4LE6A

Crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
300
structure length
257
Chain Sequence
AAPAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFSPIRSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Organophosphorus hydrolase
publication title Structural and Enzymatic Characterization of the Phosphotriesterase OPHC2 from Pseudomonas pseudoalcaligenes.
pubmed doi rcsb
source organism Pseudomonas pseudoalcaligenes
molecule tags Hydrolase
total genus 66
structure length 257
sequence length 300
chains with identical sequence B, C, D, E
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4le6A00
3I11A 4KEQA 2BIBA 4HL2A 5K4MA 4J5HA 2Q0JA 2YNVA 4UBQA 4EYLA 5FQAA 5EV8A 5LCHA 2FU8A 1QH3A 5LE1A 4RBSA 5FQCA 4Z60A 2WRSA 3QH8A 4UWPB 5HIQA 4ZNBA 5ACQA 1XTOA 5EVKA 4BP0A 4RAMA 2WYMC 3SRXA 4Z7RA 1KO2A 1HLKA 3SBLA 2Q9UA 5B1UA 5AHRA 3IOFA 4DIKA 3IDZA 2BFZA 3ZR9A 2QDSA 4TZBA 3IELA 4YSLA 3I13A 2AZ4A 4H0DA 2I7TA 3SFPA 5LCFA 2FHXB 5HH5A 5K0WA 2BG8A 3FAIA 3X2YA 5AEBA 2QDTA 3AF6A 2I7VA 4GYUA 2BFKA 3X2XA 2GFKA 2WHGA 4Z5YA 4ZO2A 4TZEA 4C1GA 3I0VA 5EH9A 4Z67A 2YNTB 4UWSB 4Z5ZA 3DHCA 4GYQA 5HISA 1WW1A 1YCFA 3T9MA 2P1EA 5HIOA 2BR6A 5AHOA 4AX1B 2GKLA 1E5DA 4UAMA 4RM5A 3T3NA 4RL2A 2QINA 5A0TA 2BGAA 4D1VA 1K07A 3BV6A 3WXCA 2GFJA 4FR7A 2QEDA 5KIKA 3IE0A 3L6NA 5ACRA 4D1UA 5EVDA 2YCBA 4NQ2A 1WRAA 4HL1A 3ESHA 4C1FA 2OHHA 3ADRA 5AYAA 2FK6A 3IEMA 3Q6VA 3SD9A 4UA4A 5K4KA 3SW3A 2QJSA 5ACPA 2Y8AA 4C09A 2NZFA 2BG7A 5EVBA 2YNWA 4P62A 4RL0A 1P9EA 4TYFA 4ZO3A 3F9OA 4RAWA 5LS3A 5IQKA 2BFLA 2Y8BA 3BC2A 4NQ4A 1MQOA 2WYLA 2Y87A 2BTNA 4BZ3A 5ACTA 2FM6A 3IOGA 4HKYA 2M5CA 2OHJA 3ZQ4A 4CHLA 4EY2A 5B3RA 1X8GA 1XM8A 4FEKA 4D1WA 1QH5A 1WUPA 2ZNBA 5EHTA 2ZZIA 1X8IA 4D1TA 1WUOA 4XWWA 3PY6A 2FU7A 4EFZA 4C1DA 5HH4A 4Z6XA 3VQZA 4XWTA 4UWRB 3PY5A 2UYXA 4EYBA 5ACXA 4GCWA 3ZNBA 5LCAA 2BC2A 3BK2A 2P18A 3KL7A 4TZ9A 3RPCA 4U4LA 5LM6A 2CBNA 3KNSA 1DDKA 3AF5A 5A0VA 4C1EA 2OHIA 3JXPA 1BC2A 4KEPA 4DILA 2FU9A 5AXRA 1ZNBA 4JO0A 4F6HA 5DPXA 3SPUA 4EYFA 1M2XA 3DHBA 2YNVB 1SMLA 1VJNA 3KNRA 3S0ZA 3IEKA 3VPEA 4F6ZA 3IE1A 2FHXA 2WYMA 5EV6A 1JT1A 3TP9A 5EWAA 1BVTA 2NYPA 3R2UA 2P4ZA 4TYTA 5EW0A 2HB9A 2E7YA 4NQ6A 4AD9A 2XR1A 1L9YA 4TZFA 4WD6A 4EXSA 1ZTCA 1ZKPA 2YZ3A 2H6AA 2BFZB 3X30A 4EXYA 2YNTA 1JJEA 4PVOA 1YCGA 1KR3A 2R2DA 1VGNA 4XUKA 4NQ5A 5ACUA 2XF4A 5HH6A 2A7MA 3A4YA 3T3OA 5ACSA 5A5ZA 4AWYB 3AJ3A 5LMCA 2BG8B 1X8HA 4YSBA 4FSBA 3LVZA 2GMNA 1BMCA 4B87A 3P2UA 5B15A 4C1HA 2FU6A 2Q42A 3PG4A 5FQBA 5KILA 3X2ZA 4J5FA 3FCZA 5ACVA 4V0HA 1A8TA 5LLDA 2BG2A 2VW8A 2BG6A 4C1CA 2YNUA 2ZWRA 5AXOA 1DXKA 5LSCA 2DOOA 2I7XA 4ZEJA 3G1PA 5HIPA 3I14A 4YSKA 4AWZA 1JJTA 1YCHA 4AX0B 3RKKA 3I15A 5ACWA 2M5DA 3IE2A 4O98A 1KO3A 4UWOB 5A87A 3DHAA 2NZEA 1Y44A 3BK1A 3DH8A 3MD7A 1DD6A 1A7TA 4LE6A 2P97A 3H3EA 5K4NA 2Q0IA 3RKJA 1VMEA 2NXAA 2AIOA 4D02A 2BMIA 4PVTA 2GCUA 3ZWFA 2DKFA 2ZO4A
chains in the Genus database with same CATH superfamily
3I11A 4KEQA 2BIBA 4HL2A 5K4MA 4J5HA 2Q0JA 2YNVA 4UBQA 4EYLA 5FQAA 5EV8A 5LCHA 2FU8A 1QH3A 5LE1A 4RBSA 5FQCA 4Z60A 2WRSA 3QH8A 4UWPB 5HIQA 4ZNBA 5ACQA 1XTOA 5EVKA 4BP0A 4RAMA 2WYMC 3SRXA 4Z7RA 1KO2A 1HLKA 3SBLA 2CG3A 2Q9UA 5B1UA 5AHRA 3IOFA 4DIKA 3IDZA 2BFZA 3ZR9A 2QDSA 4TZBA 3IELA 4YSLA 3I13A 2AZ4A 4H0DA 2I7TA 3SFPA 5LCFA 2FHXB 5HH5A 5K0WA 2BG8A 3FAIA 3X2YA 5AEBA 2QDTA 3AF6A 2I7VA 4GYUA 2BFKA 3X2XA 4PDXA 2GFKA 2WHGA 4Z5YA 4ZO2A 4TZEA 5A23A 4C1GA 3I0VA 2YHEA 5EH9A 5AIJA 4Z67A 2YNTB 4UWSB 4NURA 4Z5ZA 3DHCA 4GYQA 5HISA 1WW1A 1YCFA 3T9MA 2P1EA 5HIOA 2BR6A 5AHOA 4AX1B 2GKLA 1E5DA 4UAMA 4RM5A 3T3NA 4RL2A 2QINA 5A0TA 2BGAA 4D1VA 1K07A 3BV6A 3WXCA 2GFJA 4FR7A 2QEDA 5KIKA 3IE0A 3L6NA 5ACRA 4D1UA 2CFUA 5EVDA 2YCBA 4NQ2A 1WRAA 4HL1A 3ESHA 4C1FA 2OHHA 3ADRA 5AYAA 2FK6A 3IEMA 3Q6VA 3SD9A 4UA4A 5K4KA 3SW3A 2QJSA 5ACPA 5AJLA 2Y8AA 4C09A 2NZFA 2BG7A 5EVBA 2YNWA 4P62A 4RL0A 1P9EA 4TYFA 4ZO3A 3F9OA 4RAWA 5LS3A 5IQKA 2BFLA 2Y8BA 3BC2A 4NQ4A 1MQOA 2WYLA 2Y87A 2BTNA 4BZ3A 5ACTA 2FM6A 3IOGA 4HKYA 2M5CA 2OHJA 3ZQ4A 4CHLA 4EY2A 5B3RA 1X8GA 1XM8A 4FEKA 4D1WA 1QH5A 1WUPA 2ZNBA 5EHTA 2ZZIA 1X8IA 4D1TA 1WUOA 4XWWA 3PY6A 2FU7A 4EFZA 4C1DA 5HH4A 4Z6XA 3VQZA 4XWTA 4UWRB 3PY5A 2UYXA 4EYBA 5ACXA 4GCWA 3ZNBA 5LCAA 2BC2A 3BK2A 2P18A 3KL7A 4TZ9A 3RPCA 4U4LA 5LM6A 2CBNA 3KNSA 1DDKA 3AF5A 5A0VA 4C1EA 2OHIA 3JXPA 1BC2A 4KEPA 4DILA 2FU9A 5AXRA 1ZNBA 4JO0A 4F6HA 5DPXA 3SPUA 4EYFA 1M2XA 3DHBA 2YNVB 1SMLA 1VJNA 3KNRA 3S0ZA 3IEKA 3VPEA 4F6ZA 3IE1A 2FHXA 2CFZA 2WYMA 5EV6A 1JT1A 3TP9A 5EWAA 1BVTA 2NYPA 3R2UA 2P4ZA 4TYTA 5EW0A 2HB9A 2E7YA 4NQ6A 4AD9A 2XR1A 1L9YA 4TZFA 2CG2A 4WD6A 4EXSA 1ZTCA 1ZKPA 2YZ3A 2H6AA 2BFZB 3X30A 4EXYA 2YNTA 1JJEA 4PVOA 1YCGA 1KR3A 2R2DA 1VGNA 4XUKA 4NQ5A 5ACUA 2XF4A 5HH6A 2A7MA 3A4YA 3T3OA 5ACSA 5A5ZA 4AXHA 4AWYB 4AV7A 3AJ3A 5LMCA 2BG8B 1X8HA 4YSBA 4FSBA 3LVZA 2GMNA 1BMCA 4B87A 3P2UA 5B15A 4C1HA 2FU6A 2Q42A 3PG4A 5FQBA 5KILA 3X2ZA 4J5FA 3FCZA 5ACVA 4V0HA 1A8TA 5LLDA 2BG2A 2VW8A 2BG6A 4C1CA 2YNUA 2ZWRA 5AXOA 1DXKA 5LSCA 2DOOA 2I7XA 4ZEJA 3G1PA 5HIPA 3I14A 4YSKA 4AWZA 1JJTA 1YCHA 4AX0B 3RKKA 3I15A 5ACWA 2M5DA 3IE2A 4O98A 1KO3A 4UWOB 5A87A 3DHAA 2NZEA 1Y44A 3BK1A 3DH8A 3MD7A 1DD6A 1A7TA 4LE6A 2P97A 3H3EA 5K4NA 2Q0IA 3RKJA 1VMEA 2NXAA 2AIOA 4D02A 2BMIA 4PVTA 2GCUA 3ZWFA 2DKFA 2ZO4A
chains in the Genus database with same CATH topology
3I11A 4KEQA 2BIBA 4HL2A 5K4MA 4J5HA 2Q0JA 2YNVA 4UBQA 4EYLA 5FQAA 5EV8A 5LCHA 2FU8A 1QH3A 5LE1A 4RBSA 5FQCA 4Z60A 2WRSA 3QH8A 4UWPB 5HIQA 4ZNBA 5ACQA 1XTOA 5EVKA 4BP0A 4RAMA 2WYMC 3SRXA 4Z7RA 1KO2A 1HLKA 3SBLA 2Q9UA 5B1UA 5AHRA 3IOFA 4DIKA 3IDZA 2BFZA 3ZR9A 2QDSA 4TZBA 3IELA 4YSLA 3I13A 2AZ4A 4H0DA 2I7TA 3SFPA 5LCFA 2FHXB 5HH5A 5K0WA 2BG8A 3FAIA 3X2YA 5AEBA 2QDTA 3AF6A 2I7VA 4GYUA 2BFKA 3X2XA 2GFKA 2WHGA 4Z5YA 4ZO2A 4TZEA 4C1GA 3I0VA 5EH9A 4Z67A 2YNTB 4UWSB 4Z5ZA 3DHCA 4GYQA 5HISA 1WW1A 1YCFA 3T9MA 2P1EA 5HIOA 2BR6A 5AHOA 4AX1B 2GKLA 1E5DA 4UAMA 4RM5A 3T3NA 4RL2A 2QINA 5A0TA 2BGAA 4D1VA 1K07A 3BV6A 3WXCA 2GFJA 4FR7A 2QEDA 5KIKA 3IE0A 3L6NA 5ACRA 4D1UA 5EVDA 2YCBA 4NQ2A 1WRAA 4HL1A 3ESHA 4C1FA 2OHHA 3ADRA 5AYAA 2FK6A 3IEMA 3Q6VA 3SD9A 4UA4A 5K4KA 3SW3A 2QJSA 5ACPA 2Y8AA 4C09A 2NZFA 2BG7A 5EVBA 2YNWA 4P62A 4RL0A 1P9EA 4TYFA 4ZO3A 3F9OA 4RAWA 5LS3A 5IQKA 2BFLA 2Y8BA 3BC2A 4NQ4A 1MQOA 2WYLA 2Y87A 2BTNA 4BZ3A 5ACTA 2FM6A 3IOGA 4HKYA 2M5CA 2OHJA 3ZQ4A 4CHLA 4EY2A 5B3RA 1X8GA 1XM8A 4FEKA 4D1WA 1QH5A 1WUPA 2ZNBA 5EHTA 2ZZIA 1X8IA 4D1TA 1WUOA 4XWWA 3PY6A 2FU7A 4EFZA 4C1DA 5HH4A 4Z6XA 3VQZA 4XWTA 4UWRB 3PY5A 2UYXA 4EYBA 5ACXA 4GCWA 3ZNBA 5LCAA 2BC2A 3BK2A 2P18A 3KL7A 4TZ9A 3RPCA 4U4LA 5LM6A 2CBNA 3KNSA 1DDKA 3AF5A 5A0VA 4C1EA 2OHIA 3JXPA 1BC2A 4KEPA 4DILA 2FU9A 5AXRA 1ZNBA 4JO0A 4F6HA 5DPXA 3SPUA 4EYFA 1M2XA 3DHBA 2YNVB 1SMLA 1VJNA 3KNRA 3S0ZA 3IEKA 3VPEA 4F6ZA 3IE1A 2FHXA 2WYMA 5EV6A 1JT1A 3TP9A 5EWAA 1BVTA 2NYPA 3R2UA 2P4ZA 4TYTA 5EW0A 2HB9A 2E7YA 4NQ6A 4AD9A 2XR1A 1L9YA 4TZFA 4WD6A 4EXSA 1ZTCA 1ZKPA 2YZ3A 2H6AA 2BFZB 3X30A 4EXYA 2YNTA 1JJEA 4PVOA 1YCGA 1KR3A 2R2DA 1VGNA 4XUKA 4NQ5A 5ACUA 2XF4A 5HH6A 2A7MA 3A4YA 3T3OA 5ACSA 5A5ZA 4AWYB 3AJ3A 5LMCA 2BG8B 1X8HA 4YSBA 4FSBA 3LVZA 2GMNA 1BMCA 4B87A 3P2UA 5B15A 4C1HA 2FU6A 2Q42A 3PG4A 5FQBA 5KILA 3X2ZA 4J5FA 3FCZA 5ACVA 4V0HA 1A8TA 5LLDA 2BG2A 2VW8A 2BG6A 4C1CA 2YNUA 2ZWRA 5AXOA 1DXKA 5LSCA 2DOOA 2I7XA 4ZEJA 3G1PA 5HIPA 3I14A 4YSKA 4AWZA 1JJTA 1YCHA 4AX0B 3RKKA 3I15A 5ACWA 2M5DA 3IE2A 4O98A 1KO3A 4UWOB 5A87A 3DHAA 2NZEA 1Y44A 3BK1A 3DH8A 3MD7A 1DD6A 1A7TA 4LE6A 2P97A 3H3EA 5K4NA 2Q0IA 3RKJA 1VMEA 2NXAA 2AIOA 4D02A 2BMIA 4PVTA 2GCUA 3ZWFA 2DKFA 2ZO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I11 A;  4KEQ A;  2BIB A;  4HL2 A;  5K4M A;  4J5H A;  2Q0J A;  2YNV A;  4UBQ A;  4EYL A;  5FQA A;  5EV8 A;  5LCH A;  2FU8 A;  1QH3 A;  5LE1 A;  4RBS A;  5FQC A;  4Z60 A;  2WRS A;  3QH8 A;  4UWP B;  5HIQ A;  4ZNB A;  5ACQ A;  1XTO A;  5EVK A;  4BP0 A;  4RAM A;  2WYM C;  3SRX A;  4Z7R A;  1KO2 A;  1HLK A;  3SBL A;  2Q9U A;  5B1U A;  5AHR A;  3IOF A;  4DIK A;  3IDZ A;  2BFZ A;  3ZR9 A;  2QDS A;  4TZB A;  3IEL A;  4YSL A;  3I13 A;  2AZ4 A;  4H0D A;  2I7T A;  3SFP A;  5LCF A;  2FHX B;  5HH5 A;  5K0W A;  2BG8 A;  3FAI A;  3X2Y A;  5AEB A;  2QDT A;  3AF6 A;  2I7V A;  4GYU A;  2BFK A;  3X2X A;  2GFK A;  2WHG A;  4Z5Y A;  4ZO2 A;  4TZE A;  4C1G A;  3I0V A;  5EH9 A;  4Z67 A;  2YNT B;  4UWS B;  4Z5Z A;  3DHC A;  4GYQ A;  5HIS A;  1WW1 A;  1YCF A;  3T9M A;  2P1E A;  5HIO A;  2BR6 A;  5AHO A;  4AX1 B;  2GKL A;  1E5D A;  4UAM A;  4RM5 A;  3T3N A;  4RL2 A;  2QIN A;  5A0T A;  2BGA A;  4D1V A;  1K07 A;  3BV6 A;  3WXC A;  2GFJ A;  4FR7 A;  2QED A;  5KIK A;  3IE0 A;  3L6N A;  5ACR A;  4D1U A;  5EVD A;  2YCB A;  4NQ2 A;  1WRA A;  4HL1 A;  3ESH A;  4C1F A;  2OHH A;  3ADR A;  5AYA A;  2FK6 A;  3IEM A;  3Q6V A;  3SD9 A;  4UA4 A;  5K4K A;  3SW3 A;  2QJS A;  5ACP A;  2Y8A A;  4C09 A;  2NZF A;  2BG7 A;  5EVB A;  2YNW A;  4P62 A;  4RL0 A;  1P9E A;  4TYF A;  4ZO3 A;  3F9O A;  4RAW A;  5LS3 A;  5IQK A;  2BFL A;  2Y8B A;  3BC2 A;  4NQ4 A;  1MQO A;  2WYL A;  2Y87 A;  2BTN A;  4BZ3 A;  5ACT A;  2FM6 A;  3IOG A;  4HKY A;  2M5C A;  2OHJ A;  3ZQ4 A;  4CHL A;  4EY2 A;  5B3R A;  1X8G A;  1XM8 A;  4FEK A;  4D1W A;  1QH5 A;  1WUP A;  2ZNB A;  5EHT A;  2ZZI A;  1X8I A;  4D1T A;  1WUO A;  4XWW A;  3PY6 A;  2FU7 A;  4EFZ A;  4C1D A;  5HH4 A;  4Z6X A;  3VQZ A;  4XWT A;  4UWR B;  3PY5 A;  2UYX A;  4EYB A;  5ACX A;  4GCW A;  3ZNB A;  5LCA A;  2BC2 A;  3BK2 A;  2P18 A;  3KL7 A;  4TZ9 A;  3RPC A;  4U4L A;  5LM6 A;  2CBN A;  3KNS A;  1DDK A;  3AF5 A;  5A0V A;  4C1E A;  2OHI A;  3JXP A;  1BC2 A;  4KEP A;  4DIL A;  2FU9 A;  5AXR A;  1ZNB A;  4JO0 A;  4F6H A;  5DPX A;  3SPU A;  4EYF A;  1M2X A;  3DHB A;  2YNV B;  1SML A;  1VJN A;  3KNR A;  3S0Z A;  3IEK A;  3VPE A;  4F6Z A;  3IE1 A;  2FHX A;  2WYM A;  5EV6 A;  1JT1 A;  3TP9 A;  5EWA A;  1BVT A;  2NYP A;  3R2U A;  2P4Z A;  4TYT A;  5EW0 A;  2HB9 A;  2E7Y A;  4NQ6 A;  4AD9 A;  2XR1 A;  1L9Y A;  4TZF A;  4WD6 A;  4EXS A;  1ZTC A;  1ZKP A;  2YZ3 A;  2H6A A;  2BFZ B;  3X30 A;  4EXY A;  2YNT A;  1JJE A;  4PVO A;  1YCG A;  1KR3 A;  2R2D A;  1VGN A;  4XUK A;  4NQ5 A;  5ACU A;  2XF4 A;  5HH6 A;  2A7M A;  3A4Y A;  3T3O A;  5ACS A;  5A5Z A;  4AWY B;  3AJ3 A;  5LMC A;  2BG8 B;  1X8H A;  4YSB A;  4FSB A;  3LVZ A;  2GMN A;  1BMC A;  4B87 A;  3P2U A;  5B15 A;  4C1H A;  2FU6 A;  2Q42 A;  3PG4 A;  5FQB A;  5KIL A;  3X2Z A;  4J5F A;  3FCZ A;  5ACV A;  4V0H A;  1A8T A;  5LLD A;  2BG2 A;  2VW8 A;  2BG6 A;  4C1C A;  2YNU A;  2ZWR A;  5AXO A;  1DXK A;  5LSC A;  2DOO A;  2I7X A;  4ZEJ A;  3G1P A;  5HIP A;  3I14 A;  4YSK A;  4AWZ A;  1JJT A;  1YCH A;  4AX0 B;  3RKK A;  3I15 A;  5ACW A;  2M5D A;  3IE2 A;  4O98 A;  1KO3 A;  4UWO B;  5A87 A;  3DHA A;  2NZE A;  1Y44 A;  3BK1 A;  3DH8 A;  3MD7 A;  1DD6 A;  1A7T A;  4LE6 A;  2P97 A;  3H3E A;  5K4N A;  2Q0I A;  3RKJ A;  1VME A;  2NXA A;  2AIO A;  4D02 A;  2BMI A;  4PVT A;  2GCU A;  3ZWF A;  2DKF A;  2ZO4 A; 
#chains in the Genus database with same CATH topology
 3I11 A;  4KEQ A;  2BIB A;  4HL2 A;  5K4M A;  4J5H A;  2Q0J A;  2YNV A;  4UBQ A;  4EYL A;  5FQA A;  5EV8 A;  5LCH A;  2FU8 A;  1QH3 A;  5LE1 A;  4RBS A;  5FQC A;  4Z60 A;  2WRS A;  3QH8 A;  4UWP B;  5HIQ A;  4ZNB A;  5ACQ A;  1XTO A;  5EVK A;  4BP0 A;  4RAM A;  2WYM C;  3SRX A;  4Z7R A;  1KO2 A;  1HLK A;  3SBL A;  2CG3 A;  2Q9U A;  5B1U A;  5AHR A;  3IOF A;  4DIK A;  3IDZ A;  2BFZ A;  3ZR9 A;  2QDS A;  4TZB A;  3IEL A;  4YSL A;  3I13 A;  2AZ4 A;  4H0D A;  2I7T A;  3SFP A;  5LCF A;  2FHX B;  5HH5 A;  5K0W A;  2BG8 A;  3FAI A;  3X2Y A;  5AEB A;  2QDT A;  3AF6 A;  2I7V A;  4GYU A;  2BFK A;  3X2X A;  4PDX A;  2GFK A;  2WHG A;  4Z5Y A;  4ZO2 A;  4TZE A;  5A23 A;  4C1G A;  3I0V A;  2YHE A;  5EH9 A;  5AIJ A;  4Z67 A;  2YNT B;  4UWS B;  4NUR A;  4Z5Z A;  3DHC A;  4GYQ A;  5HIS A;  1WW1 A;  1YCF A;  3T9M A;  2P1E A;  5HIO A;  2BR6 A;  5AHO A;  4AX1 B;  2GKL A;  1E5D A;  4UAM A;  4RM5 A;  3T3N A;  4RL2 A;  2QIN A;  5A0T A;  2BGA A;  4D1V A;  1K07 A;  3BV6 A;  3WXC A;  2GFJ A;  4FR7 A;  2QED A;  5KIK A;  3IE0 A;  3L6N A;  5ACR A;  4D1U A;  2CFU A;  5EVD A;  2YCB A;  4NQ2 A;  1WRA A;  4HL1 A;  3ESH A;  4C1F A;  2OHH A;  3ADR A;  5AYA A;  2FK6 A;  3IEM A;  3Q6V A;  3SD9 A;  4UA4 A;  5K4K A;  3SW3 A;  2QJS A;  5ACP A;  5AJL A;  2Y8A A;  4C09 A;  2NZF A;  2BG7 A;  5EVB A;  2YNW A;  4P62 A;  4RL0 A;  1P9E A;  4TYF A;  4ZO3 A;  3F9O A;  4RAW A;  5LS3 A;  5IQK A;  2BFL A;  2Y8B A;  3BC2 A;  4NQ4 A;  1MQO A;  2WYL A;  2Y87 A;  2BTN A;  4BZ3 A;  5ACT A;  2FM6 A;  3IOG A;  4HKY A;  2M5C A;  2OHJ A;  3ZQ4 A;  4CHL A;  4EY2 A;  5B3R A;  1X8G A;  1XM8 A;  4FEK A;  4D1W A;  1QH5 A;  1WUP A;  2ZNB A;  5EHT A;  2ZZI A;  1X8I A;  4D1T A;  1WUO A;  4XWW A;  3PY6 A;  2FU7 A;  4EFZ A;  4C1D A;  5HH4 A;  4Z6X A;  3VQZ A;  4XWT A;  4UWR B;  3PY5 A;  2UYX A;  4EYB A;  5ACX A;  4GCW A;  3ZNB A;  5LCA A;  2BC2 A;  3BK2 A;  2P18 A;  3KL7 A;  4TZ9 A;  3RPC A;  4U4L A;  5LM6 A;  2CBN A;  3KNS A;  1DDK A;  3AF5 A;  5A0V A;  4C1E A;  2OHI A;  3JXP A;  1BC2 A;  4KEP A;  4DIL A;  2FU9 A;  5AXR A;  1ZNB A;  4JO0 A;  4F6H A;  5DPX A;  3SPU A;  4EYF A;  1M2X A;  3DHB A;  2YNV B;  1SML A;  1VJN A;  3KNR A;  3S0Z A;  3IEK A;  3VPE A;  4F6Z A;  3IE1 A;  2FHX A;  2CFZ A;  2WYM A;  5EV6 A;  1JT1 A;  3TP9 A;  5EWA A;  1BVT A;  2NYP A;  3R2U A;  2P4Z A;  4TYT A;  5EW0 A;  2HB9 A;  2E7Y A;  4NQ6 A;  4AD9 A;  2XR1 A;  1L9Y A;  4TZF A;  2CG2 A;  4WD6 A;  4EXS A;  1ZTC A;  1ZKP A;  2YZ3 A;  2H6A A;  2BFZ B;  3X30 A;  4EXY A;  2YNT A;  1JJE A;  4PVO A;  1YCG A;  1KR3 A;  2R2D A;  1VGN A;  4XUK A;  4NQ5 A;  5ACU A;  2XF4 A;  5HH6 A;  2A7M A;  3A4Y A;  3T3O A;  5ACS A;  5A5Z A;  4AXH A;  4AWY B;  4AV7 A;  3AJ3 A;  5LMC A;  2BG8 B;  1X8H A;  4YSB A;  4FSB A;  3LVZ A;  2GMN A;  1BMC A;  4B87 A;  3P2U A;  5B15 A;  4C1H A;  2FU6 A;  2Q42 A;  3PG4 A;  5FQB A;  5KIL A;  3X2Z A;  4J5F A;  3FCZ A;  5ACV A;  4V0H A;  1A8T A;  5LLD A;  2BG2 A;  2VW8 A;  2BG6 A;  4C1C A;  2YNU A;  2ZWR A;  5AXO A;  1DXK A;  5LSC A;  2DOO A;  2I7X A;  4ZEJ A;  3G1P A;  5HIP A;  3I14 A;  4YSK A;  4AWZ A;  1JJT A;  1YCH A;  4AX0 B;  3RKK A;  3I15 A;  5ACW A;  2M5D A;  3IE2 A;  4O98 A;  1KO3 A;  4UWO B;  5A87 A;  3DHA A;  2NZE A;  1Y44 A;  3BK1 A;  3DH8 A;  3MD7 A;  1DD6 A;  1A7T A;  4LE6 A;  2P97 A;  3H3E A;  5K4N A;  2Q0I A;  3RKJ A;  1VME A;  2NXA A;  2AIO A;  4D02 A;  2BMI A;  4PVT A;  2GCU A;  3ZWF A;  2DKF A;  2ZO4 A; 
#chains in the Genus database with same CATH homology
 3I11 A;  4KEQ A;  2BIB A;  4HL2 A;  5K4M A;  4J5H A;  2Q0J A;  2YNV A;  4UBQ A;  4EYL A;  5FQA A;  5EV8 A;  5LCH A;  2FU8 A;  1QH3 A;  5LE1 A;  4RBS A;  5FQC A;  4Z60 A;  2WRS A;  3QH8 A;  4UWP B;  5HIQ A;  4ZNB A;  5ACQ A;  1XTO A;  5EVK A;  4BP0 A;  4RAM A;  2WYM C;  3SRX A;  4Z7R A;  1KO2 A;  1HLK A;  3SBL A;  2Q9U A;  5B1U A;  5AHR A;  3IOF A;  4DIK A;  3IDZ A;  2BFZ A;  3ZR9 A;  2QDS A;  4TZB A;  3IEL A;  4YSL A;  3I13 A;  2AZ4 A;  4H0D A;  2I7T A;  3SFP A;  5LCF A;  2FHX B;  5HH5 A;  5K0W A;  2BG8 A;  3FAI A;  3X2Y A;  5AEB A;  2QDT A;  3AF6 A;  2I7V A;  4GYU A;  2BFK A;  3X2X A;  2GFK A;  2WHG A;  4Z5Y A;  4ZO2 A;  4TZE A;  4C1G A;  3I0V A;  5EH9 A;  4Z67 A;  2YNT B;  4UWS B;  4Z5Z A;  3DHC A;  4GYQ A;  5HIS A;  1WW1 A;  1YCF A;  3T9M A;  2P1E A;  5HIO A;  2BR6 A;  5AHO A;  4AX1 B;  2GKL A;  1E5D A;  4UAM A;  4RM5 A;  3T3N A;  4RL2 A;  2QIN A;  5A0T A;  2BGA A;  4D1V A;  1K07 A;  3BV6 A;  3WXC A;  2GFJ A;  4FR7 A;  2QED A;  5KIK A;  3IE0 A;  3L6N A;  5ACR A;  4D1U A;  5EVD A;  2YCB A;  4NQ2 A;  1WRA A;  4HL1 A;  3ESH A;  4C1F A;  2OHH A;  3ADR A;  5AYA A;  2FK6 A;  3IEM A;  3Q6V A;  3SD9 A;  4UA4 A;  5K4K A;  3SW3 A;  2QJS A;  5ACP A;  2Y8A A;  4C09 A;  2NZF A;  2BG7 A;  5EVB A;  2YNW A;  4P62 A;  4RL0 A;  1P9E A;  4TYF A;  4ZO3 A;  3F9O A;  4RAW A;  5LS3 A;  5IQK A;  2BFL A;  2Y8B A;  3BC2 A;  4NQ4 A;  1MQO A;  2WYL A;  2Y87 A;  2BTN A;  4BZ3 A;  5ACT A;  2FM6 A;  3IOG A;  4HKY A;  2M5C A;  2OHJ A;  3ZQ4 A;  4CHL A;  4EY2 A;  5B3R A;  1X8G A;  1XM8 A;  4FEK A;  4D1W A;  1QH5 A;  1WUP A;  2ZNB A;  5EHT A;  2ZZI A;  1X8I A;  4D1T A;  1WUO A;  4XWW A;  3PY6 A;  2FU7 A;  4EFZ A;  4C1D A;  5HH4 A;  4Z6X A;  3VQZ A;  4XWT A;  4UWR B;  3PY5 A;  2UYX A;  4EYB A;  5ACX A;  4GCW A;  3ZNB A;  5LCA A;  2BC2 A;  3BK2 A;  2P18 A;  3KL7 A;  4TZ9 A;  3RPC A;  4U4L A;  5LM6 A;  2CBN A;  3KNS A;  1DDK A;  3AF5 A;  5A0V A;  4C1E A;  2OHI A;  3JXP A;  1BC2 A;  4KEP A;  4DIL A;  2FU9 A;  5AXR A;  1ZNB A;  4JO0 A;  4F6H A;  5DPX A;  3SPU A;  4EYF A;  1M2X A;  3DHB A;  2YNV B;  1SML A;  1VJN A;  3KNR A;  3S0Z A;  3IEK A;  3VPE A;  4F6Z A;  3IE1 A;  2FHX A;  2WYM A;  5EV6 A;  1JT1 A;  3TP9 A;  5EWA A;  1BVT A;  2NYP A;  3R2U A;  2P4Z A;  4TYT A;  5EW0 A;  2HB9 A;  2E7Y A;  4NQ6 A;  4AD9 A;  2XR1 A;  1L9Y A;  4TZF A;  4WD6 A;  4EXS A;  1ZTC A;  1ZKP A;  2YZ3 A;  2H6A A;  2BFZ B;  3X30 A;  4EXY A;  2YNT A;  1JJE A;  4PVO A;  1YCG A;  1KR3 A;  2R2D A;  1VGN A;  4XUK A;  4NQ5 A;  5ACU A;  2XF4 A;  5HH6 A;  2A7M A;  3A4Y A;  3T3O A;  5ACS A;  5A5Z A;  4AWY B;  3AJ3 A;  5LMC A;  2BG8 B;  1X8H A;  4YSB A;  4FSB A;  3LVZ A;  2GMN A;  1BMC A;  4B87 A;  3P2U A;  5B15 A;  4C1H A;  2FU6 A;  2Q42 A;  3PG4 A;  5FQB A;  5KIL A;  3X2Z A;  4J5F A;  3FCZ A;  5ACV A;  4V0H A;  1A8T A;  5LLD A;  2BG2 A;  2VW8 A;  2BG6 A;  4C1C A;  2YNU A;  2ZWR A;  5AXO A;  1DXK A;  5LSC A;  2DOO A;  2I7X A;  4ZEJ A;  3G1P A;  5HIP A;  3I14 A;  4YSK A;  4AWZ A;  1JJT A;  1YCH A;  4AX0 B;  3RKK A;  3I15 A;  5ACW A;  2M5D A;  3IE2 A;  4O98 A;  1KO3 A;  4UWO B;  5A87 A;  3DHA A;  2NZE A;  1Y44 A;  3BK1 A;  3DH8 A;  3MD7 A;  1DD6 A;  1A7T A;  4LE6 A;  2P97 A;  3H3E A;  5K4N A;  2Q0I A;  3RKJ A;  1VME A;  2NXA A;  2AIO A;  4D02 A;  2BMI A;  4PVT A;  2GCU A;  3ZWF A;  2DKF A;  2ZO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...