5B1UA 2NZFA 4F6HA 3I14A 1KO2A 5EV6A 3G1PA 4AWZA 4C1HA 3AF6A 4F6ZA 5IQKA 1HLKA 3PY5A 4UWRB 4TZEA 4TYFA 3IELA 4ZEJA 5EH9A 4NQ2A 2XF4A 2ZO4A 4BP0A 2UYXA 1DXKA 5K4KA 1KR3A 3SD9A 1ZKPA 3FAIA 2CBNA 3IE2A 2FK6A 4NQ6A 3Q6VA 3KNSA 1K07A 5EVBA 4EXYA 4UA4A 2Q9UA 2FU9A 4TZFA 3PG4A 2YNWA 4RBSA 4UAMA 5ACVA 4ZNBA 1E5DA 4YSKA 2AZ4A 2BGAA 4PVTA 3T3NA 5HH5A 4TYTA 1A8TA 3PY6A 2Q0IA 3DH8A 2CG3A 4HL2A 4RL2A 1WUOA 3A4YA 3I15A 5ACSA 2NXAA 1JT1A 5EHTA 5FQAA 3SRXA 4C09A 4B87A 3VPEA 2BG8B 4NQ5A 2Q0JA 3RKJA 2Y87A 2QDSA 4D1VA 4DILA 4NURA 2P97A 2P18A 2FHXB 5FQBA 2I7VA 4C1GA 4U4LA 2I7XA 5A0VA 4AXHA 1YCFA 4RM5A 5HIPA 4XWTA 4P62A 2CG2A 3IOFA 4AX0B 4UBQA 4Z67A 4UWSB 4AWYB 2NZEA 4GYUA 4C1CA 2ZNBA 3L6NA 4WD6A 2YCBA 5EV8A 4J5HA 2BR6A 2NYPA 4RAWA 4EYLA 3I11A 5EVDA 4D1WA 2WYMA 1XTOA 2DKFA 2WYMC 4GCWA 2YNUA 2YNTA 4EYFA 4NQ4A 2M5CA 3RKKA 1X8GA 2YHEA 4C1EA 2ZZIA 3I0VA 3S0ZA 4EFZA 4TZBA 3IEMA 1DD6A 2E7YA 4FSBA 4D02A 5HIOA 5EW0A 5HISA 2HB9A 2GKLA 4FR7A 4HL1A 1WW1A 2FM6A 3LVZA 5LSCA 5K4MA 5HH4A 5LE1A 1ZNBA 2BFKA 3IEKA 3RPCA 4ZO3A 1MQOA 4RL0A 4EYBA 5EVKA 4LE6A 1ZTCA 3ESHA 3X2YA 5B15A 1QH3A 4HKYA 5KIKA 3KNRA 2A7MA 5K0WA 3TP9A 3IOGA 3SW3A 2P1EA 2GCUA 2BTNA 3ADRA 4CHLA 5A5ZA 4KEQA 5AXRA 1YCHA 1M2XA 2QINA 2AIOA 2YNTB 5AHRA 5AHOA 4XUKA 2WRSA 2YZ3A 4PDXA 4YSLA 4KEPA 2BC2A 2QDTA 3P2UA 3ZWFA 4PVOA 2BFLA 5AXOA 2WHGA 2OHHA 3T9MA 3QH8A 3MD7A 1L9YA 3ZR9A 2OHIA 1DDKA 2QEDA 5LCHA 5LCFA 2CFZA 4AD9A 2FU6A 2M5DA 5ACRA 2GFJA 2OHJA 5A87A 2FU8A 4JO0A 3SPUA 5ACPA 3IE1A 3KL7A 2P4ZA 1BMCA 3BK1A 5AJLA 2GMNA 3VQZA 4DIKA 4RAMA 1X8IA 1YCGA 1WRAA 4Z5YA 4EXSA 4AV7A 5LS3A 5LLDA 5K4NA 3I13A 5ACQA 4J5FA
chains in the Genus database with same CATH topology
2YNVB 5DPXA 5ACXA 3DHCA 3BC2A 1SMLA 3X2ZA 5AYAA 2BFZB 4Z6XA 4D1UA 2H6AA 2Y8BA 1VGNA 5EWAA 2GFKA 3T3OA 4EY2A 3AF5A 4FEKA 3SFPA 2FHXA 5ACTA 4YSBA 3ZQ4A 3FCZA 2YNVA 1BC2A 1KO3A 2BG7A 3X2XA 2WYLA 4H0DA 1QH5A 5HIQA 2VW8A 4BZ3A 4Z7RA 3X30A 5KILA 3ZNBA 3BV6A 1A7TA 2BG2A 2BMIA 2ZWRA 4UWPB 1X8HA 1BVTA 3R2UA 3IE0A 1XM8A 1VMEA 3F9OA 3WXCA 5LM6A 4ZO2A 2BIBA 2R2DA 1JJTA 3AJ3A 1WUPA 5AEBA 5ACUA 5ACWA 5LMCA 3DHAA 1P9EA 5B3RA 3SBLA 5FQCA 5HH6A 2QJSA 5A0TA 3BK2A 2XR1A 3H3EA 4O98A 3IDZA 4TZ9A 4C1FA 2BG8A 3JXPA 4C1DA 1Y44A 3DHBA 2Y8AA 4AX1B 4Z5ZA 2I7TA 1VJNA 2BFZA 4UWOB 4Z60A 2BG6A 5LCAA 4XWWA 2DOOA 1JJEA 2FU7A 4V0HA 4D1TA 4GYQA 2Q42A 5B1UA 2NZFA 4F6HA 3I14A 1KO2A 5EV6A 3G1PA 4AWZA 4C1HA 3AF6A 4F6ZA 5IQKA 1HLKA 3PY5A 4UWRB 4TZEA 4TYFA 3IELA 4ZEJA 5EH9A 4NQ2A 2XF4A 2ZO4A 4BP0A 2UYXA 1DXKA 5K4KA 1KR3A 3SD9A 1ZKPA 3FAIA 2CBNA 3IE2A 2FK6A 4NQ6A 3Q6VA 3KNSA 1K07A 5EVBA 4EXYA 4UA4A 2Q9UA 2FU9A 4TZFA 3PG4A 2YNWA 4RBSA 4UAMA 5ACVA 4ZNBA 1E5DA 4YSKA 2AZ4A 2BGAA 4PVTA 3T3NA 5HH5A 4TYTA 1A8TA 3PY6A 2Q0IA 3DH8A 4HL2A 4RL2A 1WUOA 3A4YA 3I15A 5ACSA 2NXAA 1JT1A 5EHTA 5FQAA 3SRXA 4C09A 4B87A 3VPEA 2BG8B 4NQ5A 2Q0JA 3RKJA 2Y87A 2QDSA 4D1VA 4DILA 2P97A 2P18A 2FHXB 5FQBA 2I7VA 4C1GA 4U4LA 2I7XA 5A0VA 1YCFA 4RM5A 5HIPA 4XWTA 4P62A 3IOFA 4AX0B 4UBQA 4Z67A 4UWSB 4AWYB 2NZEA 4GYUA 4C1CA 2ZNBA 3L6NA 4WD6A 2YCBA 5EV8A 4J5HA 2BR6A 2NYPA 4RAWA 4EYLA 3I11A 5EVDA 4D1WA 2WYMA 1XTOA 2DKFA 2WYMC 4GCWA 2YNUA 2YNTA 4EYFA 4NQ4A 2M5CA 3RKKA 1X8GA 4C1EA 2ZZIA 3I0VA 3S0ZA 4EFZA 4TZBA 3IEMA 1DD6A 2E7YA 4FSBA 4D02A 5HIOA 5EW0A 5HISA 2HB9A 2GKLA 4FR7A 4HL1A 1WW1A 2FM6A 3LVZA 5LSCA 5K4MA 5HH4A 5LE1A 1ZNBA 2BFKA 3IEKA 3RPCA 4ZO3A 1MQOA 4RL0A 4EYBA 5EVKA 4LE6A 1ZTCA 3ESHA 3X2YA 5B15A 1QH3A 4HKYA 5KIKA 3KNRA 2A7MA 5K0WA 3TP9A 3IOGA 3SW3A 2P1EA 2GCUA 2BTNA 3ADRA 4CHLA 5A5ZA 4KEQA 5AXRA 1YCHA 1M2XA 2QINA 2AIOA 2YNTB 5AHRA 5AHOA 4XUKA 2WRSA 2YZ3A 4YSLA 4KEPA 2BC2A 2QDTA 3P2UA 3ZWFA 4PVOA 2BFLA 5AXOA 2WHGA 2OHHA 3T9MA 3QH8A 3MD7A 1L9YA 3ZR9A 2OHIA 1DDKA 2QEDA 5LCHA 5LCFA 4AD9A 2FU6A 2M5DA 5ACRA 2GFJA 2OHJA 5A87A 2FU8A 4JO0A 3SPUA 5ACPA 3IE1A 3KL7A 2P4ZA 1BMCA 3BK1A 2GMNA 3VQZA 4DIKA 4RAMA 1X8IA 1YCGA 1WRAA 4Z5YA 5LS3A 4EXSA 5LLDA 5K4NA 3I13A 5ACQA 4J5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNV B;  5DPX A;  5ACX A;  3DHC A;  3BC2 A;  1SML A;  3X2Z A;  5AYA A;  2BFZ B;  4Z6X A;  4D1U A;  2H6A A;  2Y8B A;  1VGN A;  5EWA A;  2GFK A;  3T3O A;  4EY2 A;  3AF5 A;  4FEK A;  3SFP A;  2FHX A;  5ACT A;  4YSB A;  3ZQ4 A;  3FCZ A;  2YNV A;  1BC2 A;  1KO3 A;  2BG7 A;  3X2X A;  2WYL A;  4H0D A;  1QH5 A;  5HIQ A;  2VW8 A;  4BZ3 A;  4Z7R A;  3X30 A;  5KIL A;  3ZNB A;  3BV6 A;  1A7T A;  2BG2 A;  2BMI A;  2ZWR A;  4UWP B;  1X8H A;  1BVT A;  3R2U A;  3IE0 A;  1XM8 A;  1VME A;  3F9O A;  3WXC A;  5LM6 A;  4ZO2 A;  2BIB A;  2R2D A;  1JJT A;  3AJ3 A;  1WUP A;  5AEB A;  5ACU A;  5ACW A;  5LMC A;  3DHA A;  1P9E A;  5B3R A;  3SBL A;  5FQC A;  5HH6 A;  2QJS A;  5A0T A;  3BK2 A;  2XR1 A;  3H3E A;  4O98 A;  3IDZ A;  4TZ9 A;  4C1F A;  2BG8 A;  3JXP A;  4C1D A;  1Y44 A;  3DHB A;  2Y8A A;  4AX1 B;  4Z5Z A;  2I7T A;  1VJN A;  2BFZ A;  4UWO B;  4Z60 A;  2BG6 A;  5LCA A;  4XWW A;  2DOO A;  1JJE A;  2FU7 A;  4V0H A;  4D1T A;  4GYQ A;  2Q42 A;  5B1U A;  2NZF A;  4F6H A;  3I14 A;  1KO2 A;  5EV6 A;  3G1P A;  4AWZ A;  4C1H A;  3AF6 A;  4F6Z A;  5IQK A;  1HLK A;  3PY5 A;  4UWR B;  4TZE A;  4TYF A;  3IEL A;  4ZEJ A;  5EH9 A;  4NQ2 A;  2XF4 A;  2ZO4 A;  4BP0 A;  2UYX A;  1DXK A;  5K4K A;  1KR3 A;  3SD9 A;  1ZKP A;  3FAI A;  2CBN A;  3IE2 A;  2FK6 A;  4NQ6 A;  3Q6V A;  3KNS A;  1K07 A;  5EVB A;  4EXY A;  4UA4 A;  2Q9U A;  2FU9 A;  4TZF A;  3PG4 A;  2YNW A;  4RBS A;  4UAM A;  5ACV A;  4ZNB A;  1E5D A;  4YSK A;  2AZ4 A;  2BGA A;  4PVT A;  3T3N A;  5HH5 A;  4TYT A;  1A8T A;  3PY6 A;  2Q0I A;  3DH8 A;  4HL2 A;  4RL2 A;  1WUO A;  3A4Y A;  3I15 A;  5ACS A;  2NXA A;  1JT1 A;  5EHT A;  5FQA A;  3SRX A;  4C09 A;  4B87 A;  3VPE A;  2BG8 B;  4NQ5 A;  2Q0J A;  3RKJ A;  2Y87 A;  2QDS A;  4D1V A;  4DIL A;  2P97 A;  2P18 A;  2FHX B;  5FQB A;  2I7V A;  4C1G A;  4U4L A;  2I7X A;  5A0V A;  1YCF A;  4RM5 A;  5HIP A;  4XWT A;  4P62 A;  3IOF A;  4AX0 B;  4UBQ A;  4Z67 A;  4UWS B;  4AWY B;  2NZE A;  4GYU A;  4C1C A;  2ZNB A;  3L6N A;  4WD6 A;  2YCB A;  5EV8 A;  4J5H A;  2BR6 A;  2NYP A;  4RAW A;  4EYL A;  3I11 A;  5EVD A;  4D1W A;  2WYM A;  1XTO A;  2DKF A;  2WYM C;  4GCW A;  2YNU A;  2YNT A;  4EYF A;  4NQ4 A;  2M5C A;  3RKK A;  1X8G A;  4C1E A;  2ZZI A;  3I0V A;  3S0Z A;  4EFZ A;  4TZB A;  3IEM A;  1DD6 A;  2E7Y A;  4FSB A;  4D02 A;  5HIO A;  5EW0 A;  5HIS A;  2HB9 A;  2GKL A;  4FR7 A;  4HL1 A;  1WW1 A;  2FM6 A;  3LVZ A;  5LSC A;  5K4M A;  5HH4 A;  5LE1 A;  1ZNB A;  2BFK A;  3IEK A;  3RPC A;  4ZO3 A;  1MQO A;  4RL0 A;  4EYB A;  5EVK A;  4LE6 A;  1ZTC A;  3ESH A;  3X2Y A;  5B15 A;  1QH3 A;  4HKY A;  5KIK A;  3KNR A;  2A7M A;  5K0W A;  3TP9 A;  3IOG A;  3SW3 A;  2P1E A;  2GCU A;  2BTN A;  3ADR A;  4CHL A;  5A5Z A;  4KEQ A;  5AXR A;  1YCH A;  1M2X A;  2QIN A;  2AIO A;  2YNT B;  5AHR A;  5AHO A;  4XUK A;  2WRS A;  2YZ3 A;  4YSL A;  4KEP A;  2BC2 A;  2QDT A;  3P2U A;  3ZWF A;  4PVO A;  2BFL A;  5AXO A;  2WHG A;  2OHH A;  3T9M A;  3QH8 A;  3MD7 A;  1L9Y A;  3ZR9 A;  2OHI A;  1DDK A;  2QED A;  5LCH A;  5LCF A;  4AD9 A;  2FU6 A;  2M5D A;  5ACR A;  2GFJ A;  2OHJ A;  5A87 A;  2FU8 A;  4JO0 A;  3SPU A;  5ACP A;  3IE1 A;  3KL7 A;  2P4Z A;  1BMC A;  3BK1 A;  2GMN A;  3VQZ A;  4DIK A;  4RAM A;  1X8I A;  1YCG A;  1WRA A;  4Z5Y A;  5LS3 A;  4EXS A;  5LLD A;  5K4N A;  3I13 A;  5ACQ A;  4J5F A; 
#chains in the Genus database with same CATH topology
 2YNV B;  5A23 A;  5DPX A;  5ACX A;  3DHC A;  3BC2 A;  1SML A;  3X2Z A;  5AYA A;  2BFZ B;  4Z6X A;  4D1U A;  2H6A A;  2Y8B A;  1VGN A;  5EWA A;  2GFK A;  3T3O A;  4EY2 A;  3AF5 A;  4FEK A;  3SFP A;  2FHX A;  5ACT A;  4YSB A;  3ZQ4 A;  3FCZ A;  2YNV A;  1BC2 A;  1KO3 A;  2BG7 A;  3X2X A;  2WYL A;  4H0D A;  1QH5 A;  5HIQ A;  2VW8 A;  4BZ3 A;  4Z7R A;  3X30 A;  3ZNB A;  5KIL A;  3BV6 A;  1A7T A;  2BG2 A;  2BMI A;  2ZWR A;  4UWP B;  1X8H A;  1BVT A;  3R2U A;  3IE0 A;  1XM8 A;  1VME A;  3F9O A;  3WXC A;  5LM6 A;  4ZO2 A;  2BIB A;  2R2D A;  5AIJ A;  1JJT A;  3AJ3 A;  1WUP A;  5AEB A;  5ACU A;  5ACW A;  5LMC A;  3DHA A;  1P9E A;  5B3R A;  3SBL A;  5FQC A;  5HH6 A;  2QJS A;  5A0T A;  3BK2 A;  2XR1 A;  3H3E A;  4O98 A;  2CFU A;  3IDZ A;  4TZ9 A;  4C1F A;  2BG8 A;  3JXP A;  4C1D A;  1Y44 A;  3DHB A;  2Y8A A;  4AX1 B;  4Z5Z A;  2I7T A;  1VJN A;  2BFZ A;  4UWO B;  4Z60 A;  2BG6 A;  5LCA A;  4XWW A;  2DOO A;  1JJE A;  2FU7 A;  4V0H A;  4D1T A;  4GYQ A;  2Q42 A;  5B1U A;  2NZF A;  4F6H A;  3I14 A;  1KO2 A;  5EV6 A;  3G1P A;  4AWZ A;  4C1H A;  3AF6 A;  4F6Z A;  5IQK A;  1HLK A;  3PY5 A;  4UWR B;  4TZE A;  4TYF A;  3IEL A;  4ZEJ A;  5EH9 A;  4NQ2 A;  2XF4 A;  2ZO4 A;  4BP0 A;  2UYX A;  1DXK A;  5K4K A;  1KR3 A;  3SD9 A;  1ZKP A;  3FAI A;  2CBN A;  3IE2 A;  2FK6 A;  4NQ6 A;  3Q6V A;  3KNS A;  1K07 A;  5EVB A;  4EXY A;  4UA4 A;  2Q9U A;  2FU9 A;  4TZF A;  3PG4 A;  2YNW A;  4RBS A;  4UAM A;  5ACV A;  4ZNB A;  1E5D A;  4YSK A;  2AZ4 A;  2BGA A;  4PVT A;  3T3N A;  5HH5 A;  4TYT A;  1A8T A;  3PY6 A;  2Q0I A;  3DH8 A;  2CG3 A;  4HL2 A;  4RL2 A;  1WUO A;  3A4Y A;  3I15 A;  5ACS A;  2NXA A;  1JT1 A;  5EHT A;  5FQA A;  3SRX A;  4C09 A;  4B87 A;  3VPE A;  2BG8 B;  4NQ5 A;  2Q0J A;  3RKJ A;  2Y87 A;  2QDS A;  4D1V A;  4DIL A;  4NUR A;  2P97 A;  2P18 A;  2FHX B;  5FQB A;  2I7V A;  4C1G A;  4U4L A;  2I7X A;  5A0V A;  4AXH A;  1YCF A;  4RM5 A;  5HIP A;  4XWT A;  4P62 A;  2CG2 A;  3IOF A;  4AX0 B;  4UBQ A;  4Z67 A;  4UWS B;  4AWY B;  2NZE A;  4GYU A;  4C1C A;  2ZNB A;  3L6N A;  4WD6 A;  2YCB A;  5EV8 A;  4J5H A;  2BR6 A;  2NYP A;  4RAW A;  4EYL A;  3I11 A;  5EVD A;  4D1W A;  2WYM A;  1XTO A;  2DKF A;  2WYM C;  4GCW A;  2YNU A;  2YNT A;  4EYF A;  4NQ4 A;  2M5C A;  3RKK A;  1X8G A;  2YHE A;  4C1E A;  2ZZI A;  3I0V A;  3S0Z A;  4EFZ A;  4TZB A;  3IEM A;  1DD6 A;  2E7Y A;  4FSB A;  4D02 A;  5HIO A;  5EW0 A;  5HIS A;  2HB9 A;  2GKL A;  4FR7 A;  4HL1 A;  1WW1 A;  2FM6 A;  3LVZ A;  5LSC A;  5K4M A;  5HH4 A;  5LE1 A;  1ZNB A;  2BFK A;  3IEK A;  3RPC A;  4ZO3 A;  1MQO A;  4RL0 A;  4EYB A;  5EVK A;  4LE6 A;  1ZTC A;  3ESH A;  3X2Y A;  5B15 A;  1QH3 A;  4HKY A;  5KIK A;  3KNR A;  2A7M A;  5K0W A;  3TP9 A;  3IOG A;  3SW3 A;  2P1E A;  2GCU A;  2BTN A;  3ADR A;  4CHL A;  5A5Z A;  4KEQ A;  5AXR A;  1YCH A;  1M2X A;  2QIN A;  2AIO A;  2YNT B;  5AHR A;  5AHO A;  4XUK A;  2WRS A;  2YZ3 A;  4PDX A;  4YSL A;  4KEP A;  2BC2 A;  2QDT A;  3P2U A;  3ZWF A;  4PVO A;  2BFL A;  5AXO A;  2WHG A;  2OHH A;  3T9M A;  3QH8 A;  3MD7 A;  1L9Y A;  3ZR9 A;  2OHI A;  1DDK A;  2QED A;  5LCH A;  5LCF A;  2CFZ A;  4AD9 A;  2FU6 A;  2M5D A;  5ACR A;  2GFJ A;  2OHJ A;  5A87 A;  2FU8 A;  4JO0 A;  3SPU A;  5ACP A;  3IE1 A;  3KL7 A;  2P4Z A;  1BMC A;  3BK1 A;  5AJL A;  2GMN A;  3VQZ A;  4DIK A;  4RAM A;  1X8I A;  1YCG A;  1WRA A;  4Z5Y A;  4EXS A;  4AV7 A;  5LS3 A;  5LLD A;  5K4N A;  3I13 A;  5ACQ A;  4J5F A; 
#chains in the Genus database with same CATH homology
 2YNV B;  5DPX A;  5ACX A;  3DHC A;  3BC2 A;  1SML A;  3X2Z A;  5AYA A;  2BFZ B;  4Z6X A;  4D1U A;  2H6A A;  2Y8B A;  1VGN A;  5EWA A;  2GFK A;  3T3O A;  4EY2 A;  3AF5 A;  4FEK A;  3SFP A;  2FHX A;  5ACT A;  4YSB A;  3ZQ4 A;  3FCZ A;  2YNV A;  1BC2 A;  1KO3 A;  2BG7 A;  3X2X A;  2WYL A;  4H0D A;  1QH5 A;  5HIQ A;  2VW8 A;  4BZ3 A;  4Z7R A;  3X30 A;  5KIL A;  3ZNB A;  3BV6 A;  1A7T A;  2BG2 A;  2BMI A;  2ZWR A;  4UWP B;  1X8H A;  1BVT A;  3R2U A;  3IE0 A;  1XM8 A;  1VME A;  3F9O A;  3WXC A;  5LM6 A;  4ZO2 A;  2BIB A;  2R2D A;  1JJT A;  3AJ3 A;  1WUP A;  5AEB A;  5ACU A;  5ACW A;  5LMC A;  3DHA A;  1P9E A;  5B3R A;  3SBL A;  5FQC A;  5HH6 A;  2QJS A;  5A0T A;  3BK2 A;  2XR1 A;  3H3E A;  4O98 A;  3IDZ A;  4TZ9 A;  4C1F A;  2BG8 A;  3JXP A;  4C1D A;  1Y44 A;  3DHB A;  2Y8A A;  4AX1 B;  4Z5Z A;  2I7T A;  1VJN A;  2BFZ A;  4UWO B;  4Z60 A;  2BG6 A;  5LCA A;  4XWW A;  2DOO A;  1JJE A;  2FU7 A;  4V0H A;  4D1T A;  4GYQ A;  2Q42 A;  5B1U A;  2NZF A;  4F6H A;  3I14 A;  1KO2 A;  5EV6 A;  3G1P A;  4AWZ A;  4C1H A;  3AF6 A;  4F6Z A;  5IQK A;  1HLK A;  3PY5 A;  4UWR B;  4TZE A;  4TYF A;  3IEL A;  4ZEJ A;  5EH9 A;  4NQ2 A;  2XF4 A;  2ZO4 A;  4BP0 A;  2UYX A;  1DXK A;  5K4K A;  1KR3 A;  3SD9 A;  1ZKP A;  3FAI A;  2CBN A;  3IE2 A;  2FK6 A;  4NQ6 A;  3Q6V A;  3KNS A;  1K07 A;  5EVB A;  4EXY A;  4UA4 A;  2Q9U A;  2FU9 A;  4TZF A;  3PG4 A;  2YNW A;  4RBS A;  4UAM A;  5ACV A;  4ZNB A;  1E5D A;  4YSK A;  2AZ4 A;  2BGA A;  4PVT A;  3T3N A;  5HH5 A;  4TYT A;  1A8T A;  3PY6 A;  2Q0I A;  3DH8 A;  4HL2 A;  4RL2 A;  1WUO A;  3A4Y A;  3I15 A;  5ACS A;  2NXA A;  1JT1 A;  5EHT A;  5FQA A;  3SRX A;  4C09 A;  4B87 A;  3VPE A;  2BG8 B;  4NQ5 A;  2Q0J A;  3RKJ A;  2Y87 A;  2QDS A;  4D1V A;  4DIL A;  2P97 A;  2P18 A;  2FHX B;  5FQB A;  2I7V A;  4C1G A;  4U4L A;  2I7X A;  5A0V A;  1YCF A;  4RM5 A;  5HIP A;  4XWT A;  4P62 A;  3IOF A;  4AX0 B;  4UBQ A;  4Z67 A;  4UWS B;  4AWY B;  2NZE A;  4GYU A;  4C1C A;  2ZNB A;  3L6N A;  4WD6 A;  2YCB A;  5EV8 A;  4J5H A;  2BR6 A;  2NYP A;  4RAW A;  4EYL A;  3I11 A;  5EVD A;  4D1W A;  2WYM A;  1XTO A;  2DKF A;  2WYM C;  4GCW A;  2YNU A;  2YNT A;  4EYF A;  4NQ4 A;  2M5C A;  3RKK A;  1X8G A;  4C1E A;  2ZZI A;  3I0V A;  3S0Z A;  4EFZ A;  4TZB A;  3IEM A;  1DD6 A;  2E7Y A;  4FSB A;  4D02 A;  5HIO A;  5EW0 A;  5HIS A;  2HB9 A;  2GKL A;  4FR7 A;  4HL1 A;  1WW1 A;  2FM6 A;  3LVZ A;  5LSC A;  5K4M A;  5HH4 A;  5LE1 A;  1ZNB A;  2BFK A;  3IEK A;  3RPC A;  4ZO3 A;  1MQO A;  4RL0 A;  4EYB A;  5EVK A;  4LE6 A;  1ZTC A;  3ESH A;  3X2Y A;  5B15 A;  1QH3 A;  4HKY A;  5KIK A;  3KNR A;  2A7M A;  5K0W A;  3TP9 A;  3IOG A;  3SW3 A;  2P1E A;  2GCU A;  2BTN A;  3ADR A;  4CHL A;  5A5Z A;  4KEQ A;  5AXR A;  1YCH A;  1M2X A;  2QIN A;  2AIO A;  2YNT B;  5AHR A;  5AHO A;  4XUK A;  2WRS A;  2YZ3 A;  4YSL A;  4KEP A;  2BC2 A;  2QDT A;  3P2U A;  3ZWF A;  4PVO A;  2BFL A;  5AXO A;  2WHG A;  2OHH A;  3T9M A;  3QH8 A;  3MD7 A;  1L9Y A;  3ZR9 A;  2OHI A;  1DDK A;  2QED A;  5LCH A;  5LCF A;  4AD9 A;  2FU6 A;  2M5D A;  5ACR A;  2GFJ A;  2OHJ A;  5A87 A;  2FU8 A;  4JO0 A;  3SPU A;  5ACP A;  3IE1 A;  3KL7 A;  2P4Z A;  1BMC A;  3BK1 A;  2GMN A;  3VQZ A;  4DIK A;  4RAM A;  1X8I A;  1YCG A;  1WRA A;  4Z5Y A;  5LS3 A;  4EXS A;  5LLD A;  5K4N A;  3I13 A;  5ACQ A;  4J5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...