1XM8A

X-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
254
structure length
254
Chain Sequence
MQIELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGIDMALKDGDKWMFAGHEVHVMDTPGHTKGHISLYFPGSRAIFTGDTMFSLSCGKLFEGTPKQMLASLQKITSLPDDTSIYCGHEYTLSNSKFALSLEPNNEVLQSYAAHVAELRSKKLPTIPTTVKMEKACNPFLRSSNTDIRRALRIPEAADEAEALGIIRKAKDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on a mitochondrial glyoxalase II.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords glyoxalase II
total genus 97
structure length 254
sequence length 254
chains with identical sequence B
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2004-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1xm8A00
4U4LA 3T9MA 2Q42A 2YNVA 4J5HA 2DOOA 4RM5A 4J5FA 1KR3A 2BFLA 2BMIA 5AHRA 3BK2A 3I14A 4C1DA 4AX1B 1VMEA 5B15A 3WXCA 4Z5YA 5B3RA 5ACQA 1JJEA 4Z67A 3BV6A 4RL2A 5EH9A 1QH3A 2ZNBA 5DPXA 4UA4A 5HH5A 1JJTA 4EYLA 4TZ9A 2GKLA 5LM6A 2Q9UA 5LCHA 1L9YA 1WUOA 4UWRB 4GYUA 2BFZB 4FEKA 2I7VA 2QINA 2QJSA 2I7TA 3ZWFA 2UYXA 1DD6A 5HISA 2XF4A 3SPUA 2GFJA 4XWTA 1YCFA 2BFKA 5A87A 4UWOB 3JXPA 2FK6A 2HB9A 2BFZA 5EW0A 2Y8AA 3VQZA 2YCBA 2XR1A 5LLDA 2Q0JA 4NQ5A 3I11A 5KILA 4HKYA 2BTNA 5ACWA 2M5CA 5FQAA 4DIKA 1ZTCA 4V0HA 3QH8A 2Y87A 2H6AA 2BC2A 2FHXB 2FU8A 5LE1A 2FU7A 2FM6A 5ACSA 5K0WA 5FQCA 4NQ4A 3IEKA 4RBSA 1A8TA 2BG8A 2YZ3A 1K07A 2P1EA 3FCZA 3I0VA 3PY5A 5LCAA 4EYBA 4BZ3A 3MD7A 3BK1A 3IEMA 2BG8B 5EHTA 4B87A 2CBNA 2Q0IA 3SFPA 3L6NA 3IELA 3X30A 4TZFA 2GMNA 2Y8BA 2OHHA 5K4KA 1QH5A 4ZO3A 4EYFA 2DKFA 5EV6A 5HH6A 4PVOA 4JO0A 4UBQA 3KL7A 3ZR9A 3SD9A 1SMLA 4Z60A 2BGAA 4GCWA 2YNVB 3DHBA 4PVTA 5K4NA 3IOFA 2NZEA 5AYAA 4XUKA 5FQBA 4FR7A 2BG2A 2WYLA 5AXRA 5HH4A 3VPEA 4TZBA 5ACPA 3X2XA 4CHLA 4TYTA 4UAMA 4XWWA 4WD6A 5LCFA 2BG6A 5EWAA 2VW8A 1WW1A 1X8GA 5HIOA 1BVTA 4YSBA 3F9OA 1XTOA 2E7YA 2A7MA 4KEQA 4EFZA 4Z7RA 4BP0A 1Y44A 4O98A 5EV8A 4AD9A 5AXOA 4RL0A 5LMCA 5LS3A 3AF6A 1M2XA 1P9EA 3IDZA 4UWSB 5A5ZA 2NXAA 5ACUA 2BG7A 2GCUA 2WRSA 1KO2A 1XM8A 1HLKA 5ACXA 4ZEJA 4C1EA 3PG4A 4ZNBA 4D1TA 2ZO4A 1VJNA 5A0TA 2FU6A 3DHAA 4RAWA 5A0VA 3ESHA 3Q6VA 3G1PA 3H3EA 1VGNA 3DH8A 3I13A 3X2ZA 4EY2A 1WRAA 4C1GA 2ZZIA 5ACVA 4D1UA 2FHXA 2NZFA 4YSKA 4DILA 3IE0A 2YNUA 2OHIA 4EXSA 2YNTB 5ACRA 4Z5ZA 4P62A 3X2YA 3SW3A 4HL2A 4AWZA 1E5DA 2YNWA 1BC2A 2OHJA 1JT1A 3IE1A 3RKKA 4FSBA 2GFKA 4AX0B 4F6HA 4D1VA 3PY6A 4Z6XA 4H0DA 3LVZA 4HL1A 3RKJA 4RAMA 1DDKA 5LSCA 4NQ2A 4AWYB 4TZEA 5KIKA 4ZO2A 4TYFA 2WYMA 3BC2A 2QEDA 2QDSA 4C09A 3R2UA 1WUPA 2I7XA 4C1FA 2FU9A 3T3NA 4GYQA 4YSLA 4C1HA 3IOGA 3IE2A 3KNSA 3ZQ4A 3T3OA 2P97A 1X8IA 3AF5A 3TP9A 4UWPB 2YNTA 4EXYA 5HIQA 5EVDA 1KO3A 5IQKA 2AIOA 2P4ZA 3FAIA 1YCGA 1A7TA 5K4MA 2M5DA 4C1CA 3SRXA 3ZNBA 2NYPA 2ZWRA 2AZ4A 4D02A 2R2DA 5EVKA 2QDTA 1BMCA 3A4YA 5EVBA 1MQOA 5B1UA 4F6ZA 3ADRA 1ZNBA 4LE6A 2BIBA 2WYMC 3AJ3A 1DXKA 3RPCA 5AHOA 3I15A 3KNRA 5AEBA 5ACTA 5HIPA 1X8HA 3SBLA 2WHGA 3S0ZA 4NQ6A 3DHCA 2P18A 4KEPA 2BR6A 3P2UA 4D1WA 1YCHA 1ZKPA
chains in the Genus database with same CATH superfamily
4U4LA 3T9MA 2Q42A 2YNVA 4J5HA 2DOOA 4RM5A 4J5FA 1KR3A 2BFLA 2BMIA 5AHRA 3BK2A 3I14A 4C1DA 4AX1B 1VMEA 5B15A 2YHEA 3WXCA 4Z5YA 5B3RA 5ACQA 1JJEA 4Z67A 3BV6A 4RL2A 5EH9A 1QH3A 2ZNBA 5DPXA 4UA4A 5HH5A 1JJTA 4EYLA 4TZ9A 2GKLA 5LM6A 2Q9UA 5LCHA 1L9YA 1WUOA 4UWRB 4GYUA 2BFZB 4FEKA 2I7VA 2QINA 2QJSA 2I7TA 3ZWFA 2UYXA 1DD6A 5HISA 2XF4A 3SPUA 2GFJA 4XWTA 1YCFA 2BFKA 5A87A 4UWOB 3JXPA 2FK6A 2HB9A 2BFZA 2CG2A 5EW0A 2Y8AA 3VQZA 2YCBA 2XR1A 5LLDA 2Q0JA 4NQ5A 3I11A 4HKYA 5ACWA 2BTNA 5KILA 2M5CA 5FQAA 4DIKA 1ZTCA 4V0HA 3QH8A 2Y87A 2H6AA 2BC2A 2FHXB 2FU8A 5LE1A 2FU7A 2FM6A 5ACSA 5K0WA 5FQCA 4NQ4A 3IEKA 4RBSA 1A8TA 2BG8A 2YZ3A 1K07A 2P1EA 3FCZA 3I0VA 3PY5A 5LCAA 4EYBA 4BZ3A 3MD7A 3BK1A 2CFZA 3IEMA 2BG8B 5EHTA 4B87A 2CBNA 2Q0IA 3SFPA 3L6NA 3IELA 3X30A 4TZFA 2GMNA 2Y8BA 2OHHA 5K4KA 1QH5A 4ZO3A 4EYFA 2DKFA 5EV6A 5HH6A 4PVOA 4JO0A 4UBQA 3KL7A 3ZR9A 3SD9A 1SMLA 4Z60A 2BGAA 4GCWA 2YNVB 3DHBA 4PVTA 5K4NA 3IOFA 2NZEA 5AYAA 4XUKA 5FQBA 4FR7A 2BG2A 2WYLA 5AXRA 5HH4A 3VPEA 4TZBA 5ACPA 3X2XA 4CHLA 4TYTA 4UAMA 4XWWA 4WD6A 5LCFA 2BG6A 5EWAA 2VW8A 1WW1A 1X8GA 5HIOA 1BVTA 4YSBA 3F9OA 4AXHA 1XTOA 2E7YA 2A7MA 4KEQA 4EFZA 4Z7RA 4BP0A 1Y44A 4O98A 5EV8A 4AD9A 5AXOA 4RL0A 4AV7A 5A23A 5LMCA 5LS3A 3AF6A 1M2XA 1P9EA 3IDZA 4UWSB 5A5ZA 2NXAA 5ACUA 2BG7A 2GCUA 2WRSA 1KO2A 1XM8A 1HLKA 5ACXA 4ZEJA 4C1EA 3PG4A 5AIJA 4ZNBA 4D1TA 2ZO4A 1VJNA 5A0TA 2FU6A 3DHAA 4RAWA 5A0VA 3ESHA 3Q6VA 3G1PA 3H3EA 1VGNA 3DH8A 3I13A 3X2ZA 4EY2A 1WRAA 4C1GA 2ZZIA 4PDXA 5ACVA 4D1UA 2FHXA 2NZFA 4YSKA 4DILA 3IE0A 2YNUA 2OHIA 4EXSA 2YNTB 5ACRA 4Z5ZA 4P62A 3X2YA 3SW3A 4HL2A 4AWZA 1E5DA 2YNWA 1BC2A 2OHJA 1JT1A 3IE1A 3RKKA 4FSBA 2GFKA 4AX0B 4F6HA 4D1VA 2CFUA 3PY6A 4Z6XA 4H0DA 3LVZA 4HL1A 3RKJA 4RAMA 1DDKA 5LSCA 4NQ2A 4AWYB 4TZEA 5KIKA 4ZO2A 4TYFA 2WYMA 3BC2A 2QEDA 2QDSA 4C09A 3R2UA 1WUPA 2I7XA 4C1FA 2FU9A 3T3NA 4GYQA 4YSLA 4C1HA 3IOGA 3IE2A 3KNSA 3ZQ4A 3T3OA 2P97A 1X8IA 3AF5A 5AJLA 4NURA 3TP9A 4UWPB 2YNTA 4EXYA 5HIQA 5EVDA 1KO3A 5IQKA 2AIOA 2P4ZA 3FAIA 1YCGA 1A7TA 5K4MA 2M5DA 4C1CA 3SRXA 3ZNBA 2NYPA 2ZWRA 2AZ4A 4D02A 2R2DA 5EVKA 2QDTA 1BMCA 3A4YA 5EVBA 1MQOA 5B1UA 4F6ZA 3ADRA 1ZNBA 2CG3A 4LE6A 2BIBA 2WYMC 3AJ3A 1DXKA 3RPCA 5AHOA 3I15A 3KNRA 5AEBA 5ACTA 5HIPA 1X8HA 3SBLA 2WHGA 3S0ZA 4NQ6A 3DHCA 2P18A 4KEPA 2BR6A 3P2UA 4D1WA 1YCHA 1ZKPA
chains in the Genus database with same CATH topology
4U4LA 3T9MA 2Q42A 2YNVA 4J5HA 2DOOA 4RM5A 4J5FA 1KR3A 2BFLA 2BMIA 5AHRA 3BK2A 3I14A 4C1DA 4AX1B 1VMEA 5B15A 3WXCA 4Z5YA 5B3RA 5ACQA 1JJEA 4Z67A 3BV6A 4RL2A 5EH9A 1QH3A 2ZNBA 5DPXA 4UA4A 5HH5A 1JJTA 4EYLA 4TZ9A 2GKLA 5LM6A 2Q9UA 5LCHA 1L9YA 1WUOA 4UWRB 4GYUA 2BFZB 4FEKA 2I7VA 2QINA 2QJSA 2I7TA 3ZWFA 2UYXA 1DD6A 5HISA 2XF4A 3SPUA 2GFJA 4XWTA 1YCFA 2BFKA 5A87A 4UWOB 3JXPA 2FK6A 2HB9A 2BFZA 5EW0A 2Y8AA 3VQZA 2YCBA 2XR1A 5LLDA 2Q0JA 4NQ5A 3I11A 5KILA 4HKYA 2BTNA 5ACWA 2M5CA 5FQAA 4DIKA 1ZTCA 4V0HA 3QH8A 2Y87A 2H6AA 2BC2A 2FHXB 2FU8A 5LE1A 2FU7A 2FM6A 5ACSA 5K0WA 5FQCA 4NQ4A 3IEKA 4RBSA 1A8TA 2BG8A 2YZ3A 1K07A 2P1EA 3FCZA 3I0VA 3PY5A 5LCAA 4EYBA 4BZ3A 3MD7A 3BK1A 3IEMA 2BG8B 5EHTA 4B87A 2CBNA 2Q0IA 3SFPA 3L6NA 3IELA 3X30A 4TZFA 2GMNA 2Y8BA 2OHHA 5K4KA 1QH5A 4ZO3A 4EYFA 2DKFA 5EV6A 5HH6A 4PVOA 4JO0A 4UBQA 3KL7A 3ZR9A 3SD9A 1SMLA 4Z60A 2BGAA 4GCWA 2YNVB 3DHBA 4PVTA 5K4NA 3IOFA 2NZEA 5AYAA 4XUKA 5FQBA 4FR7A 2BG2A 2WYLA 5AXRA 5HH4A 3VPEA 4TZBA 5ACPA 3X2XA 4CHLA 4TYTA 4UAMA 4XWWA 4WD6A 5LCFA 2BG6A 5EWAA 2VW8A 1WW1A 1X8GA 5HIOA 1BVTA 4YSBA 3F9OA 1XTOA 2E7YA 2A7MA 4KEQA 4EFZA 4Z7RA 4BP0A 1Y44A 4O98A 5EV8A 4AD9A 5AXOA 4RL0A 5LMCA 5LS3A 3AF6A 1M2XA 1P9EA 3IDZA 4UWSB 5A5ZA 2NXAA 5ACUA 2BG7A 2GCUA 2WRSA 1KO2A 1XM8A 1HLKA 5ACXA 4ZEJA 4C1EA 3PG4A 4ZNBA 4D1TA 2ZO4A 1VJNA 5A0TA 2FU6A 3DHAA 4RAWA 5A0VA 3ESHA 3Q6VA 3G1PA 3H3EA 1VGNA 3DH8A 3I13A 3X2ZA 4EY2A 1WRAA 4C1GA 2ZZIA 5ACVA 4D1UA 2FHXA 2NZFA 4YSKA 4DILA 3IE0A 2YNUA 2OHIA 4EXSA 2YNTB 5ACRA 4Z5ZA 4P62A 3X2YA 3SW3A 4HL2A 4AWZA 1E5DA 2YNWA 1BC2A 2OHJA 1JT1A 3IE1A 3RKKA 4FSBA 2GFKA 4AX0B 4F6HA 4D1VA 3PY6A 4Z6XA 4H0DA 3LVZA 4HL1A 3RKJA 4RAMA 1DDKA 5LSCA 4NQ2A 4AWYB 4TZEA 5KIKA 4ZO2A 4TYFA 2WYMA 3BC2A 2QEDA 2QDSA 4C09A 3R2UA 1WUPA 2I7XA 4C1FA 2FU9A 3T3NA 4GYQA 4YSLA 4C1HA 3IOGA 3IE2A 3KNSA 3ZQ4A 3T3OA 2P97A 1X8IA 3AF5A 3TP9A 4UWPB 2YNTA 4EXYA 5HIQA 5EVDA 1KO3A 5IQKA 2AIOA 2P4ZA 3FAIA 1YCGA 1A7TA 5K4MA 2M5DA 4C1CA 3SRXA 3ZNBA 2NYPA 2ZWRA 2AZ4A 4D02A 2R2DA 5EVKA 2QDTA 1BMCA 3A4YA 5EVBA 1MQOA 5B1UA 4F6ZA 3ADRA 1ZNBA 4LE6A 2BIBA 2WYMC 3AJ3A 1DXKA 3RPCA 5AHOA 3I15A 3KNRA 5AEBA 5ACTA 5HIPA 1X8HA 3SBLA 2WHGA 3S0ZA 4NQ6A 3DHCA 2P18A 4KEPA 2BR6A 3P2UA 4D1WA 1YCHA 1ZKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U4L A;  3T9M A;  2Q42 A;  2YNV A;  4J5H A;  2DOO A;  4RM5 A;  4J5F A;  1KR3 A;  2BFL A;  2BMI A;  5AHR A;  3BK2 A;  3I14 A;  4C1D A;  4AX1 B;  1VME A;  5B15 A;  3WXC A;  4Z5Y A;  5B3R A;  5ACQ A;  1JJE A;  4Z67 A;  3BV6 A;  4RL2 A;  5EH9 A;  1QH3 A;  2ZNB A;  5DPX A;  4UA4 A;  5HH5 A;  1JJT A;  4EYL A;  4TZ9 A;  2GKL A;  5LM6 A;  2Q9U A;  5LCH A;  1L9Y A;  1WUO A;  4UWR B;  4GYU A;  2BFZ B;  4FEK A;  2I7V A;  2QIN A;  2QJS A;  2I7T A;  3ZWF A;  2UYX A;  1DD6 A;  5HIS A;  2XF4 A;  3SPU A;  2GFJ A;  4XWT A;  1YCF A;  2BFK A;  5A87 A;  4UWO B;  3JXP A;  2FK6 A;  2HB9 A;  2BFZ A;  5EW0 A;  2Y8A A;  3VQZ A;  2YCB A;  2XR1 A;  5LLD A;  2Q0J A;  4NQ5 A;  3I11 A;  5KIL A;  4HKY A;  2BTN A;  5ACW A;  2M5C A;  5FQA A;  4DIK A;  1ZTC A;  4V0H A;  3QH8 A;  2Y87 A;  2H6A A;  2BC2 A;  2FHX B;  2FU8 A;  5LE1 A;  2FU7 A;  2FM6 A;  5ACS A;  5K0W A;  5FQC A;  4NQ4 A;  3IEK A;  4RBS A;  1A8T A;  2BG8 A;  2YZ3 A;  1K07 A;  2P1E A;  3FCZ A;  3I0V A;  3PY5 A;  5LCA A;  4EYB A;  4BZ3 A;  3MD7 A;  3BK1 A;  3IEM A;  2BG8 B;  5EHT A;  4B87 A;  2CBN A;  2Q0I A;  3SFP A;  3L6N A;  3IEL A;  3X30 A;  4TZF A;  2GMN A;  2Y8B A;  2OHH A;  5K4K A;  1QH5 A;  4ZO3 A;  4EYF A;  2DKF A;  5EV6 A;  5HH6 A;  4PVO A;  4JO0 A;  4UBQ A;  3KL7 A;  3ZR9 A;  3SD9 A;  1SML A;  4Z60 A;  2BGA A;  4GCW A;  2YNV B;  3DHB A;  4PVT A;  5K4N A;  3IOF A;  2NZE A;  5AYA A;  4XUK A;  5FQB A;  4FR7 A;  2BG2 A;  2WYL A;  5AXR A;  5HH4 A;  3VPE A;  4TZB A;  5ACP A;  3X2X A;  4CHL A;  4TYT A;  4UAM A;  4XWW A;  4WD6 A;  5LCF A;  2BG6 A;  5EWA A;  2VW8 A;  1WW1 A;  1X8G A;  5HIO A;  1BVT A;  4YSB A;  3F9O A;  1XTO A;  2E7Y A;  2A7M A;  4KEQ A;  4EFZ A;  4Z7R A;  4BP0 A;  1Y44 A;  4O98 A;  5EV8 A;  4AD9 A;  5AXO A;  4RL0 A;  5LMC A;  5LS3 A;  3AF6 A;  1M2X A;  1P9E A;  3IDZ A;  4UWS B;  5A5Z A;  2NXA A;  5ACU A;  2BG7 A;  2GCU A;  2WRS A;  1KO2 A;  1XM8 A;  1HLK A;  5ACX A;  4ZEJ A;  4C1E A;  3PG4 A;  4ZNB A;  4D1T A;  2ZO4 A;  1VJN A;  5A0T A;  2FU6 A;  3DHA A;  4RAW A;  5A0V A;  3ESH A;  3Q6V A;  3G1P A;  3H3E A;  1VGN A;  3DH8 A;  3I13 A;  3X2Z A;  4EY2 A;  1WRA A;  4C1G A;  2ZZI A;  5ACV A;  4D1U A;  2FHX A;  2NZF A;  4YSK A;  4DIL A;  3IE0 A;  2YNU A;  2OHI A;  4EXS A;  2YNT B;  5ACR A;  4Z5Z A;  4P62 A;  3X2Y A;  3SW3 A;  4HL2 A;  4AWZ A;  1E5D A;  2YNW A;  1BC2 A;  2OHJ A;  1JT1 A;  3IE1 A;  3RKK A;  4FSB A;  2GFK A;  4AX0 B;  4F6H A;  4D1V A;  3PY6 A;  4Z6X A;  4H0D A;  3LVZ A;  4HL1 A;  3RKJ A;  4RAM A;  1DDK A;  5LSC A;  4NQ2 A;  4AWY B;  4TZE A;  5KIK A;  4ZO2 A;  4TYF A;  2WYM A;  3BC2 A;  2QED A;  2QDS A;  4C09 A;  3R2U A;  1WUP A;  2I7X A;  4C1F A;  2FU9 A;  3T3N A;  4GYQ A;  4YSL A;  4C1H A;  3IOG A;  3IE2 A;  3KNS A;  3ZQ4 A;  3T3O A;  2P97 A;  1X8I A;  3AF5 A;  3TP9 A;  4UWP B;  2YNT A;  4EXY A;  5HIQ A;  5EVD A;  1KO3 A;  5IQK A;  2AIO A;  2P4Z A;  3FAI A;  1YCG A;  1A7T A;  5K4M A;  2M5D A;  4C1C A;  3SRX A;  3ZNB A;  2NYP A;  2ZWR A;  2AZ4 A;  4D02 A;  2R2D A;  5EVK A;  2QDT A;  1BMC A;  3A4Y A;  5EVB A;  1MQO A;  5B1U A;  4F6Z A;  3ADR A;  1ZNB A;  4LE6 A;  2BIB A;  2WYM C;  3AJ3 A;  1DXK A;  3RPC A;  5AHO A;  3I15 A;  3KNR A;  5AEB A;  5ACT A;  5HIP A;  1X8H A;  3SBL A;  2WHG A;  3S0Z A;  4NQ6 A;  3DHC A;  2P18 A;  4KEP A;  2BR6 A;  3P2U A;  4D1W A;  1YCH A;  1ZKP A; 
#chains in the Genus database with same CATH topology
 4U4L A;  3T9M A;  2Q42 A;  2YNV A;  4J5H A;  2DOO A;  4RM5 A;  4J5F A;  1KR3 A;  2BFL A;  2BMI A;  5AHR A;  3BK2 A;  3I14 A;  4C1D A;  4AX1 B;  1VME A;  5B15 A;  2YHE A;  3WXC A;  4Z5Y A;  5B3R A;  5ACQ A;  1JJE A;  4Z67 A;  3BV6 A;  4RL2 A;  5EH9 A;  1QH3 A;  2ZNB A;  5DPX A;  4UA4 A;  5HH5 A;  1JJT A;  4EYL A;  4TZ9 A;  2GKL A;  5LM6 A;  2Q9U A;  5LCH A;  1L9Y A;  1WUO A;  4UWR B;  4GYU A;  2BFZ B;  4FEK A;  2I7V A;  2QIN A;  2QJS A;  2I7T A;  3ZWF A;  2UYX A;  1DD6 A;  5HIS A;  2XF4 A;  3SPU A;  2GFJ A;  4XWT A;  1YCF A;  2BFK A;  5A87 A;  4UWO B;  3JXP A;  2FK6 A;  2HB9 A;  2BFZ A;  2CG2 A;  5EW0 A;  2Y8A A;  3VQZ A;  2YCB A;  2XR1 A;  5LLD A;  2Q0J A;  4NQ5 A;  3I11 A;  4HKY A;  5ACW A;  2BTN A;  5KIL A;  2M5C A;  5FQA A;  4DIK A;  1ZTC A;  4V0H A;  3QH8 A;  2Y87 A;  2H6A A;  2BC2 A;  2FHX B;  2FU8 A;  5LE1 A;  2FU7 A;  2FM6 A;  5ACS A;  5K0W A;  5FQC A;  4NQ4 A;  3IEK A;  4RBS A;  1A8T A;  2BG8 A;  2YZ3 A;  1K07 A;  2P1E A;  3FCZ A;  3I0V A;  3PY5 A;  5LCA A;  4EYB A;  4BZ3 A;  3MD7 A;  3BK1 A;  2CFZ A;  3IEM A;  2BG8 B;  5EHT A;  4B87 A;  2CBN A;  2Q0I A;  3SFP A;  3L6N A;  3IEL A;  3X30 A;  4TZF A;  2GMN A;  2Y8B A;  2OHH A;  5K4K A;  1QH5 A;  4ZO3 A;  4EYF A;  2DKF A;  5EV6 A;  5HH6 A;  4PVO A;  4JO0 A;  4UBQ A;  3KL7 A;  3ZR9 A;  3SD9 A;  1SML A;  4Z60 A;  2BGA A;  4GCW A;  2YNV B;  3DHB A;  4PVT A;  5K4N A;  3IOF A;  2NZE A;  5AYA A;  4XUK A;  5FQB A;  4FR7 A;  2BG2 A;  2WYL A;  5AXR A;  5HH4 A;  3VPE A;  4TZB A;  5ACP A;  3X2X A;  4CHL A;  4TYT A;  4UAM A;  4XWW A;  4WD6 A;  5LCF A;  2BG6 A;  5EWA A;  2VW8 A;  1WW1 A;  1X8G A;  5HIO A;  1BVT A;  4YSB A;  3F9O A;  4AXH A;  1XTO A;  2E7Y A;  2A7M A;  4KEQ A;  4EFZ A;  4Z7R A;  4BP0 A;  1Y44 A;  4O98 A;  5EV8 A;  4AD9 A;  5AXO A;  4RL0 A;  4AV7 A;  5A23 A;  5LMC A;  5LS3 A;  3AF6 A;  1M2X A;  1P9E A;  3IDZ A;  4UWS B;  5A5Z A;  2NXA A;  5ACU A;  2BG7 A;  2GCU A;  2WRS A;  1KO2 A;  1XM8 A;  1HLK A;  5ACX A;  4ZEJ A;  4C1E A;  3PG4 A;  5AIJ A;  4ZNB A;  4D1T A;  2ZO4 A;  1VJN A;  5A0T A;  2FU6 A;  3DHA A;  4RAW A;  5A0V A;  3ESH A;  3Q6V A;  3G1P A;  3H3E A;  1VGN A;  3DH8 A;  3I13 A;  3X2Z A;  4EY2 A;  1WRA A;  4C1G A;  2ZZI A;  4PDX A;  5ACV A;  4D1U A;  2FHX A;  2NZF A;  4YSK A;  4DIL A;  3IE0 A;  2YNU A;  2OHI A;  4EXS A;  2YNT B;  5ACR A;  4Z5Z A;  4P62 A;  3X2Y A;  3SW3 A;  4HL2 A;  4AWZ A;  1E5D A;  2YNW A;  1BC2 A;  2OHJ A;  1JT1 A;  3IE1 A;  3RKK A;  4FSB A;  2GFK A;  4AX0 B;  4F6H A;  4D1V A;  2CFU A;  3PY6 A;  4Z6X A;  4H0D A;  3LVZ A;  4HL1 A;  3RKJ A;  4RAM A;  1DDK A;  5LSC A;  4NQ2 A;  4AWY B;  4TZE A;  5KIK A;  4ZO2 A;  4TYF A;  2WYM A;  3BC2 A;  2QED A;  2QDS A;  4C09 A;  3R2U A;  1WUP A;  2I7X A;  4C1F A;  2FU9 A;  3T3N A;  4GYQ A;  4YSL A;  4C1H A;  3IOG A;  3IE2 A;  3KNS A;  3ZQ4 A;  3T3O A;  2P97 A;  1X8I A;  3AF5 A;  5AJL A;  4NUR A;  3TP9 A;  4UWP B;  2YNT A;  4EXY A;  5HIQ A;  5EVD A;  1KO3 A;  5IQK A;  2AIO A;  2P4Z A;  3FAI A;  1YCG A;  1A7T A;  5K4M A;  2M5D A;  4C1C A;  3SRX A;  3ZNB A;  2NYP A;  2ZWR A;  2AZ4 A;  4D02 A;  2R2D A;  5EVK A;  2QDT A;  1BMC A;  3A4Y A;  5EVB A;  1MQO A;  5B1U A;  4F6Z A;  3ADR A;  1ZNB A;  2CG3 A;  4LE6 A;  2BIB A;  2WYM C;  3AJ3 A;  1DXK A;  3RPC A;  5AHO A;  3I15 A;  3KNR A;  5AEB A;  5ACT A;  5HIP A;  1X8H A;  3SBL A;  2WHG A;  3S0Z A;  4NQ6 A;  3DHC A;  2P18 A;  4KEP A;  2BR6 A;  3P2U A;  4D1W A;  1YCH A;  1ZKP A; 
#chains in the Genus database with same CATH homology
 4U4L A;  3T9M A;  2Q42 A;  2YNV A;  4J5H A;  2DOO A;  4RM5 A;  4J5F A;  1KR3 A;  2BFL A;  2BMI A;  5AHR A;  3BK2 A;  3I14 A;  4C1D A;  4AX1 B;  1VME A;  5B15 A;  3WXC A;  4Z5Y A;  5B3R A;  5ACQ A;  1JJE A;  4Z67 A;  3BV6 A;  4RL2 A;  5EH9 A;  1QH3 A;  2ZNB A;  5DPX A;  4UA4 A;  5HH5 A;  1JJT A;  4EYL A;  4TZ9 A;  2GKL A;  5LM6 A;  2Q9U A;  5LCH A;  1L9Y A;  1WUO A;  4UWR B;  4GYU A;  2BFZ B;  4FEK A;  2I7V A;  2QIN A;  2QJS A;  2I7T A;  3ZWF A;  2UYX A;  1DD6 A;  5HIS A;  2XF4 A;  3SPU A;  2GFJ A;  4XWT A;  1YCF A;  2BFK A;  5A87 A;  4UWO B;  3JXP A;  2FK6 A;  2HB9 A;  2BFZ A;  5EW0 A;  2Y8A A;  3VQZ A;  2YCB A;  2XR1 A;  5LLD A;  2Q0J A;  4NQ5 A;  3I11 A;  5KIL A;  4HKY A;  2BTN A;  5ACW A;  2M5C A;  5FQA A;  4DIK A;  1ZTC A;  4V0H A;  3QH8 A;  2Y87 A;  2H6A A;  2BC2 A;  2FHX B;  2FU8 A;  5LE1 A;  2FU7 A;  2FM6 A;  5ACS A;  5K0W A;  5FQC A;  4NQ4 A;  3IEK A;  4RBS A;  1A8T A;  2BG8 A;  2YZ3 A;  1K07 A;  2P1E A;  3FCZ A;  3I0V A;  3PY5 A;  5LCA A;  4EYB A;  4BZ3 A;  3MD7 A;  3BK1 A;  3IEM A;  2BG8 B;  5EHT A;  4B87 A;  2CBN A;  2Q0I A;  3SFP A;  3L6N A;  3IEL A;  3X30 A;  4TZF A;  2GMN A;  2Y8B A;  2OHH A;  5K4K A;  1QH5 A;  4ZO3 A;  4EYF A;  2DKF A;  5EV6 A;  5HH6 A;  4PVO A;  4JO0 A;  4UBQ A;  3KL7 A;  3ZR9 A;  3SD9 A;  1SML A;  4Z60 A;  2BGA A;  4GCW A;  2YNV B;  3DHB A;  4PVT A;  5K4N A;  3IOF A;  2NZE A;  5AYA A;  4XUK A;  5FQB A;  4FR7 A;  2BG2 A;  2WYL A;  5AXR A;  5HH4 A;  3VPE A;  4TZB A;  5ACP A;  3X2X A;  4CHL A;  4TYT A;  4UAM A;  4XWW A;  4WD6 A;  5LCF A;  2BG6 A;  5EWA A;  2VW8 A;  1WW1 A;  1X8G A;  5HIO A;  1BVT A;  4YSB A;  3F9O A;  1XTO A;  2E7Y A;  2A7M A;  4KEQ A;  4EFZ A;  4Z7R A;  4BP0 A;  1Y44 A;  4O98 A;  5EV8 A;  4AD9 A;  5AXO A;  4RL0 A;  5LMC A;  5LS3 A;  3AF6 A;  1M2X A;  1P9E A;  3IDZ A;  4UWS B;  5A5Z A;  2NXA A;  5ACU A;  2BG7 A;  2GCU A;  2WRS A;  1KO2 A;  1XM8 A;  1HLK A;  5ACX A;  4ZEJ A;  4C1E A;  3PG4 A;  4ZNB A;  4D1T A;  2ZO4 A;  1VJN A;  5A0T A;  2FU6 A;  3DHA A;  4RAW A;  5A0V A;  3ESH A;  3Q6V A;  3G1P A;  3H3E A;  1VGN A;  3DH8 A;  3I13 A;  3X2Z A;  4EY2 A;  1WRA A;  4C1G A;  2ZZI A;  5ACV A;  4D1U A;  2FHX A;  2NZF A;  4YSK A;  4DIL A;  3IE0 A;  2YNU A;  2OHI A;  4EXS A;  2YNT B;  5ACR A;  4Z5Z A;  4P62 A;  3X2Y A;  3SW3 A;  4HL2 A;  4AWZ A;  1E5D A;  2YNW A;  1BC2 A;  2OHJ A;  1JT1 A;  3IE1 A;  3RKK A;  4FSB A;  2GFK A;  4AX0 B;  4F6H A;  4D1V A;  3PY6 A;  4Z6X A;  4H0D A;  3LVZ A;  4HL1 A;  3RKJ A;  4RAM A;  1DDK A;  5LSC A;  4NQ2 A;  4AWY B;  4TZE A;  5KIK A;  4ZO2 A;  4TYF A;  2WYM A;  3BC2 A;  2QED A;  2QDS A;  4C09 A;  3R2U A;  1WUP A;  2I7X A;  4C1F A;  2FU9 A;  3T3N A;  4GYQ A;  4YSL A;  4C1H A;  3IOG A;  3IE2 A;  3KNS A;  3ZQ4 A;  3T3O A;  2P97 A;  1X8I A;  3AF5 A;  3TP9 A;  4UWP B;  2YNT A;  4EXY A;  5HIQ A;  5EVD A;  1KO3 A;  5IQK A;  2AIO A;  2P4Z A;  3FAI A;  1YCG A;  1A7T A;  5K4M A;  2M5D A;  4C1C A;  3SRX A;  3ZNB A;  2NYP A;  2ZWR A;  2AZ4 A;  4D02 A;  2R2D A;  5EVK A;  2QDT A;  1BMC A;  3A4Y A;  5EVB A;  1MQO A;  5B1U A;  4F6Z A;  3ADR A;  1ZNB A;  4LE6 A;  2BIB A;  2WYM C;  3AJ3 A;  1DXK A;  3RPC A;  5AHO A;  3I15 A;  3KNR A;  5AEB A;  5ACT A;  5HIP A;  1X8H A;  3SBL A;  2WHG A;  3S0Z A;  4NQ6 A;  3DHC A;  2P18 A;  4KEP A;  2BR6 A;  3P2U A;  4D1W A;  1YCH A;  1ZKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...