1XM8A

X-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
MQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALGIIRKAKDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords glyoxalase II
publication title Structural studies on a mitochondrial glyoxalase II.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1xm8A00
4NQ5A 2R2DA 2BIBA 1XTOA 2FM6A 4D1VA 5B15A 2GFJA 3BK2A 2Q0IA 1L9YA 4H0DA 3RKJA 1XM8A 3KL7A 3I0VA 4GCWA 5AYAA 2BG8B 3ESHA 3QH8A 4RM5A 2YNUA 3IOGA 5AXRA 4B87A 5ACXA 1DXKA 5FQCA 5K4NA 4DIKA 4ZNBA 3AF6A 1QH5A 5ACQA 3DHAA 4EFZA 1Y44A 3IEMA 3I14A 3KNRA 3AF5A 4XWTA 4XWWA 1E5DA 4C1EA 5AHRA 4EYFA 3SPUA 2XR1A 2ZO4A 4BZ3A 1HLKA 3WXCA 4KEPA 3H3EA 5A87A 2ZWRA 1SMLA 3I15A 5EHTA 2A7MA 4AX0B 4YSBA 5LCFA 2YNVB 3DH8A 4ZO2A 1WRAA 2QINA 5ACTA 3BC2A 4TZBA 4RAWA 2DKFA 4NQ4A 4DILA 2GMNA 1VGNA 2M5CA 2VW8A 3IE1A 5LE1A 1KO3A 3LVZA 2OHJA 5A0TA 3P2UA 3ZQ4A 2FU6A 5FQBA 2BG2A 5HH6A 1JT1A 4V0HA 3PY6A 3VPEA 1YCHA 4UWSB 2QDSA 1VJNA 3KNSA 2NXAA 3G1PA 4UA4A 4WD6A 3ZNBA 2BFZA 5HISA 2BC2A 3AJ3A 5LSCA 2BG7A 4RBSA 3T3NA 4BP0A 2YNVA 1JJEA 4FEKA 1BVTA 5EVKA 4TZ9A 4Z67A 4YSLA 4F6HA 2QDTA 4Z60A 5DPXA 4D1WA 2YCBA 5EVBA 3X30A 4C1FA 2Y8AA 3SRXA 5EW0A 4F6ZA 2WYLA 2E7YA 4C1DA 1WUOA 5EH9A 3FCZA 3RKKA 3JXPA 3SW3A 4JO0A 3Q6VA 4UBQA 1X8GA 4AWYB 5LCHA 4FSBA 1DDKA 1YCFA 2NYPA 2H6AA 1MQOA 2FHXA 3IELA 2DOOA 3R2UA 3L6NA 4HL2A 2BFLA 3MD7A 4UWOB 3S0ZA 2HB9A 5LCAA 1DD6A 3BK1A 4HL1A 2BMIA 4EXYA 5HIPA 2YNTB 5B1UA 2UYXA 4HKYA 4RL2A 2FK6A 4NQ6A 2BG8A 2WYMC 5K4MA 5LMCA 4U4LA 2BFKA 4EYLA 4TYTA 1KR3A 4TZFA 5ACSA 5ACVA 5EWAA 3ZWFA 4RAMA 4TZEA 2P18A 2BG6A 1ZTCA 5ACUA 1WW1A 4Z6XA 3PG4A 5EVDA 3X2ZA 4C1HA 1BMCA 4TYFA 5HH4A 4C09A 4PVOA 5K4KA 2NZFA 3IE0A 4J5HA 2QJSA 3FAIA 2YNTA 2P4ZA 5B3RA 2BR6A 2ZNBA 2YZ3A 3DHCA 5LLDA 4AWZA 3IE2A 2P1EA 2Q0JA 1ZNBA 2M5DA 2AZ4A 3ADRA 3A4YA 3X2YA 2NZEA 1QH3A 3T9MA 4GYUA 1VMEA 3ZR9A 4ZO3A 5ACRA 1KO2A 1JJTA 5AXOA 3X2XA 2Q9UA 4CHLA 4ZEJA 2Y87A 1K07A 2I7VA 4NQ2A 2WHGA 4D1UA 2OHIA 2OHHA 2GKLA 2FU9A 4XUKA 5EV8A 5EV6A 2CBNA 5HH5A 1WUPA 4GYQA 2XF4A 4P62A 5AHOA 3IDZA 2BTNA 2Q42A 2YNWA 3IEKA 4AX1B 5K0WA 1ZKPA 4RL0A 2ZZIA 3RPCA 4C1GA 4EXSA 3SD9A 5KIKA 4UWRB 1X8HA 5ACWA 4LE6A 3TP9A 3VQZA 2AIOA 2GCUA 3I11A 2I7TA 5A5ZA 4FR7A 2I7XA 2BFZB 3I13A 3IOFA 5A0VA 5LM6A 2WRSA 5KILA 3PY5A 2P97A 4D1TA 5HIOA 4KEQA 4UAMA 5HIQA 5FQAA 3DHBA 4PVTA 4C1CA 2FU7A 5IQKA 3T3OA 2FU8A 1BC2A 2WYMA 4EY2A 2Y8BA 5LS3A 3F9OA 3BV6A 2QEDA 1A8TA 4AD9A 4YSKA 4O98A 4J5FA 2GFKA 4D02A 1P9EA 2FHXB 5AEBA 3SFPA 2BGAA 1YCGA 4UWPB 4Z5ZA 4EYBA 3SBLA 5ACPA 1A7TA 1M2XA 4Z7RA 1X8IA 4Z5YA
chains in the Genus database with same CATH superfamily
4NQ5A 2R2DA 2BIBA 1XTOA 2FM6A 4D1VA 5B15A 2GFJA 3BK2A 2Q0IA 1L9YA 4H0DA 3RKJA 1XM8A 3KL7A 3I0VA 4GCWA 5AYAA 2BG8B 3ESHA 3QH8A 4RM5A 2YNUA 3IOGA 5AXRA 4B87A 5ACXA 1DXKA 5FQCA 5K4NA 4DIKA 4ZNBA 3AF6A 1QH5A 5ACQA 3DHAA 4EFZA 1Y44A 3IEMA 3I14A 3KNRA 3AF5A 4XWTA 4XWWA 1E5DA 4C1EA 5AHRA 4EYFA 3SPUA 2XR1A 2ZO4A 4BZ3A 1HLKA 3WXCA 4KEPA 3H3EA 5A87A 4NURA 2ZWRA 1SMLA 3I15A 5EHTA 2A7MA 4AX0B 4YSBA 5LCFA 2YNVB 3DH8A 4ZO2A 5AJLA 1WRAA 2QINA 5ACTA 3BC2A 4TZBA 4RAWA 2DKFA 4NQ4A 4DILA 2GMNA 1VGNA 2M5CA 2VW8A 3IE1A 5LE1A 1KO3A 3LVZA 2OHJA 5A0TA 3P2UA 3ZQ4A 2FU6A 5FQBA 2BG2A 5HH6A 1JT1A 4V0HA 3PY6A 3VPEA 1YCHA 4UWSB 2QDSA 1VJNA 3KNSA 2NXAA 3G1PA 4UA4A 4WD6A 3ZNBA 2BFZA 5HISA 2BC2A 3AJ3A 5LSCA 2BG7A 4RBSA 3T3NA 4BP0A 2YNVA 1JJEA 4FEKA 1BVTA 5EVKA 4TZ9A 4Z67A 4YSLA 4F6HA 2QDTA 4Z60A 5DPXA 4D1WA 2YCBA 5EVBA 4AV7A 3X30A 4C1FA 2Y8AA 3SRXA 5EW0A 4F6ZA 2WYLA 2E7YA 4C1DA 1WUOA 5EH9A 3FCZA 3RKKA 3JXPA 3SW3A 4JO0A 3Q6VA 4UBQA 1X8GA 4AWYB 5LCHA 4FSBA 1DDKA 1YCFA 2NYPA 2H6AA 1MQOA 2FHXA 3IELA 2DOOA 3R2UA 3L6NA 4HL2A 2BFLA 3MD7A 4UWOB 3S0ZA 2HB9A 5LCAA 1DD6A 3BK1A 4HL1A 2BMIA 4EXYA 5HIPA 2YNTB 5B1UA 2UYXA 4HKYA 4RL2A 2FK6A 4NQ6A 2BG8A 2WYMC 5K4MA 5LMCA 4U4LA 2BFKA 4EYLA 4TYTA 1KR3A 2CFZA 4TZFA 5ACSA 5ACVA 5EWAA 3ZWFA 4RAMA 4TZEA 2P18A 2BG6A 1ZTCA 5ACUA 1WW1A 4Z6XA 3PG4A 5EVDA 3X2ZA 4C1HA 5AIJA 1BMCA 4TYFA 5HH4A 4C09A 4PVOA 5K4KA 2NZFA 3IE0A 4J5HA 2QJSA 3FAIA 2YNTA 2P4ZA 5B3RA 2BR6A 2ZNBA 5A23A 2YZ3A 3DHCA 5LLDA 4AWZA 3IE2A 2P1EA 2Q0JA 1ZNBA 2M5DA 2AZ4A 3ADRA 3A4YA 3X2YA 2NZEA 1QH3A 3T9MA 4GYUA 1VMEA 3ZR9A 4ZO3A 5ACRA 1KO2A 1JJTA 5AXOA 3X2XA 2CFUA 2Q9UA 4CHLA 4ZEJA 2Y87A 1K07A 2I7VA 4NQ2A 2WHGA 4D1UA 2OHIA 2OHHA 2GKLA 2FU9A 4XUKA 5EV8A 5EV6A 2CBNA 5HH5A 1WUPA 4GYQA 2XF4A 4P62A 2YHEA 5AHOA 3IDZA 2BTNA 2Q42A 2YNWA 3IEKA 4AX1B 5K0WA 1ZKPA 4RL0A 2ZZIA 3RPCA 4C1GA 4EXSA 3SD9A 5KIKA 4UWRB 1X8HA 4PDXA 5ACWA 4LE6A 3TP9A 3VQZA 2AIOA 2GCUA 3I11A 2I7TA 5A5ZA 4FR7A 4AXHA 2I7XA 2CG2A 2BFZB 3I13A 3IOFA 5A0VA 5LM6A 2WRSA 5KILA 3PY5A 2P97A 4D1TA 5HIOA 4KEQA 4UAMA 5HIQA 5FQAA 3DHBA 4PVTA 4C1CA 2FU7A 5IQKA 3T3OA 2FU8A 1BC2A 2WYMA 4EY2A 2Y8BA 5LS3A 3F9OA 3BV6A 2CG3A 2QEDA 1A8TA 4AD9A 4YSKA 4O98A 4J5FA 2GFKA 4D02A 1P9EA 2FHXB 5AEBA 3SFPA 2BGAA 1YCGA 4UWPB 4Z5ZA 4EYBA 3SBLA 5ACPA 1A7TA 1M2XA 4Z7RA 1X8IA 4Z5YA
chains in the Genus database with same CATH topology
4NQ5A 2R2DA 2BIBA 1XTOA 2FM6A 4D1VA 5B15A 2GFJA 3BK2A 2Q0IA 1L9YA 4H0DA 3RKJA 1XM8A 3KL7A 3I0VA 4GCWA 5AYAA 2BG8B 3ESHA 3QH8A 4RM5A 2YNUA 3IOGA 5AXRA 4B87A 5ACXA 1DXKA 5FQCA 5K4NA 4DIKA 4ZNBA 3AF6A 1QH5A 5ACQA 3DHAA 4EFZA 1Y44A 3IEMA 3I14A 3KNRA 3AF5A 4XWTA 4XWWA 1E5DA 4C1EA 5AHRA 4EYFA 3SPUA 2XR1A 2ZO4A 4BZ3A 1HLKA 3WXCA 4KEPA 3H3EA 5A87A 2ZWRA 1SMLA 3I15A 5EHTA 2A7MA 4AX0B 4YSBA 5LCFA 2YNVB 3DH8A 4ZO2A 1WRAA 2QINA 5ACTA 3BC2A 4TZBA 4RAWA 2DKFA 4NQ4A 4DILA 2GMNA 1VGNA 2M5CA 2VW8A 3IE1A 5LE1A 1KO3A 3LVZA 2OHJA 5A0TA 3P2UA 3ZQ4A 2FU6A 5FQBA 2BG2A 5HH6A 1JT1A 4V0HA 3PY6A 3VPEA 1YCHA 4UWSB 2QDSA 1VJNA 3KNSA 2NXAA 3G1PA 4UA4A 4WD6A 3ZNBA 2BFZA 5HISA 2BC2A 3AJ3A 5LSCA 2BG7A 4RBSA 3T3NA 4BP0A 2YNVA 1JJEA 4FEKA 1BVTA 5EVKA 4TZ9A 4Z67A 4YSLA 4F6HA 2QDTA 4Z60A 5DPXA 4D1WA 2YCBA 5EVBA 3X30A 4C1FA 2Y8AA 3SRXA 5EW0A 4F6ZA 2WYLA 2E7YA 4C1DA 1WUOA 5EH9A 3FCZA 3RKKA 3JXPA 3SW3A 4JO0A 3Q6VA 4UBQA 1X8GA 4AWYB 5LCHA 4FSBA 1DDKA 1YCFA 2NYPA 2H6AA 1MQOA 2FHXA 3IELA 2DOOA 3R2UA 3L6NA 4HL2A 2BFLA 3MD7A 4UWOB 3S0ZA 2HB9A 5LCAA 1DD6A 3BK1A 4HL1A 2BMIA 4EXYA 5HIPA 2YNTB 5B1UA 2UYXA 4HKYA 4RL2A 2FK6A 4NQ6A 2BG8A 2WYMC 5K4MA 5LMCA 4U4LA 2BFKA 4EYLA 4TYTA 1KR3A 4TZFA 5ACSA 5ACVA 5EWAA 3ZWFA 4RAMA 4TZEA 2P18A 2BG6A 1ZTCA 5ACUA 1WW1A 4Z6XA 3PG4A 5EVDA 3X2ZA 4C1HA 1BMCA 4TYFA 5HH4A 4C09A 4PVOA 5K4KA 2NZFA 3IE0A 4J5HA 2QJSA 3FAIA 2YNTA 2P4ZA 5B3RA 2BR6A 2ZNBA 2YZ3A 3DHCA 5LLDA 4AWZA 3IE2A 2P1EA 2Q0JA 1ZNBA 2M5DA 2AZ4A 3ADRA 3A4YA 3X2YA 2NZEA 1QH3A 3T9MA 4GYUA 1VMEA 3ZR9A 4ZO3A 5ACRA 1KO2A 1JJTA 5AXOA 3X2XA 2Q9UA 4CHLA 4ZEJA 2Y87A 1K07A 2I7VA 4NQ2A 2WHGA 4D1UA 2OHIA 2OHHA 2GKLA 2FU9A 4XUKA 5EV8A 5EV6A 2CBNA 5HH5A 1WUPA 4GYQA 2XF4A 4P62A 5AHOA 3IDZA 2BTNA 2Q42A 2YNWA 3IEKA 4AX1B 5K0WA 1ZKPA 4RL0A 2ZZIA 3RPCA 4C1GA 4EXSA 3SD9A 5KIKA 4UWRB 1X8HA 5ACWA 4LE6A 3TP9A 3VQZA 2AIOA 2GCUA 3I11A 2I7TA 5A5ZA 4FR7A 2I7XA 2BFZB 3I13A 3IOFA 5A0VA 5LM6A 2WRSA 5KILA 3PY5A 2P97A 4D1TA 5HIOA 4KEQA 4UAMA 5HIQA 5FQAA 3DHBA 4PVTA 4C1CA 2FU7A 5IQKA 3T3OA 2FU8A 1BC2A 2WYMA 4EY2A 2Y8BA 5LS3A 3F9OA 3BV6A 2QEDA 1A8TA 4AD9A 4YSKA 4O98A 4J5FA 2GFKA 4D02A 1P9EA 2FHXB 5AEBA 3SFPA 2BGAA 1YCGA 4UWPB 4Z5ZA 4EYBA 3SBLA 5ACPA 1A7TA 1M2XA 4Z7RA 1X8IA 4Z5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ5 A;  2R2D A;  2BIB A;  1XTO A;  2FM6 A;  4D1V A;  5B15 A;  2GFJ A;  3BK2 A;  2Q0I A;  1L9Y A;  4H0D A;  3RKJ A;  1XM8 A;  3KL7 A;  3I0V A;  4GCW A;  5AYA A;  2BG8 B;  3ESH A;  3QH8 A;  4RM5 A;  2YNU A;  3IOG A;  5AXR A;  4B87 A;  5ACX A;  1DXK A;  5FQC A;  5K4N A;  4DIK A;  4ZNB A;  3AF6 A;  1QH5 A;  5ACQ A;  3DHA A;  4EFZ A;  1Y44 A;  3IEM A;  3I14 A;  3KNR A;  3AF5 A;  4XWT A;  4XWW A;  1E5D A;  4C1E A;  5AHR A;  4EYF A;  3SPU A;  2XR1 A;  2ZO4 A;  4BZ3 A;  1HLK A;  3WXC A;  4KEP A;  3H3E A;  5A87 A;  2ZWR A;  1SML A;  3I15 A;  5EHT A;  2A7M A;  4AX0 B;  4YSB A;  5LCF A;  2YNV B;  3DH8 A;  4ZO2 A;  1WRA A;  2QIN A;  5ACT A;  3BC2 A;  4TZB A;  4RAW A;  2DKF A;  4NQ4 A;  4DIL A;  2GMN A;  1VGN A;  2M5C A;  2VW8 A;  3IE1 A;  5LE1 A;  1KO3 A;  3LVZ A;  2OHJ A;  5A0T A;  3P2U A;  3ZQ4 A;  2FU6 A;  5FQB A;  2BG2 A;  5HH6 A;  1JT1 A;  4V0H A;  3PY6 A;  3VPE A;  1YCH A;  4UWS B;  2QDS A;  1VJN A;  3KNS A;  2NXA A;  3G1P A;  4UA4 A;  4WD6 A;  3ZNB A;  2BFZ A;  5HIS A;  2BC2 A;  3AJ3 A;  5LSC A;  2BG7 A;  4RBS A;  3T3N A;  4BP0 A;  2YNV A;  1JJE A;  4FEK A;  1BVT A;  5EVK A;  4TZ9 A;  4Z67 A;  4YSL A;  4F6H A;  2QDT A;  4Z60 A;  5DPX A;  4D1W A;  2YCB A;  5EVB A;  3X30 A;  4C1F A;  2Y8A A;  3SRX A;  5EW0 A;  4F6Z A;  2WYL A;  2E7Y A;  4C1D A;  1WUO A;  5EH9 A;  3FCZ A;  3RKK A;  3JXP A;  3SW3 A;  4JO0 A;  3Q6V A;  4UBQ A;  1X8G A;  4AWY B;  5LCH A;  4FSB A;  1DDK A;  1YCF A;  2NYP A;  2H6A A;  1MQO A;  2FHX A;  3IEL A;  2DOO A;  3R2U A;  3L6N A;  4HL2 A;  2BFL A;  3MD7 A;  4UWO B;  3S0Z A;  2HB9 A;  5LCA A;  1DD6 A;  3BK1 A;  4HL1 A;  2BMI A;  4EXY A;  5HIP A;  2YNT B;  5B1U A;  2UYX A;  4HKY A;  4RL2 A;  2FK6 A;  4NQ6 A;  2BG8 A;  2WYM C;  5K4M A;  5LMC A;  4U4L A;  2BFK A;  4EYL A;  4TYT A;  1KR3 A;  4TZF A;  5ACS A;  5ACV A;  5EWA A;  3ZWF A;  4RAM A;  4TZE A;  2P18 A;  2BG6 A;  1ZTC A;  5ACU A;  1WW1 A;  4Z6X A;  3PG4 A;  5EVD A;  3X2Z A;  4C1H A;  1BMC A;  4TYF A;  5HH4 A;  4C09 A;  4PVO A;  5K4K A;  2NZF A;  3IE0 A;  4J5H A;  2QJS A;  3FAI A;  2YNT A;  2P4Z A;  5B3R A;  2BR6 A;  2ZNB A;  2YZ3 A;  3DHC A;  5LLD A;  4AWZ A;  3IE2 A;  2P1E A;  2Q0J A;  1ZNB A;  2M5D A;  2AZ4 A;  3ADR A;  3A4Y A;  3X2Y A;  2NZE A;  1QH3 A;  3T9M A;  4GYU A;  1VME A;  3ZR9 A;  4ZO3 A;  5ACR A;  1KO2 A;  1JJT A;  5AXO A;  3X2X A;  2Q9U A;  4CHL A;  4ZEJ A;  2Y87 A;  1K07 A;  2I7V A;  4NQ2 A;  2WHG A;  4D1U A;  2OHI A;  2OHH A;  2GKL A;  2FU9 A;  4XUK A;  5EV8 A;  5EV6 A;  2CBN A;  5HH5 A;  1WUP A;  4GYQ A;  2XF4 A;  4P62 A;  5AHO A;  3IDZ A;  2BTN A;  2Q42 A;  2YNW A;  3IEK A;  4AX1 B;  5K0W A;  1ZKP A;  4RL0 A;  2ZZI A;  3RPC A;  4C1G A;  4EXS A;  3SD9 A;  5KIK A;  4UWR B;  1X8H A;  5ACW A;  4LE6 A;  3TP9 A;  3VQZ A;  2AIO A;  2GCU A;  3I11 A;  2I7T A;  5A5Z A;  4FR7 A;  2I7X A;  2BFZ B;  3I13 A;  3IOF A;  5A0V A;  5LM6 A;  2WRS A;  5KIL A;  3PY5 A;  2P97 A;  4D1T A;  5HIO A;  4KEQ A;  4UAM A;  5HIQ A;  5FQA A;  3DHB A;  4PVT A;  4C1C A;  2FU7 A;  5IQK A;  3T3O A;  2FU8 A;  1BC2 A;  2WYM A;  4EY2 A;  2Y8B A;  5LS3 A;  3F9O A;  3BV6 A;  2QED A;  1A8T A;  4AD9 A;  4YSK A;  4O98 A;  4J5F A;  2GFK A;  4D02 A;  1P9E A;  2FHX B;  5AEB A;  3SFP A;  2BGA A;  1YCG A;  4UWP B;  4Z5Z A;  4EYB A;  3SBL A;  5ACP A;  1A7T A;  1M2X A;  4Z7R A;  1X8I A;  4Z5Y A; 
#chains in the Genus database with same CATH topology
 4NQ5 A;  2R2D A;  2BIB A;  1XTO A;  2FM6 A;  4D1V A;  5B15 A;  2GFJ A;  3BK2 A;  2Q0I A;  1L9Y A;  4H0D A;  3RKJ A;  1XM8 A;  3KL7 A;  3I0V A;  4GCW A;  5AYA A;  2BG8 B;  3ESH A;  3QH8 A;  4RM5 A;  2YNU A;  3IOG A;  5AXR A;  4B87 A;  5ACX A;  1DXK A;  5FQC A;  5K4N A;  4DIK A;  4ZNB A;  3AF6 A;  1QH5 A;  5ACQ A;  3DHA A;  4EFZ A;  1Y44 A;  3IEM A;  3I14 A;  3KNR A;  3AF5 A;  4XWT A;  4XWW A;  1E5D A;  4C1E A;  5AHR A;  4EYF A;  3SPU A;  2XR1 A;  2ZO4 A;  4BZ3 A;  1HLK A;  3WXC A;  4KEP A;  3H3E A;  5A87 A;  4NUR A;  2ZWR A;  1SML A;  3I15 A;  5EHT A;  2A7M A;  4AX0 B;  4YSB A;  5LCF A;  2YNV B;  3DH8 A;  4ZO2 A;  5AJL A;  1WRA A;  2QIN A;  5ACT A;  3BC2 A;  4TZB A;  4RAW A;  2DKF A;  4NQ4 A;  4DIL A;  2GMN A;  1VGN A;  2M5C A;  2VW8 A;  3IE1 A;  5LE1 A;  1KO3 A;  3LVZ A;  2OHJ A;  5A0T A;  3P2U A;  3ZQ4 A;  2FU6 A;  5FQB A;  2BG2 A;  5HH6 A;  1JT1 A;  4V0H A;  3PY6 A;  3VPE A;  1YCH A;  4UWS B;  2QDS A;  1VJN A;  3KNS A;  2NXA A;  3G1P A;  4UA4 A;  4WD6 A;  3ZNB A;  2BFZ A;  5HIS A;  2BC2 A;  3AJ3 A;  5LSC A;  2BG7 A;  4RBS A;  3T3N A;  4BP0 A;  2YNV A;  1JJE A;  4FEK A;  1BVT A;  5EVK A;  4TZ9 A;  4Z67 A;  4YSL A;  4F6H A;  2QDT A;  4Z60 A;  5DPX A;  4D1W A;  2YCB A;  5EVB A;  4AV7 A;  3X30 A;  4C1F A;  2Y8A A;  3SRX A;  5EW0 A;  4F6Z A;  2WYL A;  2E7Y A;  4C1D A;  1WUO A;  5EH9 A;  3FCZ A;  3RKK A;  3JXP A;  3SW3 A;  4JO0 A;  3Q6V A;  4UBQ A;  1X8G A;  4AWY B;  5LCH A;  4FSB A;  1DDK A;  1YCF A;  2NYP A;  2H6A A;  1MQO A;  2FHX A;  3IEL A;  2DOO A;  3R2U A;  3L6N A;  4HL2 A;  2BFL A;  3MD7 A;  4UWO B;  3S0Z A;  2HB9 A;  5LCA A;  1DD6 A;  3BK1 A;  4HL1 A;  2BMI A;  4EXY A;  5HIP A;  2YNT B;  5B1U A;  2UYX A;  4HKY A;  4RL2 A;  2FK6 A;  4NQ6 A;  2BG8 A;  2WYM C;  5K4M A;  5LMC A;  4U4L A;  2BFK A;  4EYL A;  4TYT A;  1KR3 A;  2CFZ A;  4TZF A;  5ACS A;  5ACV A;  5EWA A;  3ZWF A;  4RAM A;  4TZE A;  2P18 A;  2BG6 A;  1ZTC A;  5ACU A;  1WW1 A;  4Z6X A;  3PG4 A;  5EVD A;  3X2Z A;  4C1H A;  5AIJ A;  1BMC A;  4TYF A;  5HH4 A;  4C09 A;  4PVO A;  5K4K A;  2NZF A;  3IE0 A;  4J5H A;  2QJS A;  3FAI A;  2YNT A;  2P4Z A;  5B3R A;  2BR6 A;  2ZNB A;  5A23 A;  2YZ3 A;  3DHC A;  5LLD A;  4AWZ A;  3IE2 A;  2P1E A;  2Q0J A;  1ZNB A;  2M5D A;  2AZ4 A;  3ADR A;  3A4Y A;  3X2Y A;  2NZE A;  1QH3 A;  3T9M A;  4GYU A;  1VME A;  3ZR9 A;  4ZO3 A;  5ACR A;  1KO2 A;  1JJT A;  5AXO A;  3X2X A;  2CFU A;  2Q9U A;  4CHL A;  4ZEJ A;  2Y87 A;  1K07 A;  2I7V A;  4NQ2 A;  2WHG A;  4D1U A;  2OHI A;  2OHH A;  2GKL A;  2FU9 A;  4XUK A;  5EV8 A;  5EV6 A;  2CBN A;  5HH5 A;  1WUP A;  4GYQ A;  2XF4 A;  4P62 A;  2YHE A;  5AHO A;  3IDZ A;  2BTN A;  2Q42 A;  2YNW A;  3IEK A;  4AX1 B;  5K0W A;  1ZKP A;  4RL0 A;  2ZZI A;  3RPC A;  4C1G A;  4EXS A;  3SD9 A;  5KIK A;  4UWR B;  1X8H A;  4PDX A;  5ACW A;  4LE6 A;  3TP9 A;  3VQZ A;  2AIO A;  2GCU A;  3I11 A;  2I7T A;  5A5Z A;  4FR7 A;  4AXH A;  2I7X A;  2CG2 A;  2BFZ B;  3I13 A;  3IOF A;  5A0V A;  5LM6 A;  2WRS A;  5KIL A;  3PY5 A;  2P97 A;  4D1T A;  5HIO A;  4KEQ A;  4UAM A;  5HIQ A;  5FQA A;  3DHB A;  4PVT A;  4C1C A;  2FU7 A;  5IQK A;  3T3O A;  2FU8 A;  1BC2 A;  2WYM A;  4EY2 A;  2Y8B A;  5LS3 A;  3F9O A;  3BV6 A;  2CG3 A;  2QED A;  1A8T A;  4AD9 A;  4YSK A;  4O98 A;  4J5F A;  2GFK A;  4D02 A;  1P9E A;  2FHX B;  5AEB A;  3SFP A;  2BGA A;  1YCG A;  4UWP B;  4Z5Z A;  4EYB A;  3SBL A;  5ACP A;  1A7T A;  1M2X A;  4Z7R A;  1X8I A;  4Z5Y A; 
#chains in the Genus database with same CATH homology
 4NQ5 A;  2R2D A;  2BIB A;  1XTO A;  2FM6 A;  4D1V A;  5B15 A;  2GFJ A;  3BK2 A;  2Q0I A;  1L9Y A;  4H0D A;  3RKJ A;  1XM8 A;  3KL7 A;  3I0V A;  4GCW A;  5AYA A;  2BG8 B;  3ESH A;  3QH8 A;  4RM5 A;  2YNU A;  3IOG A;  5AXR A;  4B87 A;  5ACX A;  1DXK A;  5FQC A;  5K4N A;  4DIK A;  4ZNB A;  3AF6 A;  1QH5 A;  5ACQ A;  3DHA A;  4EFZ A;  1Y44 A;  3IEM A;  3I14 A;  3KNR A;  3AF5 A;  4XWT A;  4XWW A;  1E5D A;  4C1E A;  5AHR A;  4EYF A;  3SPU A;  2XR1 A;  2ZO4 A;  4BZ3 A;  1HLK A;  3WXC A;  4KEP A;  3H3E A;  5A87 A;  2ZWR A;  1SML A;  3I15 A;  5EHT A;  2A7M A;  4AX0 B;  4YSB A;  5LCF A;  2YNV B;  3DH8 A;  4ZO2 A;  1WRA A;  2QIN A;  5ACT A;  3BC2 A;  4TZB A;  4RAW A;  2DKF A;  4NQ4 A;  4DIL A;  2GMN A;  1VGN A;  2M5C A;  2VW8 A;  3IE1 A;  5LE1 A;  1KO3 A;  3LVZ A;  2OHJ A;  5A0T A;  3P2U A;  3ZQ4 A;  2FU6 A;  5FQB A;  2BG2 A;  5HH6 A;  1JT1 A;  4V0H A;  3PY6 A;  3VPE A;  1YCH A;  4UWS B;  2QDS A;  1VJN A;  3KNS A;  2NXA A;  3G1P A;  4UA4 A;  4WD6 A;  3ZNB A;  2BFZ A;  5HIS A;  2BC2 A;  3AJ3 A;  5LSC A;  2BG7 A;  4RBS A;  3T3N A;  4BP0 A;  2YNV A;  1JJE A;  4FEK A;  1BVT A;  5EVK A;  4TZ9 A;  4Z67 A;  4YSL A;  4F6H A;  2QDT A;  4Z60 A;  5DPX A;  4D1W A;  2YCB A;  5EVB A;  3X30 A;  4C1F A;  2Y8A A;  3SRX A;  5EW0 A;  4F6Z A;  2WYL A;  2E7Y A;  4C1D A;  1WUO A;  5EH9 A;  3FCZ A;  3RKK A;  3JXP A;  3SW3 A;  4JO0 A;  3Q6V A;  4UBQ A;  1X8G A;  4AWY B;  5LCH A;  4FSB A;  1DDK A;  1YCF A;  2NYP A;  2H6A A;  1MQO A;  2FHX A;  3IEL A;  2DOO A;  3R2U A;  3L6N A;  4HL2 A;  2BFL A;  3MD7 A;  4UWO B;  3S0Z A;  2HB9 A;  5LCA A;  1DD6 A;  3BK1 A;  4HL1 A;  2BMI A;  4EXY A;  5HIP A;  2YNT B;  5B1U A;  2UYX A;  4HKY A;  4RL2 A;  2FK6 A;  4NQ6 A;  2BG8 A;  2WYM C;  5K4M A;  5LMC A;  4U4L A;  2BFK A;  4EYL A;  4TYT A;  1KR3 A;  4TZF A;  5ACS A;  5ACV A;  5EWA A;  3ZWF A;  4RAM A;  4TZE A;  2P18 A;  2BG6 A;  1ZTC A;  5ACU A;  1WW1 A;  4Z6X A;  3PG4 A;  5EVD A;  3X2Z A;  4C1H A;  1BMC A;  4TYF A;  5HH4 A;  4C09 A;  4PVO A;  5K4K A;  2NZF A;  3IE0 A;  4J5H A;  2QJS A;  3FAI A;  2YNT A;  2P4Z A;  5B3R A;  2BR6 A;  2ZNB A;  2YZ3 A;  3DHC A;  5LLD A;  4AWZ A;  3IE2 A;  2P1E A;  2Q0J A;  1ZNB A;  2M5D A;  2AZ4 A;  3ADR A;  3A4Y A;  3X2Y A;  2NZE A;  1QH3 A;  3T9M A;  4GYU A;  1VME A;  3ZR9 A;  4ZO3 A;  5ACR A;  1KO2 A;  1JJT A;  5AXO A;  3X2X A;  2Q9U A;  4CHL A;  4ZEJ A;  2Y87 A;  1K07 A;  2I7V A;  4NQ2 A;  2WHG A;  4D1U A;  2OHI A;  2OHH A;  2GKL A;  2FU9 A;  4XUK A;  5EV8 A;  5EV6 A;  2CBN A;  5HH5 A;  1WUP A;  4GYQ A;  2XF4 A;  4P62 A;  5AHO A;  3IDZ A;  2BTN A;  2Q42 A;  2YNW A;  3IEK A;  4AX1 B;  5K0W A;  1ZKP A;  4RL0 A;  2ZZI A;  3RPC A;  4C1G A;  4EXS A;  3SD9 A;  5KIK A;  4UWR B;  1X8H A;  5ACW A;  4LE6 A;  3TP9 A;  3VQZ A;  2AIO A;  2GCU A;  3I11 A;  2I7T A;  5A5Z A;  4FR7 A;  2I7X A;  2BFZ B;  3I13 A;  3IOF A;  5A0V A;  5LM6 A;  2WRS A;  5KIL A;  3PY5 A;  2P97 A;  4D1T A;  5HIO A;  4KEQ A;  4UAM A;  5HIQ A;  5FQA A;  3DHB A;  4PVT A;  4C1C A;  2FU7 A;  5IQK A;  3T3O A;  2FU8 A;  1BC2 A;  2WYM A;  4EY2 A;  2Y8B A;  5LS3 A;  3F9O A;  3BV6 A;  2QED A;  1A8T A;  4AD9 A;  4YSK A;  4O98 A;  4J5F A;  2GFK A;  4D02 A;  1P9E A;  2FHX B;  5AEB A;  3SFP A;  2BGA A;  1YCG A;  4UWP B;  4Z5Z A;  4EYB A;  3SBL A;  5ACP A;  1A7T A;  1M2X A;  4Z7R A;  1X8I A;  4Z5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...