4LE6A

Crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
300
structure length
257
Chain Sequence
b'AAPAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFSPIRSDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Organophosphorus hydrolase
molecule tags Hydrolase
source organism Pseudomonas pseudoalcaligenes
publication title Structural and Enzymatic Characterization of the Phosphotriesterase OPHC2 from Pseudomonas pseudoalcaligenes.
pubmed doi rcsb
total genus 66
structure length 257
sequence length 300
chains with identical sequence B, C, D, E
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4le6A00
2BGAA 1VJNA 2YNVB 4TZBA 1Y44A 4TYFA 4Z67A 4KEPA 2I7XA 1ZNBA 4FEKA 2Q42A 2XR1A 1ZTCA 2GKLA 3IE1A 3PY6A 5ACUA 5K4KA 4NQ5A 3IEMA 5ACPA 4GYQA 3IOGA 3ZWFA 5ACWA 2ZO4A 4GYUA 2FU6A 4RL0A 3IE2A 2UYXA 4UWOB 1XTOA 5K4MA 4ZEJA 1YCHA 1DDKA 4DILA 1JT1A 4EY2A 5LCHA 2NXAA 5LM6A 4TZ9A 3VQZA 2WHGA 2GMNA 4RL2A 5AHRA 2I7TA 5LS3A 2FHXA 2A7MA 1BVTA 5AXRA 5HH6A 2QEDA 4H0DA 2BFZB 2BG7A 5LMCA 2BFKA 2BFLA 2GFJA 2DOOA 4F6HA 1WRAA 3SPUA 5LCAA 4ZO3A 2BIBA 2M5DA 2FK6A 3I13A 5EW0A 5LSCA 1QH5A 4YSLA 5EVBA 3LVZA 5A5ZA 4C09A 2OHJA 2QDSA 4RM5A 2YCBA 5AYAA 4Z5ZA 1VGNA 1X8IA 2BG6A 2ZWRA 5A0TA 2FU8A 1WUPA 2BTNA 1ZKPA 1XM8A 4UBQA 1M2XA 3X2ZA 2FHXB 1MQOA 5A87A 1YCGA 4J5FA 3KL7A 3L6NA 3Q6VA 4UA4A 5EVKA 1E5DA 5ACSA 3ESHA 2WYLA 3SBLA 5ACVA 2QDTA 4B87A 4RAMA 5AEBA 4C1HA 1BC2A 5B1UA 4PVTA 4EXYA 4TYTA 2FU7A 3PG4A 2Q0IA 5ACQA 4TZFA 5EV8A 4KEQA 2CBNA 4D1UA 2I7VA 4GCWA 4YSBA 3FCZA 3SRXA 1JJTA 2VW8A 5HH5A 1A8TA 3X2YA 5ACRA 4EYFA 2ZZIA 2BC2A 4CHLA 2YNVA 2Y8AA 5HIQA 3BK1A 4TZEA 4D1VA 3G1PA 3KNSA 3I15A 2E7YA 4ZNBA 1WUOA 2AIOA 4RAWA 5AHOA 3DHBA 2M5CA 4EYBA 3AF5A 3T3NA 4D1WA 2Q0JA 4AWYB 4FSBA 5B15A 3IEKA 3H3EA 3MD7A 2QJSA 4BP0A 4V0HA 3IELA 4JO0A 4DIKA 3X2XA 4ZO2A 3I14A 2QINA 3SD9A 2YNWA 4UWRB 2XF4A 1WW1A 3BK2A 5HH4A 5FQCA 4AX1B 5A0VA 4NQ6A 4YSKA 4C1DA 4Z60A 2WYMA 2BR6A 2FU9A 4LE6A 3F9OA 3A4YA 4D02A 4Z5YA 2YZ3A 5LLDA 2AZ4A 2OHHA 4O98A 5K0WA 3PY5A 4HKYA 4UWSB 4C1GA 2NYPA 5HIOA 2YNUA 4Z6XA 3IDZA 2BG8B 1A7TA 5EH9A 3QH8A 2GFKA 3ZR9A 1X8HA 3ZQ4A 3DH8A 3I0VA 4J5HA 3SW3A 2FM6A 5FQAA 2WRSA 1VMEA 1L9YA 2OHIA 5EHTA 5EWAA 3WXCA 5IQKA 4AWZA 2Q9UA 2P1EA 4FR7A 3ZNBA 4RBSA 2GCUA 1HLKA 4AX0B 2Y87A 1DD6A 5B3RA 4NQ4A 1BMCA 2ZNBA 5ACTA 4AD9A 5KILA 4BZ3A 2Y8BA 4EFZA 2BFZA 4NQ2A 2HB9A 5DPXA 2BMIA 4HL1A 2BG8A 2H6AA 2WYMC 2R2DA 4WD6A 3I11A 1SMLA 3X30A 3KNRA 3RKJA 4XUKA 3SFPA 1K07A 1JJEA 3R2UA 5HIPA 3AF6A 3BV6A 4EXSA 4C1FA 1KO3A 3S0ZA 1YCFA 2P4ZA 5HISA 2P18A 1KO2A 2NZEA 4EYLA 2YNTA 2NZFA 3P2UA 5EVDA 1QH3A 3IE0A 3RKKA 5LE1A 1X8GA 4XWTA 5FQBA 5LCFA 3DHCA 5ACXA 3AJ3A 3FAIA 5EV6A 5KIKA 5K4NA 2BG2A 4F6ZA 3TP9A 3RPCA 3BC2A 4C1CA 3JXPA 3DHAA 3VPEA 2YNTB 1KR3A 4HL2A 2DKFA 4XWWA 4P62A 3T9MA 1P9EA 5AXOA 3T3OA 4U4LA 3ADRA 1DXKA 4PVOA 4C1EA 2P97A 3IOFA 4UAMA 4D1TA 4Z7RA 4UWPB
chains in the Genus database with same CATH superfamily
2BGAA 1VJNA 4AV7A 5AIJA 2YNVB 4TZBA 1Y44A 4TYFA 4Z67A 4KEPA 2I7XA 1ZNBA 4FEKA 2Q42A 2XR1A 1ZTCA 2GKLA 3IE1A 3PY6A 5ACUA 5K4KA 4NQ5A 3IEMA 5ACPA 4GYQA 3IOGA 3ZWFA 5ACWA 2ZO4A 4GYUA 2FU6A 4RL0A 3IE2A 2UYXA 4UWOB 1XTOA 5K4MA 4ZEJA 1YCHA 1DDKA 4DILA 1JT1A 4EY2A 5LCHA 2NXAA 4TZ9A 3VQZA 5A23A 5LM6A 2WHGA 2GMNA 4RL2A 5AHRA 2I7TA 5LS3A 2FHXA 2A7MA 1BVTA 5AXRA 5HH6A 2QEDA 4H0DA 2BFZB 2BG7A 5LMCA 2BFKA 2BFLA 2GFJA 2DOOA 4F6HA 1WRAA 3SPUA 5LCAA 4ZO3A 2BIBA 2M5DA 2FK6A 3I13A 5EW0A 5LSCA 1QH5A 4YSLA 5EVBA 3LVZA 5A5ZA 4C09A 2CG2A 2OHJA 2QDSA 4RM5A 2YCBA 5AYAA 4Z5ZA 1VGNA 1X8IA 2BG6A 2ZWRA 5A0TA 2FU8A 1WUPA 2BTNA 1ZKPA 1XM8A 4UBQA 1M2XA 3X2ZA 2FHXB 1MQOA 5A87A 1YCGA 4J5FA 3KL7A 3L6NA 3Q6VA 4UA4A 5EVKA 1E5DA 5ACSA 3ESHA 2WYLA 3SBLA 5ACVA 2QDTA 4B87A 4RAMA 5AEBA 4C1HA 1BC2A 5B1UA 4PVTA 4EXYA 4TYTA 2FU7A 3PG4A 2Q0IA 5ACQA 4TZFA 5EV8A 4KEQA 2CBNA 4D1UA 2I7VA 4GCWA 4YSBA 3FCZA 3SRXA 1JJTA 2VW8A 5HH5A 1A8TA 3X2YA 5ACRA 4EYFA 2ZZIA 2BC2A 4CHLA 2YNVA 2Y8AA 5HIQA 3BK1A 4D1VA 4TZEA 3G1PA 4AXHA 3KNSA 3I15A 2E7YA 4ZNBA 1WUOA 2AIOA 4RAWA 5AHOA 3DHBA 2M5CA 4EYBA 3AF5A 3T3NA 4D1WA 2Q0JA 4AWYB 5AJLA 4FSBA 5B15A 3IEKA 3H3EA 3MD7A 2QJSA 4BP0A 4V0HA 3IELA 4JO0A 2CFZA 4DIKA 3X2XA 4ZO2A 3I14A 2QINA 3SD9A 2YNWA 4UWRB 2XF4A 1WW1A 3BK2A 5HH4A 5FQCA 4AX1B 5A0VA 4NQ6A 4YSKA 4C1DA 4Z60A 2WYMA 4PDXA 2BR6A 2FU9A 4LE6A 3F9OA 3A4YA 4D02A 4Z5YA 2YZ3A 5LLDA 2AZ4A 2YHEA 2OHHA 4O98A 5K0WA 3PY5A 4HKYA 4UWSB 4C1GA 2NYPA 5HIOA 2YNUA 4Z6XA 3IDZA 2BG8B 1A7TA 5EH9A 4NURA 3QH8A 2GFKA 3ZR9A 1X8HA 3ZQ4A 3DH8A 3I0VA 4J5HA 3SW3A 2FM6A 5FQAA 2WRSA 1VMEA 1L9YA 2OHIA 5EHTA 5EWAA 2CG3A 3WXCA 5IQKA 4AWZA 2Q9UA 2P1EA 4FR7A 3ZNBA 4RBSA 2GCUA 1HLKA 4AX0B 2Y87A 1DD6A 5B3RA 4NQ4A 1BMCA 2ZNBA 5ACTA 4AD9A 5KILA 4BZ3A 2Y8BA 4EFZA 2BFZA 4NQ2A 2HB9A 5DPXA 2BMIA 4HL1A 2BG8A 2H6AA 2WYMC 2R2DA 4WD6A 3I11A 1SMLA 3X30A 3KNRA 3RKJA 4XUKA 3SFPA 1K07A 1JJEA 3R2UA 5HIPA 3AF6A 3BV6A 4EXSA 4C1FA 1KO3A 3S0ZA 1YCFA 2P4ZA 5HISA 2P18A 1KO2A 2NZEA 4EYLA 2YNTA 2NZFA 3P2UA 5EVDA 1QH3A 3IE0A 3RKKA 5LE1A 1X8GA 4XWTA 5FQBA 5LCFA 3DHCA 5ACXA 3AJ3A 3FAIA 5EV6A 5KIKA 5K4NA 2BG2A 4F6ZA 3TP9A 3RPCA 3BC2A 4C1CA 3JXPA 2CFUA 3DHAA 3VPEA 2YNTB 1KR3A 4HL2A 2DKFA 4XWWA 4P62A 3T9MA 1P9EA 5AXOA 3T3OA 4U4LA 3ADRA 1DXKA 4PVOA 4C1EA 2P97A 3IOFA 4UAMA 4D1TA 4Z7RA 4UWPB
chains in the Genus database with same CATH topology
2BGAA 1VJNA 2YNVB 4TZBA 1Y44A 4TYFA 4Z67A 4KEPA 2I7XA 1ZNBA 4FEKA 2Q42A 2XR1A 1ZTCA 2GKLA 3IE1A 3PY6A 5ACUA 5K4KA 4NQ5A 3IEMA 5ACPA 4GYQA 3IOGA 3ZWFA 5ACWA 2ZO4A 4GYUA 2FU6A 4RL0A 3IE2A 2UYXA 4UWOB 1XTOA 5K4MA 4ZEJA 1YCHA 1DDKA 4DILA 1JT1A 4EY2A 5LCHA 2NXAA 5LM6A 4TZ9A 3VQZA 2WHGA 2GMNA 4RL2A 5AHRA 2I7TA 5LS3A 2FHXA 2A7MA 1BVTA 5AXRA 5HH6A 2QEDA 4H0DA 2BFZB 2BG7A 5LMCA 2BFKA 2BFLA 2GFJA 2DOOA 4F6HA 1WRAA 3SPUA 5LCAA 4ZO3A 2BIBA 2M5DA 2FK6A 3I13A 5EW0A 5LSCA 1QH5A 4YSLA 5EVBA 3LVZA 5A5ZA 4C09A 2OHJA 2QDSA 4RM5A 2YCBA 5AYAA 4Z5ZA 1VGNA 1X8IA 2BG6A 2ZWRA 5A0TA 2FU8A 1WUPA 2BTNA 1ZKPA 1XM8A 4UBQA 1M2XA 3X2ZA 2FHXB 1MQOA 5A87A 1YCGA 4J5FA 3KL7A 3L6NA 3Q6VA 4UA4A 5EVKA 1E5DA 5ACSA 3ESHA 2WYLA 3SBLA 5ACVA 2QDTA 4B87A 4RAMA 5AEBA 4C1HA 1BC2A 5B1UA 4PVTA 4EXYA 4TYTA 2FU7A 3PG4A 2Q0IA 5ACQA 4TZFA 5EV8A 4KEQA 2CBNA 4D1UA 2I7VA 4GCWA 4YSBA 3FCZA 3SRXA 1JJTA 2VW8A 5HH5A 1A8TA 3X2YA 5ACRA 4EYFA 2ZZIA 2BC2A 4CHLA 2YNVA 2Y8AA 5HIQA 3BK1A 4TZEA 4D1VA 3G1PA 3KNSA 3I15A 2E7YA 4ZNBA 1WUOA 2AIOA 4RAWA 5AHOA 3DHBA 2M5CA 4EYBA 3AF5A 3T3NA 4D1WA 2Q0JA 4AWYB 4FSBA 5B15A 3IEKA 3H3EA 3MD7A 2QJSA 4BP0A 4V0HA 3IELA 4JO0A 4DIKA 3X2XA 4ZO2A 3I14A 2QINA 3SD9A 2YNWA 4UWRB 2XF4A 1WW1A 3BK2A 5HH4A 5FQCA 4AX1B 5A0VA 4NQ6A 4YSKA 4C1DA 4Z60A 2WYMA 2BR6A 2FU9A 4LE6A 3F9OA 3A4YA 4D02A 4Z5YA 2YZ3A 5LLDA 2AZ4A 2OHHA 4O98A 5K0WA 3PY5A 4HKYA 4UWSB 4C1GA 2NYPA 5HIOA 2YNUA 4Z6XA 3IDZA 2BG8B 1A7TA 5EH9A 3QH8A 2GFKA 3ZR9A 1X8HA 3ZQ4A 3DH8A 3I0VA 4J5HA 3SW3A 2FM6A 5FQAA 2WRSA 1VMEA 1L9YA 2OHIA 5EHTA 5EWAA 3WXCA 5IQKA 4AWZA 2Q9UA 2P1EA 4FR7A 3ZNBA 4RBSA 2GCUA 1HLKA 4AX0B 2Y87A 1DD6A 5B3RA 4NQ4A 1BMCA 2ZNBA 5ACTA 4AD9A 5KILA 4BZ3A 2Y8BA 4EFZA 2BFZA 4NQ2A 2HB9A 5DPXA 2BMIA 4HL1A 2BG8A 2H6AA 2WYMC 2R2DA 4WD6A 3I11A 1SMLA 3X30A 3KNRA 3RKJA 4XUKA 3SFPA 1K07A 1JJEA 3R2UA 5HIPA 3AF6A 3BV6A 4EXSA 4C1FA 1KO3A 3S0ZA 1YCFA 2P4ZA 5HISA 2P18A 1KO2A 2NZEA 4EYLA 2YNTA 2NZFA 3P2UA 5EVDA 1QH3A 3IE0A 3RKKA 5LE1A 1X8GA 4XWTA 5FQBA 5LCFA 3DHCA 5ACXA 3AJ3A 3FAIA 5EV6A 5KIKA 5K4NA 2BG2A 4F6ZA 3TP9A 3RPCA 3BC2A 4C1CA 3JXPA 3DHAA 3VPEA 2YNTB 1KR3A 4HL2A 2DKFA 4XWWA 4P62A 3T9MA 1P9EA 5AXOA 3T3OA 4U4LA 3ADRA 1DXKA 4PVOA 4C1EA 2P97A 3IOFA 4UAMA 4D1TA 4Z7RA 4UWPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BGA A;  1VJN A;  2YNV B;  4TZB A;  1Y44 A;  4TYF A;  4Z67 A;  4KEP A;  2I7X A;  1ZNB A;  4FEK A;  2Q42 A;  2XR1 A;  1ZTC A;  2GKL A;  3IE1 A;  3PY6 A;  5ACU A;  5K4K A;  4NQ5 A;  3IEM A;  5ACP A;  4GYQ A;  3IOG A;  3ZWF A;  5ACW A;  2ZO4 A;  4GYU A;  2FU6 A;  4RL0 A;  3IE2 A;  2UYX A;  4UWO B;  1XTO A;  5K4M A;  4ZEJ A;  1YCH A;  1DDK A;  4DIL A;  1JT1 A;  4EY2 A;  5LCH A;  2NXA A;  5LM6 A;  4TZ9 A;  3VQZ A;  2WHG A;  2GMN A;  4RL2 A;  5AHR A;  2I7T A;  5LS3 A;  2FHX A;  2A7M A;  1BVT A;  5AXR A;  5HH6 A;  2QED A;  4H0D A;  2BFZ B;  2BG7 A;  5LMC A;  2BFK A;  2BFL A;  2GFJ A;  2DOO A;  4F6H A;  1WRA A;  3SPU A;  5LCA A;  4ZO3 A;  2BIB A;  2M5D A;  2FK6 A;  3I13 A;  5EW0 A;  5LSC A;  1QH5 A;  4YSL A;  5EVB A;  3LVZ A;  5A5Z A;  4C09 A;  2OHJ A;  2QDS A;  4RM5 A;  2YCB A;  5AYA A;  4Z5Z A;  1VGN A;  1X8I A;  2BG6 A;  2ZWR A;  5A0T A;  2FU8 A;  1WUP A;  2BTN A;  1ZKP A;  1XM8 A;  4UBQ A;  1M2X A;  3X2Z A;  2FHX B;  1MQO A;  5A87 A;  1YCG A;  4J5F A;  3KL7 A;  3L6N A;  3Q6V A;  4UA4 A;  5EVK A;  1E5D A;  5ACS A;  3ESH A;  2WYL A;  3SBL A;  5ACV A;  2QDT A;  4B87 A;  4RAM A;  5AEB A;  4C1H A;  1BC2 A;  5B1U A;  4PVT A;  4EXY A;  4TYT A;  2FU7 A;  3PG4 A;  2Q0I A;  5ACQ A;  4TZF A;  5EV8 A;  4KEQ A;  2CBN A;  4D1U A;  2I7V A;  4GCW A;  4YSB A;  3FCZ A;  3SRX A;  1JJT A;  2VW8 A;  5HH5 A;  1A8T A;  3X2Y A;  5ACR A;  4EYF A;  2ZZI A;  2BC2 A;  4CHL A;  2YNV A;  2Y8A A;  5HIQ A;  3BK1 A;  4TZE A;  4D1V A;  3G1P A;  3KNS A;  3I15 A;  2E7Y A;  4ZNB A;  1WUO A;  2AIO A;  4RAW A;  5AHO A;  3DHB A;  2M5C A;  4EYB A;  3AF5 A;  3T3N A;  4D1W A;  2Q0J A;  4AWY B;  4FSB A;  5B15 A;  3IEK A;  3H3E A;  3MD7 A;  2QJS A;  4BP0 A;  4V0H A;  3IEL A;  4JO0 A;  4DIK A;  3X2X A;  4ZO2 A;  3I14 A;  2QIN A;  3SD9 A;  2YNW A;  4UWR B;  2XF4 A;  1WW1 A;  3BK2 A;  5HH4 A;  5FQC A;  4AX1 B;  5A0V A;  4NQ6 A;  4YSK A;  4C1D A;  4Z60 A;  2WYM A;  2BR6 A;  2FU9 A;  4LE6 A;  3F9O A;  3A4Y A;  4D02 A;  4Z5Y A;  2YZ3 A;  5LLD A;  2AZ4 A;  2OHH A;  4O98 A;  5K0W A;  3PY5 A;  4HKY A;  4UWS B;  4C1G A;  2NYP A;  5HIO A;  2YNU A;  4Z6X A;  3IDZ A;  2BG8 B;  1A7T A;  5EH9 A;  3QH8 A;  2GFK A;  3ZR9 A;  1X8H A;  3ZQ4 A;  3DH8 A;  3I0V A;  4J5H A;  3SW3 A;  2FM6 A;  5FQA A;  2WRS A;  1VME A;  1L9Y A;  2OHI A;  5EHT A;  5EWA A;  3WXC A;  5IQK A;  4AWZ A;  2Q9U A;  2P1E A;  4FR7 A;  3ZNB A;  4RBS A;  2GCU A;  1HLK A;  4AX0 B;  2Y87 A;  1DD6 A;  5B3R A;  4NQ4 A;  1BMC A;  2ZNB A;  5ACT A;  4AD9 A;  5KIL A;  4BZ3 A;  2Y8B A;  4EFZ A;  2BFZ A;  4NQ2 A;  2HB9 A;  5DPX A;  2BMI A;  4HL1 A;  2BG8 A;  2H6A A;  2WYM C;  2R2D A;  4WD6 A;  3I11 A;  1SML A;  3X30 A;  3KNR A;  3RKJ A;  4XUK A;  3SFP A;  1K07 A;  1JJE A;  3R2U A;  5HIP A;  3AF6 A;  3BV6 A;  4EXS A;  4C1F A;  1KO3 A;  3S0Z A;  1YCF A;  2P4Z A;  5HIS A;  2P18 A;  1KO2 A;  2NZE A;  4EYL A;  2YNT A;  2NZF A;  3P2U A;  5EVD A;  1QH3 A;  3IE0 A;  3RKK A;  5LE1 A;  1X8G A;  4XWT A;  5FQB A;  5LCF A;  3DHC A;  5ACX A;  3AJ3 A;  3FAI A;  5EV6 A;  5KIK A;  5K4N A;  2BG2 A;  4F6Z A;  3TP9 A;  3RPC A;  3BC2 A;  4C1C A;  3JXP A;  3DHA A;  3VPE A;  2YNT B;  1KR3 A;  4HL2 A;  2DKF A;  4XWW A;  4P62 A;  3T9M A;  1P9E A;  5AXO A;  3T3O A;  4U4L A;  3ADR A;  1DXK A;  4PVO A;  4C1E A;  2P97 A;  3IOF A;  4UAM A;  4D1T A;  4Z7R A;  4UWP B; 
#chains in the Genus database with same CATH topology
 2BGA A;  1VJN A;  4AV7 A;  5AIJ A;  2YNV B;  4TZB A;  1Y44 A;  4TYF A;  4Z67 A;  4KEP A;  2I7X A;  1ZNB A;  4FEK A;  2Q42 A;  2XR1 A;  1ZTC A;  2GKL A;  3IE1 A;  3PY6 A;  5ACU A;  5K4K A;  4NQ5 A;  3IEM A;  5ACP A;  4GYQ A;  3IOG A;  3ZWF A;  5ACW A;  2ZO4 A;  4GYU A;  2FU6 A;  4RL0 A;  3IE2 A;  2UYX A;  4UWO B;  1XTO A;  5K4M A;  4ZEJ A;  1YCH A;  1DDK A;  4DIL A;  1JT1 A;  4EY2 A;  5LCH A;  2NXA A;  4TZ9 A;  3VQZ A;  5A23 A;  5LM6 A;  2WHG A;  2GMN A;  4RL2 A;  5AHR A;  2I7T A;  5LS3 A;  2FHX A;  2A7M A;  1BVT A;  5AXR A;  5HH6 A;  2QED A;  4H0D A;  2BFZ B;  2BG7 A;  5LMC A;  2BFK A;  2BFL A;  2GFJ A;  2DOO A;  4F6H A;  1WRA A;  3SPU A;  5LCA A;  4ZO3 A;  2BIB A;  2M5D A;  2FK6 A;  3I13 A;  5EW0 A;  5LSC A;  1QH5 A;  4YSL A;  5EVB A;  3LVZ A;  5A5Z A;  4C09 A;  2CG2 A;  2OHJ A;  2QDS A;  4RM5 A;  2YCB A;  5AYA A;  4Z5Z A;  1VGN A;  1X8I A;  2BG6 A;  2ZWR A;  5A0T A;  2FU8 A;  1WUP A;  2BTN A;  1ZKP A;  1XM8 A;  4UBQ A;  1M2X A;  3X2Z A;  2FHX B;  1MQO A;  5A87 A;  1YCG A;  4J5F A;  3KL7 A;  3L6N A;  3Q6V A;  4UA4 A;  5EVK A;  1E5D A;  5ACS A;  3ESH A;  2WYL A;  3SBL A;  5ACV A;  2QDT A;  4B87 A;  4RAM A;  5AEB A;  4C1H A;  1BC2 A;  5B1U A;  4PVT A;  4EXY A;  4TYT A;  2FU7 A;  3PG4 A;  2Q0I A;  5ACQ A;  4TZF A;  5EV8 A;  4KEQ A;  2CBN A;  4D1U A;  2I7V A;  4GCW A;  4YSB A;  3FCZ A;  3SRX A;  1JJT A;  2VW8 A;  5HH5 A;  1A8T A;  3X2Y A;  5ACR A;  4EYF A;  2ZZI A;  2BC2 A;  4CHL A;  2YNV A;  2Y8A A;  5HIQ A;  3BK1 A;  4D1V A;  4TZE A;  3G1P A;  4AXH A;  3KNS A;  3I15 A;  2E7Y A;  4ZNB A;  1WUO A;  2AIO A;  4RAW A;  5AHO A;  3DHB A;  2M5C A;  4EYB A;  3AF5 A;  3T3N A;  4D1W A;  2Q0J A;  4AWY B;  5AJL A;  4FSB A;  5B15 A;  3IEK A;  3H3E A;  3MD7 A;  2QJS A;  4BP0 A;  4V0H A;  3IEL A;  4JO0 A;  2CFZ A;  4DIK A;  3X2X A;  4ZO2 A;  3I14 A;  2QIN A;  3SD9 A;  2YNW A;  4UWR B;  2XF4 A;  1WW1 A;  3BK2 A;  5HH4 A;  5FQC A;  4AX1 B;  5A0V A;  4NQ6 A;  4YSK A;  4C1D A;  4Z60 A;  2WYM A;  4PDX A;  2BR6 A;  2FU9 A;  4LE6 A;  3F9O A;  3A4Y A;  4D02 A;  4Z5Y A;  2YZ3 A;  5LLD A;  2AZ4 A;  2YHE A;  2OHH A;  4O98 A;  5K0W A;  3PY5 A;  4HKY A;  4UWS B;  4C1G A;  2NYP A;  5HIO A;  2YNU A;  4Z6X A;  3IDZ A;  2BG8 B;  1A7T A;  5EH9 A;  4NUR A;  3QH8 A;  2GFK A;  3ZR9 A;  1X8H A;  3ZQ4 A;  3DH8 A;  3I0V A;  4J5H A;  3SW3 A;  2FM6 A;  5FQA A;  2WRS A;  1VME A;  1L9Y A;  2OHI A;  5EHT A;  5EWA A;  2CG3 A;  3WXC A;  5IQK A;  4AWZ A;  2Q9U A;  2P1E A;  4FR7 A;  3ZNB A;  4RBS A;  2GCU A;  1HLK A;  4AX0 B;  2Y87 A;  1DD6 A;  5B3R A;  4NQ4 A;  1BMC A;  2ZNB A;  5ACT A;  4AD9 A;  5KIL A;  4BZ3 A;  2Y8B A;  4EFZ A;  2BFZ A;  4NQ2 A;  2HB9 A;  5DPX A;  2BMI A;  4HL1 A;  2BG8 A;  2H6A A;  2WYM C;  2R2D A;  4WD6 A;  3I11 A;  1SML A;  3X30 A;  3KNR A;  3RKJ A;  4XUK A;  3SFP A;  1K07 A;  1JJE A;  3R2U A;  5HIP A;  3AF6 A;  3BV6 A;  4EXS A;  4C1F A;  1KO3 A;  3S0Z A;  1YCF A;  2P4Z A;  5HIS A;  2P18 A;  1KO2 A;  2NZE A;  4EYL A;  2YNT A;  2NZF A;  3P2U A;  5EVD A;  1QH3 A;  3IE0 A;  3RKK A;  5LE1 A;  1X8G A;  4XWT A;  5FQB A;  5LCF A;  3DHC A;  5ACX A;  3AJ3 A;  3FAI A;  5EV6 A;  5KIK A;  5K4N A;  2BG2 A;  4F6Z A;  3TP9 A;  3RPC A;  3BC2 A;  4C1C A;  3JXP A;  2CFU A;  3DHA A;  3VPE A;  2YNT B;  1KR3 A;  4HL2 A;  2DKF A;  4XWW A;  4P62 A;  3T9M A;  1P9E A;  5AXO A;  3T3O A;  4U4L A;  3ADR A;  1DXK A;  4PVO A;  4C1E A;  2P97 A;  3IOF A;  4UAM A;  4D1T A;  4Z7R A;  4UWP B; 
#chains in the Genus database with same CATH homology
 2BGA A;  1VJN A;  2YNV B;  4TZB A;  1Y44 A;  4TYF A;  4Z67 A;  4KEP A;  2I7X A;  1ZNB A;  4FEK A;  2Q42 A;  2XR1 A;  1ZTC A;  2GKL A;  3IE1 A;  3PY6 A;  5ACU A;  5K4K A;  4NQ5 A;  3IEM A;  5ACP A;  4GYQ A;  3IOG A;  3ZWF A;  5ACW A;  2ZO4 A;  4GYU A;  2FU6 A;  4RL0 A;  3IE2 A;  2UYX A;  4UWO B;  1XTO A;  5K4M A;  4ZEJ A;  1YCH A;  1DDK A;  4DIL A;  1JT1 A;  4EY2 A;  5LCH A;  2NXA A;  5LM6 A;  4TZ9 A;  3VQZ A;  2WHG A;  2GMN A;  4RL2 A;  5AHR A;  2I7T A;  5LS3 A;  2FHX A;  2A7M A;  1BVT A;  5AXR A;  5HH6 A;  2QED A;  4H0D A;  2BFZ B;  2BG7 A;  5LMC A;  2BFK A;  2BFL A;  2GFJ A;  2DOO A;  4F6H A;  1WRA A;  3SPU A;  5LCA A;  4ZO3 A;  2BIB A;  2M5D A;  2FK6 A;  3I13 A;  5EW0 A;  5LSC A;  1QH5 A;  4YSL A;  5EVB A;  3LVZ A;  5A5Z A;  4C09 A;  2OHJ A;  2QDS A;  4RM5 A;  2YCB A;  5AYA A;  4Z5Z A;  1VGN A;  1X8I A;  2BG6 A;  2ZWR A;  5A0T A;  2FU8 A;  1WUP A;  2BTN A;  1ZKP A;  1XM8 A;  4UBQ A;  1M2X A;  3X2Z A;  2FHX B;  1MQO A;  5A87 A;  1YCG A;  4J5F A;  3KL7 A;  3L6N A;  3Q6V A;  4UA4 A;  5EVK A;  1E5D A;  5ACS A;  3ESH A;  2WYL A;  3SBL A;  5ACV A;  2QDT A;  4B87 A;  4RAM A;  5AEB A;  4C1H A;  1BC2 A;  5B1U A;  4PVT A;  4EXY A;  4TYT A;  2FU7 A;  3PG4 A;  2Q0I A;  5ACQ A;  4TZF A;  5EV8 A;  4KEQ A;  2CBN A;  4D1U A;  2I7V A;  4GCW A;  4YSB A;  3FCZ A;  3SRX A;  1JJT A;  2VW8 A;  5HH5 A;  1A8T A;  3X2Y A;  5ACR A;  4EYF A;  2ZZI A;  2BC2 A;  4CHL A;  2YNV A;  2Y8A A;  5HIQ A;  3BK1 A;  4TZE A;  4D1V A;  3G1P A;  3KNS A;  3I15 A;  2E7Y A;  4ZNB A;  1WUO A;  2AIO A;  4RAW A;  5AHO A;  3DHB A;  2M5C A;  4EYB A;  3AF5 A;  3T3N A;  4D1W A;  2Q0J A;  4AWY B;  4FSB A;  5B15 A;  3IEK A;  3H3E A;  3MD7 A;  2QJS A;  4BP0 A;  4V0H A;  3IEL A;  4JO0 A;  4DIK A;  3X2X A;  4ZO2 A;  3I14 A;  2QIN A;  3SD9 A;  2YNW A;  4UWR B;  2XF4 A;  1WW1 A;  3BK2 A;  5HH4 A;  5FQC A;  4AX1 B;  5A0V A;  4NQ6 A;  4YSK A;  4C1D A;  4Z60 A;  2WYM A;  2BR6 A;  2FU9 A;  4LE6 A;  3F9O A;  3A4Y A;  4D02 A;  4Z5Y A;  2YZ3 A;  5LLD A;  2AZ4 A;  2OHH A;  4O98 A;  5K0W A;  3PY5 A;  4HKY A;  4UWS B;  4C1G A;  2NYP A;  5HIO A;  2YNU A;  4Z6X A;  3IDZ A;  2BG8 B;  1A7T A;  5EH9 A;  3QH8 A;  2GFK A;  3ZR9 A;  1X8H A;  3ZQ4 A;  3DH8 A;  3I0V A;  4J5H A;  3SW3 A;  2FM6 A;  5FQA A;  2WRS A;  1VME A;  1L9Y A;  2OHI A;  5EHT A;  5EWA A;  3WXC A;  5IQK A;  4AWZ A;  2Q9U A;  2P1E A;  4FR7 A;  3ZNB A;  4RBS A;  2GCU A;  1HLK A;  4AX0 B;  2Y87 A;  1DD6 A;  5B3R A;  4NQ4 A;  1BMC A;  2ZNB A;  5ACT A;  4AD9 A;  5KIL A;  4BZ3 A;  2Y8B A;  4EFZ A;  2BFZ A;  4NQ2 A;  2HB9 A;  5DPX A;  2BMI A;  4HL1 A;  2BG8 A;  2H6A A;  2WYM C;  2R2D A;  4WD6 A;  3I11 A;  1SML A;  3X30 A;  3KNR A;  3RKJ A;  4XUK A;  3SFP A;  1K07 A;  1JJE A;  3R2U A;  5HIP A;  3AF6 A;  3BV6 A;  4EXS A;  4C1F A;  1KO3 A;  3S0Z A;  1YCF A;  2P4Z A;  5HIS A;  2P18 A;  1KO2 A;  2NZE A;  4EYL A;  2YNT A;  2NZF A;  3P2U A;  5EVD A;  1QH3 A;  3IE0 A;  3RKK A;  5LE1 A;  1X8G A;  4XWT A;  5FQB A;  5LCF A;  3DHC A;  5ACX A;  3AJ3 A;  3FAI A;  5EV6 A;  5KIK A;  5K4N A;  2BG2 A;  4F6Z A;  3TP9 A;  3RPC A;  3BC2 A;  4C1C A;  3JXP A;  3DHA A;  3VPE A;  2YNT B;  1KR3 A;  4HL2 A;  2DKF A;  4XWW A;  4P62 A;  3T9M A;  1P9E A;  5AXO A;  3T3O A;  4U4L A;  3ADR A;  1DXK A;  4PVO A;  4C1E A;  2P97 A;  3IOF A;  4UAM A;  4D1T A;  4Z7R A;  4UWP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...