4LE6A

Crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
300
structure length
257
Chain Sequence
AAPAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFSPIRSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Organophosphorus hydrolase
publication title Structural and Enzymatic Characterization of the Phosphotriesterase OPHC2 from Pseudomonas pseudoalcaligenes.
pubmed doi rcsb
source organism Pseudomonas pseudoalcaligenes
total genus 66
structure length 257
sequence length 300
chains with identical sequence B, C, D, E
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4le6A00
3ZR9A 4F6HA 2BG6A 1MQOA 2WYLA 4AWZA 4YSBA 4RM5A 3IE0A 4UBQA 3IE1A 5LSCA 2QDTA 2Q9UA 1KO3A 3IE2A 2YNTB 4D02A 5LE1A 5A0VA 2YNUA 4JO0A 2I7XA 2OHIA 3KNRA 2OHJA 2BG8B 2Q0JA 4Z6XA 1DD6A 2M5CA 3IEKA 1ZKPA 1X8HA 4C1FA 1KR3A 4TZEA 1BMCA 2P18A 5HIOA 2AZ4A 4J5HA 2ZO4A 2QINA 2NYPA 5HH4A 1VMEA 1JJEA 5LS3A 2Y87A 2BTNA 3PY5A 3T3NA 2GFKA 3F9OA 3X2ZA 2XR1A 1KO2A 2BFZA 3RKJA 1X8IA 1JJTA 4C1DA 4UAMA 4ZO3A 4HL2A 1E5DA 3VQZA 5EV8A 5K4MA 3ZWFA 2AIOA 2WYMA 5K4NA 4C1HA 3FAIA 1YCHA 4C1CA 5HIQA 4Z60A 3IOFA 1DXKA 2Y8BA 4TZBA 5LCAA 1VGNA 1QH5A 5AHOA 1K07A 1WRAA 4UA4A 2BC2A 5AXRA 4Z67A 1WUOA 4EY2A 4AD9A 2BFLA 4F6ZA 2WYMC 1WW1A 5EVBA 5ACXA 3G1PA 4EFZA 5FQAA 4DILA 2M5DA 2I7TA 5LCHA 3DHAA 2NZFA 4Z5YA 4GCWA 4RBSA 4J5FA 4H0DA 5EH9A 2Q0IA 4YSKA 3JXPA 1QH3A 2FK6A 1P9EA 2BFZB 1A8TA 4LE6A 3DHCA 4NQ2A 5HISA 4D1WA 5KIKA 4EYBA 4YSLA 1XM8A 2FU7A 2BMIA 5AYAA 4FR7A 3L6NA 2YCBA 4GYQA 5ACQA 5HH6A 2QDSA 5ACPA 4ZEJA 2NZEA 2Q42A 4RAWA 1JT1A 3AF5A 4GYUA 3SPUA 4AX0B 3LVZA 2FM6A 5ACWA 5EVKA 5AXOA 3S0ZA 4BZ3A 4AX1B 3DH8A 2YZ3A 4XWTA 2GCUA 4Z5ZA 4B87A 3PG4A 5EHTA 3T3OA 4UWSB 2UYXA 1DDKA 3SD9A 1L9YA 3I11A 3KNSA 3SW3A 2VW8A 2ZWRA 2WRSA 5EWAA 2YNTA 4RL0A 2FU6A 3P2UA 1A7TA 4KEQA 2P4ZA 5LLDA 4UWPB 5LM6A 1YCFA 3SRXA 2BG7A 4PVTA 5K0WA 2DOOA 3IDZA 3RKKA 4HL1A 3X2YA 1X8GA 5LMCA 2GKLA 2WHGA 3X30A 4TYTA 3I13A 1M2XA 5KILA 2BIBA 1SMLA 4AWYB 3IELA 4C1EA 3H3EA 4ZO2A 4EYFA 4PVOA 2OHHA 4WD6A 4Z7RA 1WUPA 5EW0A 2A7MA 3ADRA 5ACRA 4XUKA 3SBLA 1HLKA 3IOGA 3SFPA 3I0VA 3VPEA 2R2DA 5IQKA 4FSBA 3QH8A 2YNVA 4O98A 4V0HA 3BC2A 2H6AA 2CBNA 3BV6A 1BC2A 1Y44A 2I7VA 4TZ9A 2QEDA 4TZFA 5EVDA 5A5ZA 3Q6VA 1XTOA 5ACUA 4EXSA 4XWWA 5FQCA 2ZNBA 4RL2A 4UWRB 3RPCA 2FHXA 2P97A 2BG2A 2E7YA 5ACSA 5EV6A 3ESHA 2DKFA 3R2UA 4NQ5A 5K4KA 3I14A 4U4LA 5DPXA 3AF6A 3PY6A 3IEMA 1VJNA 4BP0A 4D1UA 4FEKA 5ACTA 5HH5A 3WXCA 2FU9A 5FQBA 4DIKA 1BVTA 4ZNBA 3ZQ4A 1ZNBA 4NQ6A 3X2XA 4D1TA 2BG8A 3T9MA 2HB9A 4TYFA 4C1GA 4D1VA 2BR6A 2YNVB 3DHBA 4P62A 2ZZIA 2GFJA 2QJSA 5B1UA 3ZNBA 2FU8A 3BK1A 1YCGA 2BGAA 3AJ3A 2YNWA 5A87A 5ACVA 4EXYA 3BK2A 5AHRA 3FCZA 3KL7A 4NQ4A 2XF4A 2BFKA 2P1EA 2Y8AA 5B15A 4CHLA 1ZTCA 3I15A 3MD7A 2GMNA 2FHXB 4HKYA 5B3RA 5A0TA 5LCFA 4EYLA 4KEPA 4C09A 3TP9A 2NXAA 3A4YA 4RAMA 4UWOB 5HIPA 5AEBA
chains in the Genus database with same CATH superfamily
3ZR9A 4F6HA 2BG6A 1MQOA 2WYLA 4AWZA 4YSBA 4RM5A 3IE0A 4UBQA 3IE1A 5LSCA 2QDTA 2Q9UA 1KO3A 3IE2A 2YNTB 4D02A 5LE1A 5A0VA 2YNUA 4JO0A 2I7XA 2OHIA 3KNRA 2OHJA 2BG8B 2Q0JA 4Z6XA 1DD6A 2M5CA 3IEKA 1ZKPA 2CFUA 1X8HA 4C1FA 1KR3A 4TZEA 1BMCA 2P18A 5HIOA 2AZ4A 4J5HA 2ZO4A 2QINA 2NYPA 5HH4A 1VMEA 2CFZA 1JJEA 5LS3A 2Y87A 2BTNA 3PY5A 3T3NA 2GFKA 3F9OA 3X2ZA 2XR1A 1KO2A 2BFZA 3RKJA 1X8IA 1JJTA 4C1DA 4UAMA 4ZO3A 4HL2A 1E5DA 3VQZA 5EV8A 5K4MA 3ZWFA 2AIOA 2WYMA 5K4NA 4C1HA 3FAIA 1YCHA 4C1CA 5HIQA 4Z60A 3IOFA 1DXKA 2Y8BA 4TZBA 5LCAA 1VGNA 1QH5A 5AHOA 1K07A 1WRAA 4UA4A 2BC2A 5AXRA 4Z67A 1WUOA 4NURA 4EY2A 4AD9A 2BFLA 4F6ZA 2WYMC 1WW1A 5EVBA 5ACXA 3G1PA 4EFZA 5FQAA 4DILA 2M5DA 2I7TA 5LCHA 3DHAA 2NZFA 4Z5YA 4GCWA 4RBSA 4J5FA 4H0DA 5EH9A 2Q0IA 4YSKA 3JXPA 1QH3A 2FK6A 1P9EA 2BFZB 1A8TA 4LE6A 3DHCA 4NQ2A 5HISA 4D1WA 5KIKA 4EYBA 4YSLA 1XM8A 2FU7A 2BMIA 5AYAA 4FR7A 3L6NA 2YCBA 4GYQA 5ACQA 5HH6A 2QDSA 5ACPA 4ZEJA 2NZEA 2Q42A 4RAWA 5A23A 1JT1A 3AF5A 4GYUA 3SPUA 4AX0B 3LVZA 2FM6A 5ACWA 5EVKA 5AXOA 3S0ZA 4BZ3A 4AX1B 4AXHA 3DH8A 2YZ3A 4XWTA 2GCUA 4Z5ZA 4B87A 3PG4A 5EHTA 3T3OA 4UWSB 2UYXA 1DDKA 3SD9A 1L9YA 3I11A 3KNSA 3SW3A 2VW8A 2ZWRA 2WRSA 4PDXA 5EWAA 2YNTA 4RL0A 2FU6A 3P2UA 1A7TA 4KEQA 2P4ZA 5LLDA 4UWPB 5LM6A 1YCFA 3SRXA 2BG7A 4PVTA 5K0WA 2DOOA 3IDZA 3RKKA 4HL1A 3X2YA 1X8GA 5LMCA 2GKLA 2WHGA 3X30A 4TYTA 3I13A 1M2XA 5KILA 2BIBA 1SMLA 4AWYB 3IELA 4C1EA 3H3EA 4ZO2A 4EYFA 4PVOA 2OHHA 4WD6A 4Z7RA 1WUPA 5EW0A 2A7MA 3ADRA 5ACRA 4XUKA 3SBLA 1HLKA 3IOGA 3SFPA 3I0VA 3VPEA 2R2DA 5IQKA 4FSBA 3QH8A 2YNVA 2CG3A 4O98A 4AV7A 4V0HA 3BC2A 2H6AA 2CBNA 2YHEA 3BV6A 1BC2A 1Y44A 2I7VA 4TZ9A 2QEDA 4TZFA 5EVDA 5A5ZA 3Q6VA 1XTOA 5ACUA 4EXSA 4XWWA 5FQCA 2ZNBA 4RL2A 4UWRB 3RPCA 2FHXA 2P97A 2BG2A 2E7YA 5ACSA 5EV6A 3ESHA 2DKFA 3R2UA 4NQ5A 5K4KA 3I14A 2CG2A 4U4LA 5DPXA 3AF6A 3PY6A 3IEMA 1VJNA 4BP0A 4D1UA 4FEKA 5ACTA 5HH5A 3WXCA 2FU9A 5FQBA 5AJLA 4DIKA 1BVTA 4ZNBA 3ZQ4A 1ZNBA 4NQ6A 3X2XA 4D1TA 2BG8A 3T9MA 2HB9A 4TYFA 4C1GA 4D1VA 2BR6A 2YNVB 3DHBA 4P62A 2ZZIA 2GFJA 2QJSA 5AIJA 5B1UA 3ZNBA 2FU8A 3BK1A 1YCGA 2BGAA 3AJ3A 2YNWA 5A87A 5ACVA 4EXYA 3BK2A 5AHRA 3FCZA 3KL7A 4NQ4A 2XF4A 2BFKA 2P1EA 2Y8AA 5B15A 4CHLA 1ZTCA 3I15A 3MD7A 2GMNA 2FHXB 4HKYA 5B3RA 5A0TA 5LCFA 4EYLA 4KEPA 4C09A 3TP9A 2NXAA 3A4YA 4RAMA 4UWOB 5HIPA 5AEBA
chains in the Genus database with same CATH topology
3ZR9A 4F6HA 2BG6A 1MQOA 2WYLA 4AWZA 4YSBA 4RM5A 3IE0A 4UBQA 3IE1A 5LSCA 2QDTA 2Q9UA 1KO3A 3IE2A 2YNTB 4D02A 5LE1A 5A0VA 2YNUA 4JO0A 2I7XA 2OHIA 3KNRA 2OHJA 2BG8B 2Q0JA 4Z6XA 1DD6A 2M5CA 3IEKA 1ZKPA 1X8HA 4C1FA 1KR3A 4TZEA 1BMCA 2P18A 5HIOA 2AZ4A 4J5HA 2ZO4A 2QINA 2NYPA 5HH4A 1VMEA 1JJEA 5LS3A 2Y87A 2BTNA 3PY5A 3T3NA 2GFKA 3F9OA 3X2ZA 2XR1A 1KO2A 2BFZA 3RKJA 1X8IA 1JJTA 4C1DA 4UAMA 4ZO3A 4HL2A 1E5DA 3VQZA 5EV8A 5K4MA 3ZWFA 2AIOA 2WYMA 5K4NA 4C1HA 3FAIA 1YCHA 4C1CA 5HIQA 4Z60A 3IOFA 1DXKA 2Y8BA 4TZBA 5LCAA 1VGNA 1QH5A 5AHOA 1K07A 1WRAA 4UA4A 2BC2A 5AXRA 4Z67A 1WUOA 4EY2A 4AD9A 2BFLA 4F6ZA 2WYMC 1WW1A 5EVBA 5ACXA 3G1PA 4EFZA 5FQAA 4DILA 2M5DA 2I7TA 5LCHA 3DHAA 2NZFA 4Z5YA 4GCWA 4RBSA 4J5FA 4H0DA 5EH9A 2Q0IA 4YSKA 3JXPA 1QH3A 2FK6A 1P9EA 2BFZB 1A8TA 4LE6A 3DHCA 4NQ2A 5HISA 4D1WA 5KIKA 4EYBA 4YSLA 1XM8A 2FU7A 2BMIA 5AYAA 4FR7A 3L6NA 2YCBA 4GYQA 5ACQA 5HH6A 2QDSA 5ACPA 4ZEJA 2NZEA 2Q42A 4RAWA 1JT1A 3AF5A 4GYUA 3SPUA 4AX0B 3LVZA 2FM6A 5ACWA 5EVKA 5AXOA 3S0ZA 4BZ3A 4AX1B 3DH8A 2YZ3A 4XWTA 2GCUA 4Z5ZA 4B87A 3PG4A 5EHTA 3T3OA 4UWSB 2UYXA 1DDKA 3SD9A 1L9YA 3I11A 3KNSA 3SW3A 2VW8A 2ZWRA 2WRSA 5EWAA 2YNTA 4RL0A 2FU6A 3P2UA 1A7TA 4KEQA 2P4ZA 5LLDA 4UWPB 5LM6A 1YCFA 3SRXA 2BG7A 4PVTA 5K0WA 2DOOA 3IDZA 3RKKA 4HL1A 3X2YA 1X8GA 5LMCA 2GKLA 2WHGA 3X30A 4TYTA 3I13A 1M2XA 5KILA 2BIBA 1SMLA 4AWYB 3IELA 4C1EA 3H3EA 4ZO2A 4EYFA 4PVOA 2OHHA 4WD6A 4Z7RA 1WUPA 5EW0A 2A7MA 3ADRA 5ACRA 4XUKA 3SBLA 1HLKA 3IOGA 3SFPA 3I0VA 3VPEA 2R2DA 5IQKA 4FSBA 3QH8A 2YNVA 4O98A 4V0HA 3BC2A 2H6AA 2CBNA 3BV6A 1BC2A 1Y44A 2I7VA 4TZ9A 2QEDA 4TZFA 5EVDA 5A5ZA 3Q6VA 1XTOA 5ACUA 4EXSA 4XWWA 5FQCA 2ZNBA 4RL2A 4UWRB 3RPCA 2FHXA 2P97A 2BG2A 2E7YA 5ACSA 5EV6A 3ESHA 2DKFA 3R2UA 4NQ5A 5K4KA 3I14A 4U4LA 5DPXA 3AF6A 3PY6A 3IEMA 1VJNA 4BP0A 4D1UA 4FEKA 5ACTA 5HH5A 3WXCA 2FU9A 5FQBA 4DIKA 1BVTA 4ZNBA 3ZQ4A 1ZNBA 4NQ6A 3X2XA 4D1TA 2BG8A 3T9MA 2HB9A 4TYFA 4C1GA 4D1VA 2BR6A 2YNVB 3DHBA 4P62A 2ZZIA 2GFJA 2QJSA 5B1UA 3ZNBA 2FU8A 3BK1A 1YCGA 2BGAA 3AJ3A 2YNWA 5A87A 5ACVA 4EXYA 3BK2A 5AHRA 3FCZA 3KL7A 4NQ4A 2XF4A 2BFKA 2P1EA 2Y8AA 5B15A 4CHLA 1ZTCA 3I15A 3MD7A 2GMNA 2FHXB 4HKYA 5B3RA 5A0TA 5LCFA 4EYLA 4KEPA 4C09A 3TP9A 2NXAA 3A4YA 4RAMA 4UWOB 5HIPA 5AEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZR9 A;  4F6H A;  2BG6 A;  1MQO A;  2WYL A;  4AWZ A;  4YSB A;  4RM5 A;  3IE0 A;  4UBQ A;  3IE1 A;  5LSC A;  2QDT A;  2Q9U A;  1KO3 A;  3IE2 A;  2YNT B;  4D02 A;  5LE1 A;  5A0V A;  2YNU A;  4JO0 A;  2I7X A;  2OHI A;  3KNR A;  2OHJ A;  2BG8 B;  2Q0J A;  4Z6X A;  1DD6 A;  2M5C A;  3IEK A;  1ZKP A;  1X8H A;  4C1F A;  1KR3 A;  4TZE A;  1BMC A;  2P18 A;  5HIO A;  2AZ4 A;  4J5H A;  2ZO4 A;  2QIN A;  2NYP A;  5HH4 A;  1VME A;  1JJE A;  5LS3 A;  2Y87 A;  2BTN A;  3PY5 A;  3T3N A;  2GFK A;  3F9O A;  3X2Z A;  2XR1 A;  1KO2 A;  2BFZ A;  3RKJ A;  1X8I A;  1JJT A;  4C1D A;  4UAM A;  4ZO3 A;  4HL2 A;  1E5D A;  3VQZ A;  5EV8 A;  5K4M A;  3ZWF A;  2AIO A;  2WYM A;  5K4N A;  4C1H A;  3FAI A;  1YCH A;  4C1C A;  5HIQ A;  4Z60 A;  3IOF A;  1DXK A;  2Y8B A;  4TZB A;  5LCA A;  1VGN A;  1QH5 A;  5AHO A;  1K07 A;  1WRA A;  4UA4 A;  2BC2 A;  5AXR A;  4Z67 A;  1WUO A;  4EY2 A;  4AD9 A;  2BFL A;  4F6Z A;  2WYM C;  1WW1 A;  5EVB A;  5ACX A;  3G1P A;  4EFZ A;  5FQA A;  4DIL A;  2M5D A;  2I7T A;  5LCH A;  3DHA A;  2NZF A;  4Z5Y A;  4GCW A;  4RBS A;  4J5F A;  4H0D A;  5EH9 A;  2Q0I A;  4YSK A;  3JXP A;  1QH3 A;  2FK6 A;  1P9E A;  2BFZ B;  1A8T A;  4LE6 A;  3DHC A;  4NQ2 A;  5HIS A;  4D1W A;  5KIK A;  4EYB A;  4YSL A;  1XM8 A;  2FU7 A;  2BMI A;  5AYA A;  4FR7 A;  3L6N A;  2YCB A;  4GYQ A;  5ACQ A;  5HH6 A;  2QDS A;  5ACP A;  4ZEJ A;  2NZE A;  2Q42 A;  4RAW A;  1JT1 A;  3AF5 A;  4GYU A;  3SPU A;  4AX0 B;  3LVZ A;  2FM6 A;  5ACW A;  5EVK A;  5AXO A;  3S0Z A;  4BZ3 A;  4AX1 B;  3DH8 A;  2YZ3 A;  4XWT A;  2GCU A;  4Z5Z A;  4B87 A;  3PG4 A;  5EHT A;  3T3O A;  4UWS B;  2UYX A;  1DDK A;  3SD9 A;  1L9Y A;  3I11 A;  3KNS A;  3SW3 A;  2VW8 A;  2ZWR A;  2WRS A;  5EWA A;  2YNT A;  4RL0 A;  2FU6 A;  3P2U A;  1A7T A;  4KEQ A;  2P4Z A;  5LLD A;  4UWP B;  5LM6 A;  1YCF A;  3SRX A;  2BG7 A;  4PVT A;  5K0W A;  2DOO A;  3IDZ A;  3RKK A;  4HL1 A;  3X2Y A;  1X8G A;  5LMC A;  2GKL A;  2WHG A;  3X30 A;  4TYT A;  3I13 A;  1M2X A;  5KIL A;  2BIB A;  1SML A;  4AWY B;  3IEL A;  4C1E A;  3H3E A;  4ZO2 A;  4EYF A;  4PVO A;  2OHH A;  4WD6 A;  4Z7R A;  1WUP A;  5EW0 A;  2A7M A;  3ADR A;  5ACR A;  4XUK A;  3SBL A;  1HLK A;  3IOG A;  3SFP A;  3I0V A;  3VPE A;  2R2D A;  5IQK A;  4FSB A;  3QH8 A;  2YNV A;  4O98 A;  4V0H A;  3BC2 A;  2H6A A;  2CBN A;  3BV6 A;  1BC2 A;  1Y44 A;  2I7V A;  4TZ9 A;  2QED A;  4TZF A;  5EVD A;  5A5Z A;  3Q6V A;  1XTO A;  5ACU A;  4EXS A;  4XWW A;  5FQC A;  2ZNB A;  4RL2 A;  4UWR B;  3RPC A;  2FHX A;  2P97 A;  2BG2 A;  2E7Y A;  5ACS A;  5EV6 A;  3ESH A;  2DKF A;  3R2U A;  4NQ5 A;  5K4K A;  3I14 A;  4U4L A;  5DPX A;  3AF6 A;  3PY6 A;  3IEM A;  1VJN A;  4BP0 A;  4D1U A;  4FEK A;  5ACT A;  5HH5 A;  3WXC A;  2FU9 A;  5FQB A;  4DIK A;  1BVT A;  4ZNB A;  3ZQ4 A;  1ZNB A;  4NQ6 A;  3X2X A;  4D1T A;  2BG8 A;  3T9M A;  2HB9 A;  4TYF A;  4C1G A;  4D1V A;  2BR6 A;  2YNV B;  3DHB A;  4P62 A;  2ZZI A;  2GFJ A;  2QJS A;  5B1U A;  3ZNB A;  2FU8 A;  3BK1 A;  1YCG A;  2BGA A;  3AJ3 A;  2YNW A;  5A87 A;  5ACV A;  4EXY A;  3BK2 A;  5AHR A;  3FCZ A;  3KL7 A;  4NQ4 A;  2XF4 A;  2BFK A;  2P1E A;  2Y8A A;  5B15 A;  4CHL A;  1ZTC A;  3I15 A;  3MD7 A;  2GMN A;  2FHX B;  4HKY A;  5B3R A;  5A0T A;  5LCF A;  4EYL A;  4KEP A;  4C09 A;  3TP9 A;  2NXA A;  3A4Y A;  4RAM A;  4UWO B;  5HIP A;  5AEB A; 
#chains in the Genus database with same CATH topology
 3ZR9 A;  4F6H A;  2BG6 A;  1MQO A;  2WYL A;  4AWZ A;  4YSB A;  4RM5 A;  3IE0 A;  4UBQ A;  3IE1 A;  5LSC A;  2QDT A;  2Q9U A;  1KO3 A;  3IE2 A;  2YNT B;  4D02 A;  5LE1 A;  5A0V A;  2YNU A;  4JO0 A;  2I7X A;  2OHI A;  3KNR A;  2OHJ A;  2BG8 B;  2Q0J A;  4Z6X A;  1DD6 A;  2M5C A;  3IEK A;  1ZKP A;  2CFU A;  1X8H A;  4C1F A;  1KR3 A;  4TZE A;  1BMC A;  2P18 A;  5HIO A;  2AZ4 A;  4J5H A;  2ZO4 A;  2QIN A;  2NYP A;  5HH4 A;  1VME A;  2CFZ A;  1JJE A;  5LS3 A;  2Y87 A;  2BTN A;  3PY5 A;  3T3N A;  2GFK A;  3F9O A;  3X2Z A;  2XR1 A;  1KO2 A;  2BFZ A;  3RKJ A;  1X8I A;  1JJT A;  4C1D A;  4UAM A;  4ZO3 A;  4HL2 A;  1E5D A;  3VQZ A;  5EV8 A;  5K4M A;  3ZWF A;  2AIO A;  2WYM A;  5K4N A;  4C1H A;  3FAI A;  1YCH A;  4C1C A;  5HIQ A;  4Z60 A;  3IOF A;  1DXK A;  2Y8B A;  4TZB A;  5LCA A;  1VGN A;  1QH5 A;  5AHO A;  1K07 A;  1WRA A;  4UA4 A;  2BC2 A;  5AXR A;  4Z67 A;  1WUO A;  4NUR A;  4EY2 A;  4AD9 A;  2BFL A;  4F6Z A;  2WYM C;  1WW1 A;  5EVB A;  5ACX A;  3G1P A;  4EFZ A;  5FQA A;  4DIL A;  2M5D A;  2I7T A;  5LCH A;  3DHA A;  2NZF A;  4Z5Y A;  4GCW A;  4RBS A;  4J5F A;  4H0D A;  5EH9 A;  2Q0I A;  4YSK A;  3JXP A;  1QH3 A;  2FK6 A;  1P9E A;  2BFZ B;  1A8T A;  4LE6 A;  3DHC A;  4NQ2 A;  5HIS A;  4D1W A;  5KIK A;  4EYB A;  4YSL A;  1XM8 A;  2FU7 A;  2BMI A;  5AYA A;  4FR7 A;  3L6N A;  2YCB A;  4GYQ A;  5ACQ A;  5HH6 A;  2QDS A;  5ACP A;  4ZEJ A;  2NZE A;  2Q42 A;  4RAW A;  5A23 A;  1JT1 A;  3AF5 A;  4GYU A;  3SPU A;  4AX0 B;  3LVZ A;  2FM6 A;  5ACW A;  5EVK A;  5AXO A;  3S0Z A;  4BZ3 A;  4AX1 B;  4AXH A;  3DH8 A;  2YZ3 A;  4XWT A;  2GCU A;  4Z5Z A;  4B87 A;  3PG4 A;  5EHT A;  3T3O A;  4UWS B;  2UYX A;  1DDK A;  3SD9 A;  1L9Y A;  3I11 A;  3KNS A;  3SW3 A;  2VW8 A;  2ZWR A;  2WRS A;  4PDX A;  5EWA A;  2YNT A;  4RL0 A;  2FU6 A;  3P2U A;  1A7T A;  4KEQ A;  2P4Z A;  5LLD A;  4UWP B;  5LM6 A;  1YCF A;  3SRX A;  2BG7 A;  4PVT A;  5K0W A;  2DOO A;  3IDZ A;  3RKK A;  4HL1 A;  3X2Y A;  1X8G A;  5LMC A;  2GKL A;  2WHG A;  3X30 A;  4TYT A;  3I13 A;  1M2X A;  5KIL A;  2BIB A;  1SML A;  4AWY B;  3IEL A;  4C1E A;  3H3E A;  4ZO2 A;  4EYF A;  4PVO A;  2OHH A;  4WD6 A;  4Z7R A;  1WUP A;  5EW0 A;  2A7M A;  3ADR A;  5ACR A;  4XUK A;  3SBL A;  1HLK A;  3IOG A;  3SFP A;  3I0V A;  3VPE A;  2R2D A;  5IQK A;  4FSB A;  3QH8 A;  2YNV A;  2CG3 A;  4O98 A;  4AV7 A;  4V0H A;  3BC2 A;  2H6A A;  2CBN A;  2YHE A;  3BV6 A;  1BC2 A;  1Y44 A;  2I7V A;  4TZ9 A;  2QED A;  4TZF A;  5EVD A;  5A5Z A;  3Q6V A;  1XTO A;  5ACU A;  4EXS A;  4XWW A;  5FQC A;  2ZNB A;  4RL2 A;  4UWR B;  3RPC A;  2FHX A;  2P97 A;  2BG2 A;  2E7Y A;  5ACS A;  5EV6 A;  3ESH A;  2DKF A;  3R2U A;  4NQ5 A;  5K4K A;  3I14 A;  2CG2 A;  4U4L A;  5DPX A;  3AF6 A;  3PY6 A;  3IEM A;  1VJN A;  4BP0 A;  4D1U A;  4FEK A;  5ACT A;  5HH5 A;  3WXC A;  2FU9 A;  5FQB A;  5AJL A;  4DIK A;  1BVT A;  4ZNB A;  3ZQ4 A;  1ZNB A;  4NQ6 A;  3X2X A;  4D1T A;  2BG8 A;  3T9M A;  2HB9 A;  4TYF A;  4C1G A;  4D1V A;  2BR6 A;  2YNV B;  3DHB A;  4P62 A;  2ZZI A;  2GFJ A;  2QJS A;  5AIJ A;  5B1U A;  3ZNB A;  2FU8 A;  3BK1 A;  1YCG A;  2BGA A;  3AJ3 A;  2YNW A;  5A87 A;  5ACV A;  4EXY A;  3BK2 A;  5AHR A;  3FCZ A;  3KL7 A;  4NQ4 A;  2XF4 A;  2BFK A;  2P1E A;  2Y8A A;  5B15 A;  4CHL A;  1ZTC A;  3I15 A;  3MD7 A;  2GMN A;  2FHX B;  4HKY A;  5B3R A;  5A0T A;  5LCF A;  4EYL A;  4KEP A;  4C09 A;  3TP9 A;  2NXA A;  3A4Y A;  4RAM A;  4UWO B;  5HIP A;  5AEB A; 
#chains in the Genus database with same CATH homology
 3ZR9 A;  4F6H A;  2BG6 A;  1MQO A;  2WYL A;  4AWZ A;  4YSB A;  4RM5 A;  3IE0 A;  4UBQ A;  3IE1 A;  5LSC A;  2QDT A;  2Q9U A;  1KO3 A;  3IE2 A;  2YNT B;  4D02 A;  5LE1 A;  5A0V A;  2YNU A;  4JO0 A;  2I7X A;  2OHI A;  3KNR A;  2OHJ A;  2BG8 B;  2Q0J A;  4Z6X A;  1DD6 A;  2M5C A;  3IEK A;  1ZKP A;  1X8H A;  4C1F A;  1KR3 A;  4TZE A;  1BMC A;  2P18 A;  5HIO A;  2AZ4 A;  4J5H A;  2ZO4 A;  2QIN A;  2NYP A;  5HH4 A;  1VME A;  1JJE A;  5LS3 A;  2Y87 A;  2BTN A;  3PY5 A;  3T3N A;  2GFK A;  3F9O A;  3X2Z A;  2XR1 A;  1KO2 A;  2BFZ A;  3RKJ A;  1X8I A;  1JJT A;  4C1D A;  4UAM A;  4ZO3 A;  4HL2 A;  1E5D A;  3VQZ A;  5EV8 A;  5K4M A;  3ZWF A;  2AIO A;  2WYM A;  5K4N A;  4C1H A;  3FAI A;  1YCH A;  4C1C A;  5HIQ A;  4Z60 A;  3IOF A;  1DXK A;  2Y8B A;  4TZB A;  5LCA A;  1VGN A;  1QH5 A;  5AHO A;  1K07 A;  1WRA A;  4UA4 A;  2BC2 A;  5AXR A;  4Z67 A;  1WUO A;  4EY2 A;  4AD9 A;  2BFL A;  4F6Z A;  2WYM C;  1WW1 A;  5EVB A;  5ACX A;  3G1P A;  4EFZ A;  5FQA A;  4DIL A;  2M5D A;  2I7T A;  5LCH A;  3DHA A;  2NZF A;  4Z5Y A;  4GCW A;  4RBS A;  4J5F A;  4H0D A;  5EH9 A;  2Q0I A;  4YSK A;  3JXP A;  1QH3 A;  2FK6 A;  1P9E A;  2BFZ B;  1A8T A;  4LE6 A;  3DHC A;  4NQ2 A;  5HIS A;  4D1W A;  5KIK A;  4EYB A;  4YSL A;  1XM8 A;  2FU7 A;  2BMI A;  5AYA A;  4FR7 A;  3L6N A;  2YCB A;  4GYQ A;  5ACQ A;  5HH6 A;  2QDS A;  5ACP A;  4ZEJ A;  2NZE A;  2Q42 A;  4RAW A;  1JT1 A;  3AF5 A;  4GYU A;  3SPU A;  4AX0 B;  3LVZ A;  2FM6 A;  5ACW A;  5EVK A;  5AXO A;  3S0Z A;  4BZ3 A;  4AX1 B;  3DH8 A;  2YZ3 A;  4XWT A;  2GCU A;  4Z5Z A;  4B87 A;  3PG4 A;  5EHT A;  3T3O A;  4UWS B;  2UYX A;  1DDK A;  3SD9 A;  1L9Y A;  3I11 A;  3KNS A;  3SW3 A;  2VW8 A;  2ZWR A;  2WRS A;  5EWA A;  2YNT A;  4RL0 A;  2FU6 A;  3P2U A;  1A7T A;  4KEQ A;  2P4Z A;  5LLD A;  4UWP B;  5LM6 A;  1YCF A;  3SRX A;  2BG7 A;  4PVT A;  5K0W A;  2DOO A;  3IDZ A;  3RKK A;  4HL1 A;  3X2Y A;  1X8G A;  5LMC A;  2GKL A;  2WHG A;  3X30 A;  4TYT A;  3I13 A;  1M2X A;  5KIL A;  2BIB A;  1SML A;  4AWY B;  3IEL A;  4C1E A;  3H3E A;  4ZO2 A;  4EYF A;  4PVO A;  2OHH A;  4WD6 A;  4Z7R A;  1WUP A;  5EW0 A;  2A7M A;  3ADR A;  5ACR A;  4XUK A;  3SBL A;  1HLK A;  3IOG A;  3SFP A;  3I0V A;  3VPE A;  2R2D A;  5IQK A;  4FSB A;  3QH8 A;  2YNV A;  4O98 A;  4V0H A;  3BC2 A;  2H6A A;  2CBN A;  3BV6 A;  1BC2 A;  1Y44 A;  2I7V A;  4TZ9 A;  2QED A;  4TZF A;  5EVD A;  5A5Z A;  3Q6V A;  1XTO A;  5ACU A;  4EXS A;  4XWW A;  5FQC A;  2ZNB A;  4RL2 A;  4UWR B;  3RPC A;  2FHX A;  2P97 A;  2BG2 A;  2E7Y A;  5ACS A;  5EV6 A;  3ESH A;  2DKF A;  3R2U A;  4NQ5 A;  5K4K A;  3I14 A;  4U4L A;  5DPX A;  3AF6 A;  3PY6 A;  3IEM A;  1VJN A;  4BP0 A;  4D1U A;  4FEK A;  5ACT A;  5HH5 A;  3WXC A;  2FU9 A;  5FQB A;  4DIK A;  1BVT A;  4ZNB A;  3ZQ4 A;  1ZNB A;  4NQ6 A;  3X2X A;  4D1T A;  2BG8 A;  3T9M A;  2HB9 A;  4TYF A;  4C1G A;  4D1V A;  2BR6 A;  2YNV B;  3DHB A;  4P62 A;  2ZZI A;  2GFJ A;  2QJS A;  5B1U A;  3ZNB A;  2FU8 A;  3BK1 A;  1YCG A;  2BGA A;  3AJ3 A;  2YNW A;  5A87 A;  5ACV A;  4EXY A;  3BK2 A;  5AHR A;  3FCZ A;  3KL7 A;  4NQ4 A;  2XF4 A;  2BFK A;  2P1E A;  2Y8A A;  5B15 A;  4CHL A;  1ZTC A;  3I15 A;  3MD7 A;  2GMN A;  2FHX B;  4HKY A;  5B3R A;  5A0T A;  5LCF A;  4EYL A;  4KEP A;  4C09 A;  3TP9 A;  2NXA A;  3A4Y A;  4RAM A;  4UWO B;  5HIP A;  5AEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...