1XM8A

X-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
b'MQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALGIIRKAKDDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glyoxalase II
publication title Structural studies on a mitochondrial glyoxalase II.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1xm8A00
2BR6A 4AWYB 3ESHA 5HISA 4UA4A 1DD6A 5LCHA 4WD6A 3LVZA 2NZEA 4TYTA 4UWPB 4EXYA 3L6NA 4D1UA 3PG4A 2P18A 5HH5A 4F6HA 3X2XA 5K4MA 2I7XA 4NQ4A 4C1HA 4J5HA 4ZNBA 4D1TA 4HL1A 4FEKA 2FU8A 2BTNA 3TP9A 4PVTA 2GFJA 5LM6A 5EVBA 5B1UA 3IE2A 2XR1A 4UWSB 4DIKA 4C1GA 4RL0A 2QINA 2GMNA 3F9OA 1WRAA 2GKLA 2BFKA 4YSKA 1KR3A 2M5DA 2YZ3A 5HH6A 4BP0A 4JO0A 2Q0JA 1VGNA 3ADRA 1YCHA 1A7TA 2I7VA 2NYPA 5AHRA 3KL7A 5B15A 4Z7RA 4TZEA 5HIQA 5HIOA 3P2UA 3S0ZA 4NQ5A 3BV6A 2BMIA 5ACQA 1X8IA 2FU9A 4J5FA 2QJSA 2YNVA 3ZWFA 3SFPA 5AXOA 2E7YA 4KEPA 5A0VA 3ZNBA 2Y8BA 4XUKA 4GYUA 2DOOA 2ZNBA 2UYXA 4LE6A 3A4YA 4EYBA 4V0HA 4UAMA 5A5ZA 3R2UA 1QH5A 2Y8AA 3BC2A 3IOGA 2QDSA 2P4ZA 3AF5A 3FAIA 5B3RA 3X2YA 3PY5A 2YNTB 3BK1A 5IQKA 4Z5ZA 3SD9A 1E5DA 2ZO4A 3WXCA 4YSLA 1XM8A 2OHHA 2HB9A 2BFLA 1K07A 4UWOB 1MQOA 4ZEJA 2FM6A 4C1FA 4O98A 4RM5A 4UWRB 4XWTA 4RL2A 3PY6A 3DHCA 4ZO3A 3QH8A 1WW1A 4KEQA 5ACTA 1ZNBA 1WUOA 4AD9A 4BZ3A 2ZZIA 2Q0IA 5HH4A 5KIKA 3SBLA 3DHAA 4TYFA 4FR7A 4GYQA 5EH9A 4Z67A 1QH3A 5EW0A 3IELA 3KNSA 3VQZA 2AIOA 5EVDA 4RBSA 5FQBA 2P1EA 2WYLA 4PVOA 1JJEA 4EXSA 2AZ4A 1ZTCA 4Z5YA 1YCGA 2OHIA 2QEDA 3I15A 3I11A 3T9MA 5LCFA 2FK6A 2YNUA 5DPXA 2R2DA 1X8GA 1ZKPA 3SRXA 5ACXA 2NXAA 5ACPA 1XTOA 2ZWRA 2XF4A 5AXRA 1YCFA 4CHLA 3I14A 3SPUA 5A0TA 2BFZB 3T3OA 2Q42A 3Q6VA 5LMCA 3IOFA 5EHTA 4F6ZA 3IDZA 3G1PA 5HIPA 1VMEA 4EFZA 4TZFA 4AX0B 2I7TA 1BC2A 4AWZA 5LE1A 2BG2A 4TZ9A 2BG8B 2DKFA 3MD7A 5LSCA 2YNTA 3IEMA 2BG6A 3AF6A 4RAWA 1VJNA 4RAMA 2FU6A 2FHXB 5K4NA 4Z6XA 2VW8A 4DILA 4XWWA 4TZBA 3DHBA 4ZO2A 3FCZA 4FSBA 2FHXA 2GFKA 4D1VA 4YSBA 5LS3A 3T3NA 3RKJA 5EVKA 3IEKA 5ACSA 2P97A 4AX1B 5ACWA 3AJ3A 1HLKA 1KO2A 3KNRA 5ACVA 4B87A 2WYMC 5LCAA 4EY2A 2YNWA 5EV8A 2BGAA 5AHOA 2CBNA 1Y44A 2Y87A 1DDKA 4D02A 3VPEA 1A8TA 4D1WA 2YCBA 4HKYA 2BG7A 2M5CA 1JT1A 3H3EA 3ZR9A 1BVTA 1P9EA 3SW3A 4EYFA 2BC2A 2WHGA 4EYLA 4H0DA 2YNVB 3RKKA 1WUPA 1JJTA 2H6AA 1DXKA 3JXPA 3DH8A 2WYMA 1M2XA 4HL2A 1BMCA 3IE1A 2NZFA 4NQ6A 5K4KA 3ZQ4A 4C1CA 5K0WA 1L9YA 4Z60A 2A7MA 2BFZA 4C09A 5LLDA 5AYAA 5AEBA 5A87A 5FQCA 4GCWA 2BIBA 4NQ2A 3X2ZA 2OHJA 2QDTA 4C1DA 1KO3A 5ACRA 2WRSA 3RPCA 4U4LA 1X8HA 4P62A 5EWAA 3X30A 3I0VA 2BG8A 4UBQA 4C1EA 5FQAA 2FU7A 2GCUA 5KILA 1SMLA 3I13A 3IE0A 2Q9UA 3BK2A 5EV6A 5ACUA
chains in the Genus database with same CATH superfamily
2BR6A 4AWYB 3ESHA 5HISA 4UA4A 1DD6A 5LCHA 4WD6A 3LVZA 2NZEA 4TYTA 4UWPB 4EXYA 3L6NA 4D1UA 3PG4A 2CG3A 2P18A 5HH5A 4F6HA 3X2XA 5K4MA 2I7XA 4NQ4A 4C1HA 4J5HA 4ZNBA 4D1TA 4HL1A 4FEKA 2FU8A 2BTNA 3TP9A 4PVTA 2GFJA 5LM6A 5EVBA 5B1UA 3IE2A 2XR1A 4UWSB 4DIKA 4C1GA 4RL0A 2QINA 2GMNA 3F9OA 1WRAA 2GKLA 2BFKA 5AIJA 4YSKA 1KR3A 2M5DA 2YZ3A 5HH6A 4BP0A 4JO0A 2Q0JA 1VGNA 3ADRA 1YCHA 1A7TA 2I7VA 2NYPA 5AHRA 3KL7A 5B15A 4Z7RA 4TZEA 5HIQA 5HIOA 3P2UA 3S0ZA 4NQ5A 3BV6A 2BMIA 5ACQA 1X8IA 2FU9A 4J5FA 2QJSA 2YNVA 3ZWFA 3SFPA 5AXOA 2E7YA 4KEPA 5A0VA 3ZNBA 2Y8BA 4XUKA 4GYUA 2DOOA 2ZNBA 2UYXA 4LE6A 3A4YA 4EYBA 4V0HA 4UAMA 5A5ZA 3R2UA 1QH5A 2Y8AA 5AJLA 3BC2A 3IOGA 2QDSA 2P4ZA 3AF5A 3FAIA 5B3RA 3X2YA 3PY5A 2YNTB 3BK1A 5IQKA 4Z5ZA 3SD9A 1E5DA 2CFZA 2ZO4A 3WXCA 4YSLA 1XM8A 2OHHA 2HB9A 2BFLA 1K07A 4UWOB 1MQOA 2CFUA 4ZEJA 2FM6A 2YHEA 4C1FA 4O98A 4RM5A 4UWRB 4XWTA 4RL2A 3PY6A 3DHCA 4ZO3A 3QH8A 1WW1A 4KEQA 5ACTA 1ZNBA 1WUOA 4AD9A 4BZ3A 2ZZIA 2Q0IA 5HH4A 5KIKA 3SBLA 3DHAA 4TYFA 4FR7A 4GYQA 5EH9A 4Z67A 1QH3A 5EW0A 3IELA 3KNSA 3VQZA 2AIOA 5EVDA 4RBSA 5FQBA 2P1EA 2WYLA 4PVOA 1JJEA 4EXSA 2AZ4A 1ZTCA 4Z5YA 1YCGA 2OHIA 2QEDA 3I15A 3I11A 3T9MA 5LCFA 2FK6A 4NURA 2YNUA 5DPXA 2R2DA 1X8GA 1ZKPA 3SRXA 5ACXA 2NXAA 5ACPA 1XTOA 2ZWRA 2XF4A 5AXRA 1YCFA 4CHLA 3I14A 3SPUA 5A0TA 2BFZB 3T3OA 2Q42A 3Q6VA 5LMCA 3IOFA 5EHTA 4F6ZA 3IDZA 3G1PA 5HIPA 1VMEA 4EFZA 4TZFA 4AX0B 2I7TA 1BC2A 4AWZA 5LE1A 2BG2A 4TZ9A 2BG8B 2DKFA 3MD7A 5LSCA 2YNTA 3IEMA 2BG6A 3AF6A 4RAWA 1VJNA 4RAMA 2FU6A 2FHXB 5K4NA 4Z6XA 2VW8A 4DILA 4XWWA 4TZBA 3DHBA 4ZO2A 3FCZA 4FSBA 2FHXA 2GFKA 4PDXA 4D1VA 4YSBA 5LS3A 3T3NA 3RKJA 5EVKA 3IEKA 5ACSA 2P97A 4AX1B 5ACWA 3AJ3A 1HLKA 1KO2A 3KNRA 5ACVA 4B87A 2WYMC 5LCAA 4EY2A 2YNWA 5EV8A 2BGAA 5AHOA 2CBNA 1Y44A 2Y87A 1DDKA 4D02A 3VPEA 1A8TA 4D1WA 2YCBA 4HKYA 2BG7A 2M5CA 4AXHA 5A23A 1JT1A 2CG2A 3H3EA 3ZR9A 1BVTA 1P9EA 3SW3A 4EYFA 2BC2A 2WHGA 4EYLA 4H0DA 2YNVB 3RKKA 1WUPA 1JJTA 2H6AA 1DXKA 3JXPA 3DH8A 2WYMA 1M2XA 4HL2A 1BMCA 3IE1A 2NZFA 4NQ6A 5K4KA 3ZQ4A 4C1CA 5K0WA 1L9YA 4Z60A 2A7MA 2BFZA 4C09A 5LLDA 5AYAA 5AEBA 5A87A 5FQCA 4GCWA 2BIBA 4NQ2A 3X2ZA 2OHJA 2QDTA 4C1DA 1KO3A 5ACRA 2WRSA 3RPCA 4U4LA 1X8HA 4P62A 5EWAA 3X30A 3I0VA 2BG8A 4UBQA 4C1EA 5FQAA 4AV7A 2FU7A 2GCUA 1SMLA 3I13A 5KILA 3IE0A 2Q9UA 3BK2A 5EV6A 5ACUA
chains in the Genus database with same CATH topology
2BR6A 4AWYB 3ESHA 5HISA 4UA4A 1DD6A 5LCHA 4WD6A 3LVZA 2NZEA 4TYTA 4UWPB 4EXYA 3L6NA 4D1UA 3PG4A 2P18A 5HH5A 4F6HA 3X2XA 5K4MA 2I7XA 4NQ4A 4C1HA 4J5HA 4ZNBA 4D1TA 4HL1A 4FEKA 2FU8A 2BTNA 3TP9A 4PVTA 2GFJA 5LM6A 5EVBA 5B1UA 3IE2A 2XR1A 4UWSB 4DIKA 4C1GA 4RL0A 2QINA 2GMNA 3F9OA 1WRAA 2GKLA 2BFKA 4YSKA 1KR3A 2M5DA 2YZ3A 5HH6A 4BP0A 4JO0A 2Q0JA 1VGNA 3ADRA 1YCHA 1A7TA 2I7VA 2NYPA 5AHRA 3KL7A 5B15A 4Z7RA 4TZEA 5HIQA 5HIOA 3P2UA 3S0ZA 4NQ5A 3BV6A 2BMIA 5ACQA 1X8IA 2FU9A 4J5FA 2QJSA 2YNVA 3ZWFA 3SFPA 5AXOA 2E7YA 4KEPA 5A0VA 3ZNBA 2Y8BA 4XUKA 4GYUA 2DOOA 2ZNBA 2UYXA 4LE6A 3A4YA 4EYBA 4V0HA 4UAMA 5A5ZA 3R2UA 1QH5A 2Y8AA 3BC2A 3IOGA 2QDSA 2P4ZA 3AF5A 3FAIA 5B3RA 3X2YA 3PY5A 2YNTB 3BK1A 5IQKA 4Z5ZA 3SD9A 1E5DA 2ZO4A 3WXCA 4YSLA 1XM8A 2OHHA 2HB9A 2BFLA 1K07A 4UWOB 1MQOA 4ZEJA 2FM6A 4C1FA 4O98A 4RM5A 4UWRB 4XWTA 4RL2A 3PY6A 3DHCA 4ZO3A 3QH8A 1WW1A 4KEQA 5ACTA 1ZNBA 1WUOA 4AD9A 4BZ3A 2ZZIA 2Q0IA 5HH4A 5KIKA 3SBLA 3DHAA 4TYFA 4FR7A 4GYQA 5EH9A 4Z67A 1QH3A 5EW0A 3IELA 3KNSA 3VQZA 2AIOA 5EVDA 4RBSA 5FQBA 2P1EA 2WYLA 4PVOA 1JJEA 4EXSA 2AZ4A 1ZTCA 4Z5YA 1YCGA 2OHIA 2QEDA 3I15A 3I11A 3T9MA 5LCFA 2FK6A 2YNUA 5DPXA 2R2DA 1X8GA 1ZKPA 3SRXA 5ACXA 2NXAA 5ACPA 1XTOA 2ZWRA 2XF4A 5AXRA 1YCFA 4CHLA 3I14A 3SPUA 5A0TA 2BFZB 3T3OA 2Q42A 3Q6VA 5LMCA 3IOFA 5EHTA 4F6ZA 3IDZA 3G1PA 5HIPA 1VMEA 4EFZA 4TZFA 4AX0B 2I7TA 1BC2A 4AWZA 5LE1A 2BG2A 4TZ9A 2BG8B 2DKFA 3MD7A 5LSCA 2YNTA 3IEMA 2BG6A 3AF6A 4RAWA 1VJNA 4RAMA 2FU6A 2FHXB 5K4NA 4Z6XA 2VW8A 4DILA 4XWWA 4TZBA 3DHBA 4ZO2A 3FCZA 4FSBA 2FHXA 2GFKA 4D1VA 4YSBA 5LS3A 3T3NA 3RKJA 5EVKA 3IEKA 5ACSA 2P97A 4AX1B 5ACWA 3AJ3A 1HLKA 1KO2A 3KNRA 5ACVA 4B87A 2WYMC 5LCAA 4EY2A 2YNWA 5EV8A 2BGAA 5AHOA 2CBNA 1Y44A 2Y87A 1DDKA 4D02A 3VPEA 1A8TA 4D1WA 2YCBA 4HKYA 2BG7A 2M5CA 1JT1A 3H3EA 3ZR9A 1BVTA 1P9EA 3SW3A 4EYFA 2BC2A 2WHGA 4EYLA 4H0DA 2YNVB 3RKKA 1WUPA 1JJTA 2H6AA 1DXKA 3JXPA 3DH8A 2WYMA 1M2XA 4HL2A 1BMCA 3IE1A 2NZFA 4NQ6A 5K4KA 3ZQ4A 4C1CA 5K0WA 1L9YA 4Z60A 2A7MA 2BFZA 4C09A 5LLDA 5AYAA 5AEBA 5A87A 5FQCA 4GCWA 2BIBA 4NQ2A 3X2ZA 2OHJA 2QDTA 4C1DA 1KO3A 5ACRA 2WRSA 3RPCA 4U4LA 1X8HA 4P62A 5EWAA 3X30A 3I0VA 2BG8A 4UBQA 4C1EA 5FQAA 2FU7A 2GCUA 5KILA 1SMLA 3I13A 3IE0A 2Q9UA 3BK2A 5EV6A 5ACUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BR6 A;  4AWY B;  3ESH A;  5HIS A;  4UA4 A;  1DD6 A;  5LCH A;  4WD6 A;  3LVZ A;  2NZE A;  4TYT A;  4UWP B;  4EXY A;  3L6N A;  4D1U A;  3PG4 A;  2P18 A;  5HH5 A;  4F6H A;  3X2X A;  5K4M A;  2I7X A;  4NQ4 A;  4C1H A;  4J5H A;  4ZNB A;  4D1T A;  4HL1 A;  4FEK A;  2FU8 A;  2BTN A;  3TP9 A;  4PVT A;  2GFJ A;  5LM6 A;  5EVB A;  5B1U A;  3IE2 A;  2XR1 A;  4UWS B;  4DIK A;  4C1G A;  4RL0 A;  2QIN A;  2GMN A;  3F9O A;  1WRA A;  2GKL A;  2BFK A;  4YSK A;  1KR3 A;  2M5D A;  2YZ3 A;  5HH6 A;  4BP0 A;  4JO0 A;  2Q0J A;  1VGN A;  3ADR A;  1YCH A;  1A7T A;  2I7V A;  2NYP A;  5AHR A;  3KL7 A;  5B15 A;  4Z7R A;  4TZE A;  5HIQ A;  5HIO A;  3P2U A;  3S0Z A;  4NQ5 A;  3BV6 A;  2BMI A;  5ACQ A;  1X8I A;  2FU9 A;  4J5F A;  2QJS A;  2YNV A;  3ZWF A;  3SFP A;  5AXO A;  2E7Y A;  4KEP A;  5A0V A;  3ZNB A;  2Y8B A;  4XUK A;  4GYU A;  2DOO A;  2ZNB A;  2UYX A;  4LE6 A;  3A4Y A;  4EYB A;  4V0H A;  4UAM A;  5A5Z A;  3R2U A;  1QH5 A;  2Y8A A;  3BC2 A;  3IOG A;  2QDS A;  2P4Z A;  3AF5 A;  3FAI A;  5B3R A;  3X2Y A;  3PY5 A;  2YNT B;  3BK1 A;  5IQK A;  4Z5Z A;  3SD9 A;  1E5D A;  2ZO4 A;  3WXC A;  4YSL A;  1XM8 A;  2OHH A;  2HB9 A;  2BFL A;  1K07 A;  4UWO B;  1MQO A;  4ZEJ A;  2FM6 A;  4C1F A;  4O98 A;  4RM5 A;  4UWR B;  4XWT A;  4RL2 A;  3PY6 A;  3DHC A;  4ZO3 A;  3QH8 A;  1WW1 A;  4KEQ A;  5ACT A;  1ZNB A;  1WUO A;  4AD9 A;  4BZ3 A;  2ZZI A;  2Q0I A;  5HH4 A;  5KIK A;  3SBL A;  3DHA A;  4TYF A;  4FR7 A;  4GYQ A;  5EH9 A;  4Z67 A;  1QH3 A;  5EW0 A;  3IEL A;  3KNS A;  3VQZ A;  2AIO A;  5EVD A;  4RBS A;  5FQB A;  2P1E A;  2WYL A;  4PVO A;  1JJE A;  4EXS A;  2AZ4 A;  1ZTC A;  4Z5Y A;  1YCG A;  2OHI A;  2QED A;  3I15 A;  3I11 A;  3T9M A;  5LCF A;  2FK6 A;  2YNU A;  5DPX A;  2R2D A;  1X8G A;  1ZKP A;  3SRX A;  5ACX A;  2NXA A;  5ACP A;  1XTO A;  2ZWR A;  2XF4 A;  5AXR A;  1YCF A;  4CHL A;  3I14 A;  3SPU A;  5A0T A;  2BFZ B;  3T3O A;  2Q42 A;  3Q6V A;  5LMC A;  3IOF A;  5EHT A;  4F6Z A;  3IDZ A;  3G1P A;  5HIP A;  1VME A;  4EFZ A;  4TZF A;  4AX0 B;  2I7T A;  1BC2 A;  4AWZ A;  5LE1 A;  2BG2 A;  4TZ9 A;  2BG8 B;  2DKF A;  3MD7 A;  5LSC A;  2YNT A;  3IEM A;  2BG6 A;  3AF6 A;  4RAW A;  1VJN A;  4RAM A;  2FU6 A;  2FHX B;  5K4N A;  4Z6X A;  2VW8 A;  4DIL A;  4XWW A;  4TZB A;  3DHB A;  4ZO2 A;  3FCZ A;  4FSB A;  2FHX A;  2GFK A;  4D1V A;  4YSB A;  5LS3 A;  3T3N A;  3RKJ A;  5EVK A;  3IEK A;  5ACS A;  2P97 A;  4AX1 B;  5ACW A;  3AJ3 A;  1HLK A;  1KO2 A;  3KNR A;  5ACV A;  4B87 A;  2WYM C;  5LCA A;  4EY2 A;  2YNW A;  5EV8 A;  2BGA A;  5AHO A;  2CBN A;  1Y44 A;  2Y87 A;  1DDK A;  4D02 A;  3VPE A;  1A8T A;  4D1W A;  2YCB A;  4HKY A;  2BG7 A;  2M5C A;  1JT1 A;  3H3E A;  3ZR9 A;  1BVT A;  1P9E A;  3SW3 A;  4EYF A;  2BC2 A;  2WHG A;  4EYL A;  4H0D A;  2YNV B;  3RKK A;  1WUP A;  1JJT A;  2H6A A;  1DXK A;  3JXP A;  3DH8 A;  2WYM A;  1M2X A;  4HL2 A;  1BMC A;  3IE1 A;  2NZF A;  4NQ6 A;  5K4K A;  3ZQ4 A;  4C1C A;  5K0W A;  1L9Y A;  4Z60 A;  2A7M A;  2BFZ A;  4C09 A;  5LLD A;  5AYA A;  5AEB A;  5A87 A;  5FQC A;  4GCW A;  2BIB A;  4NQ2 A;  3X2Z A;  2OHJ A;  2QDT A;  4C1D A;  1KO3 A;  5ACR A;  2WRS A;  3RPC A;  4U4L A;  1X8H A;  4P62 A;  5EWA A;  3X30 A;  3I0V A;  2BG8 A;  4UBQ A;  4C1E A;  5FQA A;  2FU7 A;  2GCU A;  5KIL A;  1SML A;  3I13 A;  3IE0 A;  2Q9U A;  3BK2 A;  5EV6 A;  5ACU A; 
#chains in the Genus database with same CATH topology
 2BR6 A;  4AWY B;  3ESH A;  5HIS A;  4UA4 A;  1DD6 A;  5LCH A;  4WD6 A;  3LVZ A;  2NZE A;  4TYT A;  4UWP B;  4EXY A;  3L6N A;  4D1U A;  3PG4 A;  2CG3 A;  2P18 A;  5HH5 A;  4F6H A;  3X2X A;  5K4M A;  2I7X A;  4NQ4 A;  4C1H A;  4J5H A;  4ZNB A;  4D1T A;  4HL1 A;  4FEK A;  2FU8 A;  2BTN A;  3TP9 A;  4PVT A;  2GFJ A;  5LM6 A;  5EVB A;  5B1U A;  3IE2 A;  2XR1 A;  4UWS B;  4DIK A;  4C1G A;  4RL0 A;  2QIN A;  2GMN A;  3F9O A;  1WRA A;  2GKL A;  2BFK A;  5AIJ A;  4YSK A;  1KR3 A;  2M5D A;  2YZ3 A;  5HH6 A;  4BP0 A;  4JO0 A;  2Q0J A;  1VGN A;  3ADR A;  1YCH A;  1A7T A;  2I7V A;  2NYP A;  5AHR A;  3KL7 A;  5B15 A;  4Z7R A;  4TZE A;  5HIQ A;  5HIO A;  3P2U A;  3S0Z A;  4NQ5 A;  3BV6 A;  2BMI A;  5ACQ A;  1X8I A;  2FU9 A;  4J5F A;  2QJS A;  2YNV A;  3ZWF A;  3SFP A;  5AXO A;  2E7Y A;  4KEP A;  5A0V A;  3ZNB A;  2Y8B A;  4XUK A;  4GYU A;  2DOO A;  2ZNB A;  2UYX A;  4LE6 A;  3A4Y A;  4EYB A;  4V0H A;  4UAM A;  5A5Z A;  3R2U A;  1QH5 A;  2Y8A A;  5AJL A;  3BC2 A;  3IOG A;  2QDS A;  2P4Z A;  3AF5 A;  3FAI A;  5B3R A;  3X2Y A;  3PY5 A;  2YNT B;  3BK1 A;  5IQK A;  4Z5Z A;  3SD9 A;  1E5D A;  2CFZ A;  2ZO4 A;  3WXC A;  4YSL A;  1XM8 A;  2OHH A;  2HB9 A;  2BFL A;  1K07 A;  4UWO B;  1MQO A;  2CFU A;  4ZEJ A;  2FM6 A;  2YHE A;  4C1F A;  4O98 A;  4RM5 A;  4UWR B;  4XWT A;  4RL2 A;  3PY6 A;  3DHC A;  4ZO3 A;  3QH8 A;  1WW1 A;  4KEQ A;  5ACT A;  1ZNB A;  1WUO A;  4AD9 A;  4BZ3 A;  2ZZI A;  2Q0I A;  5HH4 A;  5KIK A;  3SBL A;  3DHA A;  4TYF A;  4FR7 A;  4GYQ A;  5EH9 A;  4Z67 A;  1QH3 A;  5EW0 A;  3IEL A;  3KNS A;  3VQZ A;  2AIO A;  5EVD A;  4RBS A;  5FQB A;  2P1E A;  2WYL A;  4PVO A;  1JJE A;  4EXS A;  2AZ4 A;  1ZTC A;  4Z5Y A;  1YCG A;  2OHI A;  2QED A;  3I15 A;  3I11 A;  3T9M A;  5LCF A;  2FK6 A;  4NUR A;  2YNU A;  5DPX A;  2R2D A;  1X8G A;  1ZKP A;  3SRX A;  5ACX A;  2NXA A;  5ACP A;  1XTO A;  2ZWR A;  2XF4 A;  5AXR A;  1YCF A;  4CHL A;  3I14 A;  3SPU A;  5A0T A;  2BFZ B;  3T3O A;  2Q42 A;  3Q6V A;  5LMC A;  3IOF A;  5EHT A;  4F6Z A;  3IDZ A;  3G1P A;  5HIP A;  1VME A;  4EFZ A;  4TZF A;  4AX0 B;  2I7T A;  1BC2 A;  4AWZ A;  5LE1 A;  2BG2 A;  4TZ9 A;  2BG8 B;  2DKF A;  3MD7 A;  5LSC A;  2YNT A;  3IEM A;  2BG6 A;  3AF6 A;  4RAW A;  1VJN A;  4RAM A;  2FU6 A;  2FHX B;  5K4N A;  4Z6X A;  2VW8 A;  4DIL A;  4XWW A;  4TZB A;  3DHB A;  4ZO2 A;  3FCZ A;  4FSB A;  2FHX A;  2GFK A;  4PDX A;  4D1V A;  4YSB A;  5LS3 A;  3T3N A;  3RKJ A;  5EVK A;  3IEK A;  5ACS A;  2P97 A;  4AX1 B;  5ACW A;  3AJ3 A;  1HLK A;  1KO2 A;  3KNR A;  5ACV A;  4B87 A;  2WYM C;  5LCA A;  4EY2 A;  2YNW A;  5EV8 A;  2BGA A;  5AHO A;  2CBN A;  1Y44 A;  2Y87 A;  1DDK A;  4D02 A;  3VPE A;  1A8T A;  4D1W A;  2YCB A;  4HKY A;  2BG7 A;  2M5C A;  4AXH A;  5A23 A;  1JT1 A;  2CG2 A;  3H3E A;  3ZR9 A;  1BVT A;  1P9E A;  3SW3 A;  4EYF A;  2BC2 A;  2WHG A;  4EYL A;  4H0D A;  2YNV B;  3RKK A;  1WUP A;  1JJT A;  2H6A A;  1DXK A;  3JXP A;  3DH8 A;  2WYM A;  1M2X A;  4HL2 A;  1BMC A;  3IE1 A;  2NZF A;  4NQ6 A;  5K4K A;  3ZQ4 A;  4C1C A;  5K0W A;  1L9Y A;  4Z60 A;  2A7M A;  2BFZ A;  4C09 A;  5LLD A;  5AYA A;  5AEB A;  5A87 A;  5FQC A;  4GCW A;  2BIB A;  4NQ2 A;  3X2Z A;  2OHJ A;  2QDT A;  4C1D A;  1KO3 A;  5ACR A;  2WRS A;  3RPC A;  4U4L A;  1X8H A;  4P62 A;  5EWA A;  3X30 A;  3I0V A;  2BG8 A;  4UBQ A;  4C1E A;  5FQA A;  4AV7 A;  2FU7 A;  2GCU A;  1SML A;  3I13 A;  5KIL A;  3IE0 A;  2Q9U A;  3BK2 A;  5EV6 A;  5ACU A; 
#chains in the Genus database with same CATH homology
 2BR6 A;  4AWY B;  3ESH A;  5HIS A;  4UA4 A;  1DD6 A;  5LCH A;  4WD6 A;  3LVZ A;  2NZE A;  4TYT A;  4UWP B;  4EXY A;  3L6N A;  4D1U A;  3PG4 A;  2P18 A;  5HH5 A;  4F6H A;  3X2X A;  5K4M A;  2I7X A;  4NQ4 A;  4C1H A;  4J5H A;  4ZNB A;  4D1T A;  4HL1 A;  4FEK A;  2FU8 A;  2BTN A;  3TP9 A;  4PVT A;  2GFJ A;  5LM6 A;  5EVB A;  5B1U A;  3IE2 A;  2XR1 A;  4UWS B;  4DIK A;  4C1G A;  4RL0 A;  2QIN A;  2GMN A;  3F9O A;  1WRA A;  2GKL A;  2BFK A;  4YSK A;  1KR3 A;  2M5D A;  2YZ3 A;  5HH6 A;  4BP0 A;  4JO0 A;  2Q0J A;  1VGN A;  3ADR A;  1YCH A;  1A7T A;  2I7V A;  2NYP A;  5AHR A;  3KL7 A;  5B15 A;  4Z7R A;  4TZE A;  5HIQ A;  5HIO A;  3P2U A;  3S0Z A;  4NQ5 A;  3BV6 A;  2BMI A;  5ACQ A;  1X8I A;  2FU9 A;  4J5F A;  2QJS A;  2YNV A;  3ZWF A;  3SFP A;  5AXO A;  2E7Y A;  4KEP A;  5A0V A;  3ZNB A;  2Y8B A;  4XUK A;  4GYU A;  2DOO A;  2ZNB A;  2UYX A;  4LE6 A;  3A4Y A;  4EYB A;  4V0H A;  4UAM A;  5A5Z A;  3R2U A;  1QH5 A;  2Y8A A;  3BC2 A;  3IOG A;  2QDS A;  2P4Z A;  3AF5 A;  3FAI A;  5B3R A;  3X2Y A;  3PY5 A;  2YNT B;  3BK1 A;  5IQK A;  4Z5Z A;  3SD9 A;  1E5D A;  2ZO4 A;  3WXC A;  4YSL A;  1XM8 A;  2OHH A;  2HB9 A;  2BFL A;  1K07 A;  4UWO B;  1MQO A;  4ZEJ A;  2FM6 A;  4C1F A;  4O98 A;  4RM5 A;  4UWR B;  4XWT A;  4RL2 A;  3PY6 A;  3DHC A;  4ZO3 A;  3QH8 A;  1WW1 A;  4KEQ A;  5ACT A;  1ZNB A;  1WUO A;  4AD9 A;  4BZ3 A;  2ZZI A;  2Q0I A;  5HH4 A;  5KIK A;  3SBL A;  3DHA A;  4TYF A;  4FR7 A;  4GYQ A;  5EH9 A;  4Z67 A;  1QH3 A;  5EW0 A;  3IEL A;  3KNS A;  3VQZ A;  2AIO A;  5EVD A;  4RBS A;  5FQB A;  2P1E A;  2WYL A;  4PVO A;  1JJE A;  4EXS A;  2AZ4 A;  1ZTC A;  4Z5Y A;  1YCG A;  2OHI A;  2QED A;  3I15 A;  3I11 A;  3T9M A;  5LCF A;  2FK6 A;  2YNU A;  5DPX A;  2R2D A;  1X8G A;  1ZKP A;  3SRX A;  5ACX A;  2NXA A;  5ACP A;  1XTO A;  2ZWR A;  2XF4 A;  5AXR A;  1YCF A;  4CHL A;  3I14 A;  3SPU A;  5A0T A;  2BFZ B;  3T3O A;  2Q42 A;  3Q6V A;  5LMC A;  3IOF A;  5EHT A;  4F6Z A;  3IDZ A;  3G1P A;  5HIP A;  1VME A;  4EFZ A;  4TZF A;  4AX0 B;  2I7T A;  1BC2 A;  4AWZ A;  5LE1 A;  2BG2 A;  4TZ9 A;  2BG8 B;  2DKF A;  3MD7 A;  5LSC A;  2YNT A;  3IEM A;  2BG6 A;  3AF6 A;  4RAW A;  1VJN A;  4RAM A;  2FU6 A;  2FHX B;  5K4N A;  4Z6X A;  2VW8 A;  4DIL A;  4XWW A;  4TZB A;  3DHB A;  4ZO2 A;  3FCZ A;  4FSB A;  2FHX A;  2GFK A;  4D1V A;  4YSB A;  5LS3 A;  3T3N A;  3RKJ A;  5EVK A;  3IEK A;  5ACS A;  2P97 A;  4AX1 B;  5ACW A;  3AJ3 A;  1HLK A;  1KO2 A;  3KNR A;  5ACV A;  4B87 A;  2WYM C;  5LCA A;  4EY2 A;  2YNW A;  5EV8 A;  2BGA A;  5AHO A;  2CBN A;  1Y44 A;  2Y87 A;  1DDK A;  4D02 A;  3VPE A;  1A8T A;  4D1W A;  2YCB A;  4HKY A;  2BG7 A;  2M5C A;  1JT1 A;  3H3E A;  3ZR9 A;  1BVT A;  1P9E A;  3SW3 A;  4EYF A;  2BC2 A;  2WHG A;  4EYL A;  4H0D A;  2YNV B;  3RKK A;  1WUP A;  1JJT A;  2H6A A;  1DXK A;  3JXP A;  3DH8 A;  2WYM A;  1M2X A;  4HL2 A;  1BMC A;  3IE1 A;  2NZF A;  4NQ6 A;  5K4K A;  3ZQ4 A;  4C1C A;  5K0W A;  1L9Y A;  4Z60 A;  2A7M A;  2BFZ A;  4C09 A;  5LLD A;  5AYA A;  5AEB A;  5A87 A;  5FQC A;  4GCW A;  2BIB A;  4NQ2 A;  3X2Z A;  2OHJ A;  2QDT A;  4C1D A;  1KO3 A;  5ACR A;  2WRS A;  3RPC A;  4U4L A;  1X8H A;  4P62 A;  5EWA A;  3X30 A;  3I0V A;  2BG8 A;  4UBQ A;  4C1E A;  5FQA A;  2FU7 A;  2GCU A;  5KIL A;  1SML A;  3I13 A;  3IE0 A;  2Q9U A;  3BK2 A;  5EV6 A;  5ACU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...