4LE6A

Crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
300
structure length
257
Chain Sequence
AAPAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFSPIRSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Enzymatic Characterization of the Phosphotriesterase OPHC2 from Pseudomonas pseudoalcaligenes.
pubmed doi rcsb
source organism Pseudomonas pseudoalcaligenes
molecule tags Hydrolase
molecule keywords Organophosphorus hydrolase
total genus 66
structure length 257
sequence length 300
chains with identical sequence B, C, D, E
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4le6A00
3X2ZA 2GFKA 5AHRA 4O98A 2BG6A 5HH6A 4ZO3A 1MQOA 2ZNBA 3SW3A 5LM6A 5LSCA 2AZ4A 4D02A 1DDKA 3A4YA 5ACXA 3DHCA 2UYXA 4XWWA 3LVZA 2BC2A 2YCBA 3BV6A 2GFJA 5LE1A 2XF4A 2YZ3A 4UWRB 2ZWRA 2OHJA 3DHBA 1JJEA 5ACUA 5KIKA 1WUPA 4NQ6A 4HKYA 2P1EA 3PG4A 2M5CA 1VMEA 4KEQA 4EYLA 4F6HA 1BVTA 2BG8B 4C1GA 3H3EA 2DOOA 5AEBA 4EYBA 3AJ3A 2FU7A 5AYAA 2QINA 4RM5A 4TYFA 3T3OA 1Y44A 3FAIA 3IEMA 4ZEJA 1ZTCA 2Q0IA 4EY2A 2Q0JA 4RAMA 5FQAA 4DIKA 4C09A 4TZ9A 5AHOA 1X8IA 4FSBA 2YNVA 5ACWA 4ZO2A 4AX0B 2FHXB 1XM8A 2YNUA 5FQCA 5ACQA 2BGAA 3RKKA 2BG2A 4Z5YA 1KO2A 2DKFA 5EWAA 1VJNA 1X8GA 3SRXA 2Y8BA 3IE0A 2Y87A 3R2UA 2WYLA 4GYUA 2H6AA 2Q9UA 5HIPA 2OHIA 5ACTA 3DH8A 3I13A 5LCAA 1WRAA 4DILA 5A0VA 2BFLA 2FU9A 5HISA 3S0ZA 1L9YA 2BFKA 1QH5A 4FEKA 4H0DA 5LCHA 2WRSA 5FQBA 5EH9A 3F9OA 5B15A 4PVTA 2I7TA 3SFPA 4TZFA 1ZNBA 4WD6A 3VPEA 4HL1A 5B3RA 3IOFA 4C1HA 5ACRA 3I11A 3ZQ4A 1JT1A 2QDSA 3WXCA 4GCWA 2BMIA 4TYTA 3KNRA 5HIQA 3SPUA 2GMNA 2P18A 4UAMA 1A8TA 4UWPB 2NXAA 2QEDA 5IQKA 4P62A 3P2UA 3Q6VA 5LMCA 5A87A 2I7XA 2FU8A 4J5FA 2BTNA 2GCUA 2YNTA 5EVBA 3I15A 3IEKA 2Y8AA 5K0WA 3IE2A 1QH3A 4D1WA 5EW0A 4C1FA 3AF5A 5DPXA 4Z7RA 2WYMA 4RBSA 2YNTB 3QH8A 5ACVA 4AWZA 2ZO4A 2AIOA 5AXOA 3X2XA 3IOGA 4RL2A 5HIOA 1YCGA 3ZWFA 5LCFA 1DD6A 2QDTA 3AF6A 5EV6A 3FCZA 4GYQA 2XR1A 4B87A 4YSBA 4XUKA 2YNVB 5K4MA 5A5ZA 1YCHA 1KO3A 4D1VA 4Z67A 1BC2A 4UWOB 2BG7A 4EFZA 1YCFA 4BZ3A 3MD7A 1DXKA 3SD9A 1HLKA 1WW1A 5EVDA 5ACPA 3IDZA 2WYMC 1WUOA 3X2YA 4AWYB 5EV8A 4C1DA 3G1PA 4J5HA 5LLDA 5KILA 3BC2A 2E7YA 3IELA 3JXPA 3L6NA 4EXSA 2FK6A 4JO0A 1ZKPA 4YSLA 3BK1A 4CHLA 1VGNA 1XTOA 3ZR9A 2BFZB 2Q42A 2FHXA 5K4NA 3IE1A 4YSKA 3KL7A 4C1CA 3RKJA 2NZFA 3SBLA 2BG8A 5AXRA 4LE6A 2BIBA 4PVOA 4NQ4A 4C1EA 4FR7A 2GKLA 2CBNA 4Z6XA 4XWTA 2QJSA 4EYFA 3I14A 4F6ZA 1BMCA 2FU6A 4KEPA 4AD9A 2I7VA 5HH4A 3ZNBA 2VW8A 4RL0A 4UA4A 3T3NA 5ACSA 3KNSA 2BFZA 1SMLA 3PY5A 3BK2A 4NQ5A 3DHAA 3TP9A 2A7MA 2M5DA 4HL2A 2OHHA 1P9EA 2NYPA 4AX1B 1E5DA 1A7TA 4U4LA 3ADRA 3VQZA 4TZBA 1X8HA 2P97A 5HH5A 5A0TA 4ZNBA 1KR3A 3I0VA 4D1UA 4Z5ZA 1JJTA 4UBQA 4NQ2A 2ZZIA 4RAWA 5LS3A 2P4ZA 2R2DA 1M2XA 2NZEA 5B1UA 3RPCA 3X30A 2WHGA 4V0HA 4TZEA 4UWSB 5EVKA 5K4KA 3T9MA 4D1TA 4Z60A 2YNWA 4EXYA 1K07A 2FM6A 4BP0A 2BR6A 2HB9A 3ESHA 5EHTA 3PY6A
chains in the Genus database with same CATH superfamily
3X2ZA 2GFKA 5AHRA 4O98A 2BG6A 5HH6A 4ZO3A 1MQOA 2ZNBA 3SW3A 5LM6A 5LSCA 2AZ4A 2CG3A 1DDKA 4D02A 3A4YA 5ACXA 3DHCA 2UYXA 4XWWA 3LVZA 2BC2A 2YCBA 3BV6A 2GFJA 5LE1A 2XF4A 2YZ3A 4UWRB 2ZWRA 2OHJA 3DHBA 1JJEA 5ACUA 5KIKA 1WUPA 4NQ6A 4HKYA 2P1EA 3PG4A 2M5CA 1VMEA 4KEQA 4EYLA 4F6HA 1BVTA 2BG8B 4C1GA 3H3EA 2DOOA 5AEBA 4EYBA 3AJ3A 2FU7A 5AYAA 2QINA 4RM5A 4TYFA 3T3OA 1Y44A 3FAIA 3IEMA 4ZEJA 1ZTCA 2Q0IA 4EY2A 2Q0JA 4RAMA 5FQAA 4DIKA 4C09A 4TZ9A 5AHOA 1X8IA 4FSBA 2YNVA 5ACWA 4ZO2A 4AX0B 2FHXB 1XM8A 2YNUA 5FQCA 5ACQA 2BGAA 3RKKA 2BG2A 4Z5YA 1KO2A 2DKFA 5EWAA 1VJNA 1X8GA 3SRXA 2Y8BA 3IE0A 2Y87A 3R2UA 2WYLA 4GYUA 4AXHA 2H6AA 2Q9UA 5HIPA 2OHIA 5ACTA 2CFZA 3DH8A 3I13A 5LCAA 1WRAA 4DILA 5A0VA 2BFLA 2FU9A 5HISA 3S0ZA 1L9YA 2BFKA 1QH5A 4FEKA 4H0DA 5LCHA 2WRSA 5FQBA 5EH9A 3F9OA 5B15A 4PVTA 2I7TA 3SFPA 4TZFA 1ZNBA 4WD6A 3VPEA 4HL1A 5B3RA 3IOFA 4C1HA 5ACRA 3I11A 3ZQ4A 1JT1A 2QDSA 3WXCA 4GCWA 2BMIA 4TYTA 3KNRA 5HIQA 3SPUA 2GMNA 2P18A 4UAMA 1A8TA 4UWPB 2NXAA 2QEDA 5IQKA 4P62A 3P2UA 3Q6VA 5AIJA 5LMCA 5A87A 2I7XA 2FU8A 4J5FA 2BTNA 2GCUA 2YNTA 5EVBA 3I15A 3IEKA 2Y8AA 5K0WA 3IE2A 1QH3A 4D1WA 5EW0A 4C1FA 3AF5A 5DPXA 4Z7RA 2WYMA 4RBSA 2YNTB 3QH8A 5ACVA 4AWZA 2ZO4A 2AIOA 5AXOA 3X2XA 3IOGA 4RL2A 5HIOA 1YCGA 3ZWFA 5LCFA 1DD6A 2QDTA 3AF6A 5EV6A 3FCZA 4GYQA 2XR1A 4B87A 4YSBA 4XUKA 2YNVB 5K4MA 5A5ZA 1YCHA 1KO3A 4D1VA 4Z67A 1BC2A 4UWOB 2BG7A 4EFZA 1YCFA 4BZ3A 3MD7A 1DXKA 3SD9A 1HLKA 1WW1A 5EVDA 5ACPA 4NURA 3IDZA 2WYMC 1WUOA 3X2YA 4AWYB 5EV8A 4C1DA 3G1PA 4J5HA 5LLDA 5KILA 3BC2A 2E7YA 3IELA 3JXPA 3L6NA 4EXSA 2FK6A 4JO0A 1ZKPA 4YSLA 3BK1A 4CHLA 1VGNA 1XTOA 3ZR9A 2BFZB 2Q42A 2FHXA 2CG2A 5K4NA 3IE1A 4YSKA 3KL7A 4C1CA 3RKJA 2NZFA 3SBLA 2BG8A 5AXRA 4LE6A 2BIBA 4PVOA 4NQ4A 5A23A 4C1EA 4FR7A 2GKLA 2CBNA 4Z6XA 4XWTA 2QJSA 4EYFA 3I14A 4F6ZA 1BMCA 2FU6A 4KEPA 4AD9A 2I7VA 5HH4A 3ZNBA 2VW8A 2YHEA 4RL0A 4UA4A 3T3NA 5ACSA 3KNSA 2BFZA 1SMLA 3PY5A 3BK2A 2CFUA 4NQ5A 3DHAA 5AJLA 3TP9A 2A7MA 2M5DA 4HL2A 2OHHA 1P9EA 2NYPA 4AX1B 1E5DA 1A7TA 4U4LA 3ADRA 3VQZA 4TZBA 4PDXA 1X8HA 2P97A 5HH5A 5A0TA 4ZNBA 1KR3A 3I0VA 4D1UA 4Z5ZA 1JJTA 4UBQA 4NQ2A 4AV7A 2ZZIA 4RAWA 5LS3A 2P4ZA 2R2DA 1M2XA 2NZEA 5B1UA 3RPCA 3X30A 2WHGA 4V0HA 4TZEA 4UWSB 5EVKA 5K4KA 3T9MA 4D1TA 4Z60A 2YNWA 4EXYA 1K07A 2FM6A 4BP0A 2BR6A 2HB9A 3ESHA 5EHTA 3PY6A
chains in the Genus database with same CATH topology
3X2ZA 2GFKA 5AHRA 4O98A 2BG6A 5HH6A 4ZO3A 1MQOA 2ZNBA 3SW3A 5LM6A 5LSCA 2AZ4A 4D02A 1DDKA 3A4YA 5ACXA 3DHCA 2UYXA 4XWWA 3LVZA 2BC2A 2YCBA 3BV6A 2GFJA 5LE1A 2XF4A 2YZ3A 4UWRB 2ZWRA 2OHJA 3DHBA 1JJEA 5ACUA 5KIKA 1WUPA 4NQ6A 4HKYA 2P1EA 3PG4A 2M5CA 1VMEA 4KEQA 4EYLA 4F6HA 1BVTA 2BG8B 4C1GA 3H3EA 2DOOA 5AEBA 4EYBA 3AJ3A 2FU7A 5AYAA 2QINA 4RM5A 4TYFA 3T3OA 1Y44A 3FAIA 3IEMA 4ZEJA 1ZTCA 2Q0IA 4EY2A 2Q0JA 4RAMA 5FQAA 4DIKA 4C09A 4TZ9A 5AHOA 1X8IA 4FSBA 2YNVA 5ACWA 4ZO2A 4AX0B 2FHXB 1XM8A 2YNUA 5FQCA 5ACQA 2BGAA 3RKKA 2BG2A 4Z5YA 1KO2A 2DKFA 5EWAA 1VJNA 1X8GA 3SRXA 2Y8BA 3IE0A 2Y87A 3R2UA 2WYLA 4GYUA 2H6AA 2Q9UA 5HIPA 2OHIA 5ACTA 3DH8A 3I13A 5LCAA 1WRAA 4DILA 5A0VA 2BFLA 2FU9A 5HISA 3S0ZA 1L9YA 2BFKA 1QH5A 4FEKA 4H0DA 5LCHA 2WRSA 5FQBA 5EH9A 3F9OA 5B15A 4PVTA 2I7TA 3SFPA 4TZFA 1ZNBA 4WD6A 3VPEA 4HL1A 5B3RA 3IOFA 4C1HA 5ACRA 3I11A 3ZQ4A 1JT1A 2QDSA 3WXCA 4GCWA 2BMIA 4TYTA 3KNRA 5HIQA 3SPUA 2GMNA 2P18A 4UAMA 1A8TA 4UWPB 2NXAA 2QEDA 5IQKA 4P62A 3P2UA 3Q6VA 5LMCA 5A87A 2I7XA 2FU8A 4J5FA 2BTNA 2GCUA 2YNTA 5EVBA 3I15A 3IEKA 2Y8AA 5K0WA 3IE2A 1QH3A 4D1WA 5EW0A 4C1FA 3AF5A 5DPXA 4Z7RA 2WYMA 4RBSA 2YNTB 3QH8A 5ACVA 4AWZA 2ZO4A 2AIOA 5AXOA 3X2XA 3IOGA 4RL2A 5HIOA 1YCGA 3ZWFA 5LCFA 1DD6A 2QDTA 3AF6A 5EV6A 3FCZA 4GYQA 2XR1A 4B87A 4YSBA 4XUKA 2YNVB 5K4MA 5A5ZA 1YCHA 1KO3A 4D1VA 4Z67A 1BC2A 4UWOB 2BG7A 4EFZA 1YCFA 4BZ3A 3MD7A 1DXKA 3SD9A 1HLKA 1WW1A 5EVDA 5ACPA 3IDZA 2WYMC 1WUOA 3X2YA 4AWYB 5EV8A 4C1DA 3G1PA 4J5HA 5LLDA 5KILA 3BC2A 2E7YA 3IELA 3JXPA 3L6NA 4EXSA 2FK6A 4JO0A 1ZKPA 4YSLA 3BK1A 4CHLA 1VGNA 1XTOA 3ZR9A 2BFZB 2Q42A 2FHXA 5K4NA 3IE1A 4YSKA 3KL7A 4C1CA 3RKJA 2NZFA 3SBLA 2BG8A 5AXRA 4LE6A 2BIBA 4PVOA 4NQ4A 4C1EA 4FR7A 2GKLA 2CBNA 4Z6XA 4XWTA 2QJSA 4EYFA 3I14A 4F6ZA 1BMCA 2FU6A 4KEPA 4AD9A 2I7VA 5HH4A 3ZNBA 2VW8A 4RL0A 4UA4A 3T3NA 5ACSA 3KNSA 2BFZA 1SMLA 3PY5A 3BK2A 4NQ5A 3DHAA 3TP9A 2A7MA 2M5DA 4HL2A 2OHHA 1P9EA 2NYPA 4AX1B 1E5DA 1A7TA 4U4LA 3ADRA 3VQZA 4TZBA 1X8HA 2P97A 5HH5A 5A0TA 4ZNBA 1KR3A 3I0VA 4D1UA 4Z5ZA 1JJTA 4UBQA 4NQ2A 2ZZIA 4RAWA 5LS3A 2P4ZA 2R2DA 1M2XA 2NZEA 5B1UA 3RPCA 3X30A 2WHGA 4V0HA 4TZEA 4UWSB 5EVKA 5K4KA 3T9MA 4D1TA 4Z60A 2YNWA 4EXYA 1K07A 2FM6A 4BP0A 2BR6A 2HB9A 3ESHA 5EHTA 3PY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Z A;  2GFK A;  5AHR A;  4O98 A;  2BG6 A;  5HH6 A;  4ZO3 A;  1MQO A;  2ZNB A;  3SW3 A;  5LM6 A;  5LSC A;  2AZ4 A;  4D02 A;  1DDK A;  3A4Y A;  5ACX A;  3DHC A;  2UYX A;  4XWW A;  3LVZ A;  2BC2 A;  2YCB A;  3BV6 A;  2GFJ A;  5LE1 A;  2XF4 A;  2YZ3 A;  4UWR B;  2ZWR A;  2OHJ A;  3DHB A;  1JJE A;  5ACU A;  5KIK A;  1WUP A;  4NQ6 A;  4HKY A;  2P1E A;  3PG4 A;  2M5C A;  1VME A;  4KEQ A;  4EYL A;  4F6H A;  1BVT A;  2BG8 B;  4C1G A;  3H3E A;  2DOO A;  5AEB A;  4EYB A;  3AJ3 A;  2FU7 A;  5AYA A;  2QIN A;  4RM5 A;  4TYF A;  3T3O A;  1Y44 A;  3FAI A;  3IEM A;  4ZEJ A;  1ZTC A;  2Q0I A;  4EY2 A;  2Q0J A;  4RAM A;  5FQA A;  4DIK A;  4C09 A;  4TZ9 A;  5AHO A;  1X8I A;  4FSB A;  2YNV A;  5ACW A;  4ZO2 A;  4AX0 B;  2FHX B;  1XM8 A;  2YNU A;  5FQC A;  5ACQ A;  2BGA A;  3RKK A;  2BG2 A;  4Z5Y A;  1KO2 A;  2DKF A;  5EWA A;  1VJN A;  1X8G A;  3SRX A;  2Y8B A;  3IE0 A;  2Y87 A;  3R2U A;  2WYL A;  4GYU A;  2H6A A;  2Q9U A;  5HIP A;  2OHI A;  5ACT A;  3DH8 A;  3I13 A;  5LCA A;  1WRA A;  4DIL A;  5A0V A;  2BFL A;  2FU9 A;  5HIS A;  3S0Z A;  1L9Y A;  2BFK A;  1QH5 A;  4FEK A;  4H0D A;  5LCH A;  2WRS A;  5FQB A;  5EH9 A;  3F9O A;  5B15 A;  4PVT A;  2I7T A;  3SFP A;  4TZF A;  1ZNB A;  4WD6 A;  3VPE A;  4HL1 A;  5B3R A;  3IOF A;  4C1H A;  5ACR A;  3I11 A;  3ZQ4 A;  1JT1 A;  2QDS A;  3WXC A;  4GCW A;  2BMI A;  4TYT A;  3KNR A;  5HIQ A;  3SPU A;  2GMN A;  2P18 A;  4UAM A;  1A8T A;  4UWP B;  2NXA A;  2QED A;  5IQK A;  4P62 A;  3P2U A;  3Q6V A;  5LMC A;  5A87 A;  2I7X A;  2FU8 A;  4J5F A;  2BTN A;  2GCU A;  2YNT A;  5EVB A;  3I15 A;  3IEK A;  2Y8A A;  5K0W A;  3IE2 A;  1QH3 A;  4D1W A;  5EW0 A;  4C1F A;  3AF5 A;  5DPX A;  4Z7R A;  2WYM A;  4RBS A;  2YNT B;  3QH8 A;  5ACV A;  4AWZ A;  2ZO4 A;  2AIO A;  5AXO A;  3X2X A;  3IOG A;  4RL2 A;  5HIO A;  1YCG A;  3ZWF A;  5LCF A;  1DD6 A;  2QDT A;  3AF6 A;  5EV6 A;  3FCZ A;  4GYQ A;  2XR1 A;  4B87 A;  4YSB A;  4XUK A;  2YNV B;  5K4M A;  5A5Z A;  1YCH A;  1KO3 A;  4D1V A;  4Z67 A;  1BC2 A;  4UWO B;  2BG7 A;  4EFZ A;  1YCF A;  4BZ3 A;  3MD7 A;  1DXK A;  3SD9 A;  1HLK A;  1WW1 A;  5EVD A;  5ACP A;  3IDZ A;  2WYM C;  1WUO A;  3X2Y A;  4AWY B;  5EV8 A;  4C1D A;  3G1P A;  4J5H A;  5LLD A;  5KIL A;  3BC2 A;  2E7Y A;  3IEL A;  3JXP A;  3L6N A;  4EXS A;  2FK6 A;  4JO0 A;  1ZKP A;  4YSL A;  3BK1 A;  4CHL A;  1VGN A;  1XTO A;  3ZR9 A;  2BFZ B;  2Q42 A;  2FHX A;  5K4N A;  3IE1 A;  4YSK A;  3KL7 A;  4C1C A;  3RKJ A;  2NZF A;  3SBL A;  2BG8 A;  5AXR A;  4LE6 A;  2BIB A;  4PVO A;  4NQ4 A;  4C1E A;  4FR7 A;  2GKL A;  2CBN A;  4Z6X A;  4XWT A;  2QJS A;  4EYF A;  3I14 A;  4F6Z A;  1BMC A;  2FU6 A;  4KEP A;  4AD9 A;  2I7V A;  5HH4 A;  3ZNB A;  2VW8 A;  4RL0 A;  4UA4 A;  3T3N A;  5ACS A;  3KNS A;  2BFZ A;  1SML A;  3PY5 A;  3BK2 A;  4NQ5 A;  3DHA A;  3TP9 A;  2A7M A;  2M5D A;  4HL2 A;  2OHH A;  1P9E A;  2NYP A;  4AX1 B;  1E5D A;  1A7T A;  4U4L A;  3ADR A;  3VQZ A;  4TZB A;  1X8H A;  2P97 A;  5HH5 A;  5A0T A;  4ZNB A;  1KR3 A;  3I0V A;  4D1U A;  4Z5Z A;  1JJT A;  4UBQ A;  4NQ2 A;  2ZZI A;  4RAW A;  5LS3 A;  2P4Z A;  2R2D A;  1M2X A;  2NZE A;  5B1U A;  3RPC A;  3X30 A;  2WHG A;  4V0H A;  4TZE A;  4UWS B;  5EVK A;  5K4K A;  3T9M A;  4D1T A;  4Z60 A;  2YNW A;  4EXY A;  1K07 A;  2FM6 A;  4BP0 A;  2BR6 A;  2HB9 A;  3ESH A;  5EHT A;  3PY6 A; 
#chains in the Genus database with same CATH topology
 3X2Z A;  2GFK A;  5AHR A;  4O98 A;  2BG6 A;  5HH6 A;  4ZO3 A;  1MQO A;  2ZNB A;  3SW3 A;  5LM6 A;  5LSC A;  2AZ4 A;  2CG3 A;  1DDK A;  4D02 A;  3A4Y A;  5ACX A;  3DHC A;  2UYX A;  4XWW A;  3LVZ A;  2BC2 A;  2YCB A;  3BV6 A;  2GFJ A;  5LE1 A;  2XF4 A;  2YZ3 A;  4UWR B;  2ZWR A;  2OHJ A;  3DHB A;  1JJE A;  5ACU A;  5KIK A;  1WUP A;  4NQ6 A;  4HKY A;  2P1E A;  3PG4 A;  2M5C A;  1VME A;  4KEQ A;  4EYL A;  4F6H A;  1BVT A;  2BG8 B;  4C1G A;  3H3E A;  2DOO A;  5AEB A;  4EYB A;  3AJ3 A;  2FU7 A;  5AYA A;  2QIN A;  4RM5 A;  4TYF A;  3T3O A;  1Y44 A;  3FAI A;  3IEM A;  4ZEJ A;  1ZTC A;  2Q0I A;  4EY2 A;  2Q0J A;  4RAM A;  5FQA A;  4DIK A;  4C09 A;  4TZ9 A;  5AHO A;  1X8I A;  4FSB A;  2YNV A;  5ACW A;  4ZO2 A;  4AX0 B;  2FHX B;  1XM8 A;  2YNU A;  5FQC A;  5ACQ A;  2BGA A;  3RKK A;  2BG2 A;  4Z5Y A;  1KO2 A;  2DKF A;  5EWA A;  1VJN A;  1X8G A;  3SRX A;  2Y8B A;  3IE0 A;  2Y87 A;  3R2U A;  2WYL A;  4GYU A;  4AXH A;  2H6A A;  2Q9U A;  5HIP A;  2OHI A;  5ACT A;  2CFZ A;  3DH8 A;  3I13 A;  5LCA A;  1WRA A;  4DIL A;  5A0V A;  2BFL A;  2FU9 A;  5HIS A;  3S0Z A;  1L9Y A;  2BFK A;  1QH5 A;  4FEK A;  4H0D A;  5LCH A;  2WRS A;  5FQB A;  5EH9 A;  3F9O A;  5B15 A;  4PVT A;  2I7T A;  3SFP A;  4TZF A;  1ZNB A;  4WD6 A;  3VPE A;  4HL1 A;  5B3R A;  3IOF A;  4C1H A;  5ACR A;  3I11 A;  3ZQ4 A;  1JT1 A;  2QDS A;  3WXC A;  4GCW A;  2BMI A;  4TYT A;  3KNR A;  5HIQ A;  3SPU A;  2GMN A;  2P18 A;  4UAM A;  1A8T A;  4UWP B;  2NXA A;  2QED A;  5IQK A;  4P62 A;  3P2U A;  3Q6V A;  5AIJ A;  5LMC A;  5A87 A;  2I7X A;  2FU8 A;  4J5F A;  2BTN A;  2GCU A;  2YNT A;  5EVB A;  3I15 A;  3IEK A;  2Y8A A;  5K0W A;  3IE2 A;  1QH3 A;  4D1W A;  5EW0 A;  4C1F A;  3AF5 A;  5DPX A;  4Z7R A;  2WYM A;  4RBS A;  2YNT B;  3QH8 A;  5ACV A;  4AWZ A;  2ZO4 A;  2AIO A;  5AXO A;  3X2X A;  3IOG A;  4RL2 A;  5HIO A;  1YCG A;  3ZWF A;  5LCF A;  1DD6 A;  2QDT A;  3AF6 A;  5EV6 A;  3FCZ A;  4GYQ A;  2XR1 A;  4B87 A;  4YSB A;  4XUK A;  2YNV B;  5K4M A;  5A5Z A;  1YCH A;  1KO3 A;  4D1V A;  4Z67 A;  1BC2 A;  4UWO B;  2BG7 A;  4EFZ A;  1YCF A;  4BZ3 A;  3MD7 A;  1DXK A;  3SD9 A;  1HLK A;  1WW1 A;  5EVD A;  5ACP A;  4NUR A;  3IDZ A;  2WYM C;  1WUO A;  3X2Y A;  4AWY B;  5EV8 A;  4C1D A;  3G1P A;  4J5H A;  5LLD A;  5KIL A;  3BC2 A;  2E7Y A;  3IEL A;  3JXP A;  3L6N A;  4EXS A;  2FK6 A;  4JO0 A;  1ZKP A;  4YSL A;  3BK1 A;  4CHL A;  1VGN A;  1XTO A;  3ZR9 A;  2BFZ B;  2Q42 A;  2FHX A;  2CG2 A;  5K4N A;  3IE1 A;  4YSK A;  3KL7 A;  4C1C A;  3RKJ A;  2NZF A;  3SBL A;  2BG8 A;  5AXR A;  4LE6 A;  2BIB A;  4PVO A;  4NQ4 A;  5A23 A;  4C1E A;  4FR7 A;  2GKL A;  2CBN A;  4Z6X A;  4XWT A;  2QJS A;  4EYF A;  3I14 A;  4F6Z A;  1BMC A;  2FU6 A;  4KEP A;  4AD9 A;  2I7V A;  5HH4 A;  3ZNB A;  2VW8 A;  2YHE A;  4RL0 A;  4UA4 A;  3T3N A;  5ACS A;  3KNS A;  2BFZ A;  1SML A;  3PY5 A;  3BK2 A;  2CFU A;  4NQ5 A;  3DHA A;  5AJL A;  3TP9 A;  2A7M A;  2M5D A;  4HL2 A;  2OHH A;  1P9E A;  2NYP A;  4AX1 B;  1E5D A;  1A7T A;  4U4L A;  3ADR A;  3VQZ A;  4TZB A;  4PDX A;  1X8H A;  2P97 A;  5HH5 A;  5A0T A;  4ZNB A;  1KR3 A;  3I0V A;  4D1U A;  4Z5Z A;  1JJT A;  4UBQ A;  4NQ2 A;  4AV7 A;  2ZZI A;  4RAW A;  5LS3 A;  2P4Z A;  2R2D A;  1M2X A;  2NZE A;  5B1U A;  3RPC A;  3X30 A;  2WHG A;  4V0H A;  4TZE A;  4UWS B;  5EVK A;  5K4K A;  3T9M A;  4D1T A;  4Z60 A;  2YNW A;  4EXY A;  1K07 A;  2FM6 A;  4BP0 A;  2BR6 A;  2HB9 A;  3ESH A;  5EHT A;  3PY6 A; 
#chains in the Genus database with same CATH homology
 3X2Z A;  2GFK A;  5AHR A;  4O98 A;  2BG6 A;  5HH6 A;  4ZO3 A;  1MQO A;  2ZNB A;  3SW3 A;  5LM6 A;  5LSC A;  2AZ4 A;  4D02 A;  1DDK A;  3A4Y A;  5ACX A;  3DHC A;  2UYX A;  4XWW A;  3LVZ A;  2BC2 A;  2YCB A;  3BV6 A;  2GFJ A;  5LE1 A;  2XF4 A;  2YZ3 A;  4UWR B;  2ZWR A;  2OHJ A;  3DHB A;  1JJE A;  5ACU A;  5KIK A;  1WUP A;  4NQ6 A;  4HKY A;  2P1E A;  3PG4 A;  2M5C A;  1VME A;  4KEQ A;  4EYL A;  4F6H A;  1BVT A;  2BG8 B;  4C1G A;  3H3E A;  2DOO A;  5AEB A;  4EYB A;  3AJ3 A;  2FU7 A;  5AYA A;  2QIN A;  4RM5 A;  4TYF A;  3T3O A;  1Y44 A;  3FAI A;  3IEM A;  4ZEJ A;  1ZTC A;  2Q0I A;  4EY2 A;  2Q0J A;  4RAM A;  5FQA A;  4DIK A;  4C09 A;  4TZ9 A;  5AHO A;  1X8I A;  4FSB A;  2YNV A;  5ACW A;  4ZO2 A;  4AX0 B;  2FHX B;  1XM8 A;  2YNU A;  5FQC A;  5ACQ A;  2BGA A;  3RKK A;  2BG2 A;  4Z5Y A;  1KO2 A;  2DKF A;  5EWA A;  1VJN A;  1X8G A;  3SRX A;  2Y8B A;  3IE0 A;  2Y87 A;  3R2U A;  2WYL A;  4GYU A;  2H6A A;  2Q9U A;  5HIP A;  2OHI A;  5ACT A;  3DH8 A;  3I13 A;  5LCA A;  1WRA A;  4DIL A;  5A0V A;  2BFL A;  2FU9 A;  5HIS A;  3S0Z A;  1L9Y A;  2BFK A;  1QH5 A;  4FEK A;  4H0D A;  5LCH A;  2WRS A;  5FQB A;  5EH9 A;  3F9O A;  5B15 A;  4PVT A;  2I7T A;  3SFP A;  4TZF A;  1ZNB A;  4WD6 A;  3VPE A;  4HL1 A;  5B3R A;  3IOF A;  4C1H A;  5ACR A;  3I11 A;  3ZQ4 A;  1JT1 A;  2QDS A;  3WXC A;  4GCW A;  2BMI A;  4TYT A;  3KNR A;  5HIQ A;  3SPU A;  2GMN A;  2P18 A;  4UAM A;  1A8T A;  4UWP B;  2NXA A;  2QED A;  5IQK A;  4P62 A;  3P2U A;  3Q6V A;  5LMC A;  5A87 A;  2I7X A;  2FU8 A;  4J5F A;  2BTN A;  2GCU A;  2YNT A;  5EVB A;  3I15 A;  3IEK A;  2Y8A A;  5K0W A;  3IE2 A;  1QH3 A;  4D1W A;  5EW0 A;  4C1F A;  3AF5 A;  5DPX A;  4Z7R A;  2WYM A;  4RBS A;  2YNT B;  3QH8 A;  5ACV A;  4AWZ A;  2ZO4 A;  2AIO A;  5AXO A;  3X2X A;  3IOG A;  4RL2 A;  5HIO A;  1YCG A;  3ZWF A;  5LCF A;  1DD6 A;  2QDT A;  3AF6 A;  5EV6 A;  3FCZ A;  4GYQ A;  2XR1 A;  4B87 A;  4YSB A;  4XUK A;  2YNV B;  5K4M A;  5A5Z A;  1YCH A;  1KO3 A;  4D1V A;  4Z67 A;  1BC2 A;  4UWO B;  2BG7 A;  4EFZ A;  1YCF A;  4BZ3 A;  3MD7 A;  1DXK A;  3SD9 A;  1HLK A;  1WW1 A;  5EVD A;  5ACP A;  3IDZ A;  2WYM C;  1WUO A;  3X2Y A;  4AWY B;  5EV8 A;  4C1D A;  3G1P A;  4J5H A;  5LLD A;  5KIL A;  3BC2 A;  2E7Y A;  3IEL A;  3JXP A;  3L6N A;  4EXS A;  2FK6 A;  4JO0 A;  1ZKP A;  4YSL A;  3BK1 A;  4CHL A;  1VGN A;  1XTO A;  3ZR9 A;  2BFZ B;  2Q42 A;  2FHX A;  5K4N A;  3IE1 A;  4YSK A;  3KL7 A;  4C1C A;  3RKJ A;  2NZF A;  3SBL A;  2BG8 A;  5AXR A;  4LE6 A;  2BIB A;  4PVO A;  4NQ4 A;  4C1E A;  4FR7 A;  2GKL A;  2CBN A;  4Z6X A;  4XWT A;  2QJS A;  4EYF A;  3I14 A;  4F6Z A;  1BMC A;  2FU6 A;  4KEP A;  4AD9 A;  2I7V A;  5HH4 A;  3ZNB A;  2VW8 A;  4RL0 A;  4UA4 A;  3T3N A;  5ACS A;  3KNS A;  2BFZ A;  1SML A;  3PY5 A;  3BK2 A;  4NQ5 A;  3DHA A;  3TP9 A;  2A7M A;  2M5D A;  4HL2 A;  2OHH A;  1P9E A;  2NYP A;  4AX1 B;  1E5D A;  1A7T A;  4U4L A;  3ADR A;  3VQZ A;  4TZB A;  1X8H A;  2P97 A;  5HH5 A;  5A0T A;  4ZNB A;  1KR3 A;  3I0V A;  4D1U A;  4Z5Z A;  1JJT A;  4UBQ A;  4NQ2 A;  2ZZI A;  4RAW A;  5LS3 A;  2P4Z A;  2R2D A;  1M2X A;  2NZE A;  5B1U A;  3RPC A;  3X30 A;  2WHG A;  4V0H A;  4TZE A;  4UWS B;  5EVK A;  5K4K A;  3T9M A;  4D1T A;  4Z60 A;  2YNW A;  4EXY A;  1K07 A;  2FM6 A;  4BP0 A;  2BR6 A;  2HB9 A;  3ESH A;  5EHT A;  3PY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...