4LE6A

Crystal structure of the phosphotriesterase ophc2 from pseudomonas pseudoalcaligenes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
300
structure length
257
Chain Sequence
AAPAQQKTQVPGYYRMALGDFEVTALYDGYVDLPASLLKGIDDKDLQSLLARMFVASEKGVQTAVNAYLINTGDNLVLIDTGAAQCFGPTLGVVQTNLKASGYQPEQVDTVLLTHLHPDHACGLVNADGSPAYPNATVEVPQAEGELLPGVSLVASPGHTPGHTSYLFKSGGQSLLVWGDILLNHAVQFAKPEVVFEFDVDSDQARQSRQRILAEAATDKLWVAGAHLPFPGLGHVRKEAQGYAWVPVEFSPIRSDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Organophosphorus hydrolase
publication title Structural and Enzymatic Characterization of the Phosphotriesterase OPHC2 from Pseudomonas pseudoalcaligenes.
pubmed doi rcsb
source organism Pseudomonas pseudoalcaligenes
molecule tags Hydrolase
total genus 66
structure length 257
sequence length 300
chains with identical sequence B, C, D, E
ec nomenclature ec 3.1.8.1: Aryldialkylphosphatase.
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4le6A00
2GKLA 5EW0A 3I0VA 2P4ZA 5ACTA 2YNWA 4U4LA 3T9MA 5AHRA 5K0WA 3FAIA 3IE2A 4P62A 2BGAA 4EXYA 4KEPA 2QDSA 4D1UA 4Z6XA 4YSLA 4GYUA 3DHAA 5AXOA 3BC2A 5DPXA 2ZZIA 1BVTA 1X8HA 3KNSA 3I14A 3JXPA 4Z5YA 3VQZA 1WW1A 4UWOB 5AEBA 3A4YA 3IE0A 5ACPA 3R2UA 1XM8A 3I13A 2M5CA 2I7VA 2P97A 4H0DA 3KNRA 3QH8A 2WRSA 4B87A 1WUPA 2BG8A 1QH5A 4EYLA 1E5DA 5EVKA 3SBLA 4AD9A 4O98A 2E7YA 5ACRA 1JJTA 3IE1A 2OHHA 3T3NA 2NZEA 5EH9A 4PVTA 3KL7A 2YNVB 3I15A 1YCGA 3P2UA 1JT1A 3IOFA 1DXKA 1L9YA 4RL0A 1KO3A 5HH4A 1KO2A 2QEDA 5LCAA 3WXCA 4NQ4A 3PG4A 1YCFA 5LSCA 4TZ9A 5AYAA 5K4KA 2HB9A 4GYQA 4EYBA 1SMLA 1HLKA 2FU7A 1VMEA 3MD7A 3X2YA 2WYLA 4UBQA 2Y87A 2BG8B 2FHXA 2P18A 3SPUA 3ZR9A 5A0VA 3BK1A 3L6NA 3H3EA 4FEKA 4BZ3A 2NYPA 2AZ4A 5LMCA 5LCHA 2NZFA 5EWAA 1X8GA 4JO0A 2GFKA 4NQ5A 5HIOA 2YNUA 4C1CA 3Q6VA 4WD6A 5A0TA 1VGNA 5LE1A 2Q0JA 2UYXA 2I7XA 4J5HA 4RBSA 5A5ZA 4UA4A 5LS3A 3ZWFA 2M5DA 3DH8A 2BFZB 4Z67A 2Y8AA 3IEKA 2WYMC 3IEMA 2BMIA 3RKKA 4XWTA 5B1UA 4C1FA 4D1TA 3G1PA 2BG2A 2BFLA 3LVZA 4RM5A 4KEQA 2GMNA 2BG7A 4UWSB 4AWZA 4RAWA 2QINA 4UWRB 5ACUA 4TZFA 3TP9A 1WUOA 2QDTA 5LM6A 2FK6A 5EV6A 4YSKA 4Z5ZA 3IDZA 4FSBA 5KIKA 5A87A 3AF5A 4HL1A 4Z7RA 1A7TA 3SW3A 1A8TA 4RAMA 5ACVA 1DD6A 2ZWRA 3VPEA 4UWPB 2BIBA 4ZEJA 3ZQ4A 3FCZA 3AF6A 2OHJA 3ZNBA 2I7TA 4HKYA 2ZNBA 3T3OA 2OHIA 3X2ZA 2A7MA 2P1EA 2XR1A 4TZBA 3PY5A 4PVOA 1WRAA 2YCBA 3X30A 5EV8A 4ZNBA 3AJ3A 5KILA 4C09A 2BFKA 5HH6A 2ZO4A 3I11A 2VW8A 4NQ2A 3F9OA 4UAMA 5B3RA 5AXRA 4LE6A 5HISA 1BC2A 1Y44A 2FM6A 5HIQA 3SFPA 2WYMA 1K07A 5FQBA 5LLDA 1JJEA 1DDKA 4HL2A 5K4NA 2Y8BA 2BTNA 2XF4A 4TYFA 5LCFA 2NXAA 1KR3A 3IOGA 3SRXA 2BC2A 4D1VA 4DILA 4CHLA 2BR6A 3BK2A 2AIOA 4C1DA 4D02A 3ADRA 4BP0A 2YNVA 3DHBA 2H6AA 5ACWA 4ZO2A 5EHTA 3ESHA 5FQAA 3X2XA 1MQOA 4C1EA 1QH3A 3SD9A 1X8IA 1M2XA 2FHXB 3RPCA 1ZTCA 1P9EA 5ACSA 5ACQA 4AWYB 1BMCA 1VJNA 4XWWA 4AX0B 5K4MA 5HH5A 4J5FA 2GFJA 2CBNA 4NQ6A 5IQKA 4EXSA 4RL2A 1YCHA 4V0HA 4FR7A 2GCUA 2YNTA 2R2DA 3BV6A 4F6HA 4ZO3A 1ZKPA 3RKJA 2WHGA 5AHOA 4D1WA 2FU8A 5B15A 4XUKA 5EVDA 2Q0IA 4TZEA 2Q9UA 2YZ3A 5FQCA 4EFZA 4C1HA 2BG6A 2Q42A 2FU6A 3IELA 4DIKA 2BFZA 5EVBA 4GCWA 2FU9A 1ZNBA 2DOOA 3PY6A 4YSBA 4EY2A 4EYFA 2DKFA 4C1GA 3DHCA 5ACXA 2QJSA 2YNTB 5HIPA 4TYTA 4F6ZA 1XTOA 4Z60A 4AX1B 3S0ZA
chains in the Genus database with same CATH superfamily
2GKLA 5EW0A 3I0VA 2P4ZA 5ACTA 2YNWA 4U4LA 3T9MA 5AHRA 5K0WA 3FAIA 3IE2A 4P62A 2BGAA 4EXYA 4KEPA 4NURA 2QDSA 4D1UA 4Z6XA 4YSLA 4GYUA 4PDXA 3DHAA 5AXOA 3BC2A 5DPXA 2ZZIA 1BVTA 1X8HA 3KNSA 3I14A 3JXPA 4Z5YA 3VQZA 2YHEA 1WW1A 4UWOB 5AEBA 3A4YA 3IE0A 5ACPA 3R2UA 1XM8A 3I13A 2M5CA 2I7VA 2P97A 4H0DA 2CG2A 3KNRA 3QH8A 2WRSA 4B87A 1WUPA 2BG8A 1QH5A 4EYLA 1E5DA 5EVKA 3SBLA 4AD9A 4O98A 2E7YA 5ACRA 1JJTA 3IE1A 2OHHA 3T3NA 2NZEA 5EH9A 4PVTA 3KL7A 2YNVB 3I15A 4AXHA 1YCGA 3P2UA 1JT1A 3IOFA 1DXKA 1L9YA 4RL0A 1KO3A 5HH4A 1KO2A 2QEDA 5LCAA 3WXCA 4NQ4A 3PG4A 1YCFA 5LSCA 4TZ9A 5AYAA 5K4KA 2HB9A 4GYQA 4EYBA 1SMLA 1HLKA 2FU7A 1VMEA 3MD7A 3X2YA 2WYLA 4UBQA 2Y87A 2BG8B 2FHXA 2P18A 3SPUA 3ZR9A 5A0VA 3BK1A 3L6NA 3H3EA 4FEKA 4BZ3A 2NYPA 2AZ4A 5LMCA 5LCHA 2NZFA 5EWAA 1X8GA 4JO0A 2GFKA 4NQ5A 5HIOA 2YNUA 4C1CA 3Q6VA 4WD6A 5A0TA 1VGNA 5LE1A 2Q0JA 2UYXA 2I7XA 4J5HA 4RBSA 5A5ZA 4UA4A 5LS3A 3ZWFA 2M5DA 3DH8A 2BFZB 4Z67A 2Y8AA 3IEKA 2WYMC 3IEMA 2BMIA 3RKKA 4XWTA 5B1UA 4C1FA 4D1TA 3G1PA 5AIJA 2BG2A 2BFLA 3LVZA 4RM5A 4KEQA 2CFZA 2GMNA 2BG7A 4UWSB 4AWZA 4RAWA 2QINA 4UWRB 5ACUA 4TZFA 3TP9A 1WUOA 2QDTA 5LM6A 2FK6A 5EV6A 4YSKA 4Z5ZA 3IDZA 4FSBA 5KIKA 5A87A 3AF5A 4HL1A 4Z7RA 1A7TA 3SW3A 1A8TA 4RAMA 5ACVA 1DD6A 2ZWRA 3VPEA 4UWPB 2BIBA 4ZEJA 3ZQ4A 3FCZA 3AF6A 2OHJA 3ZNBA 2I7TA 4HKYA 2ZNBA 3T3OA 2OHIA 3X2ZA 2A7MA 2P1EA 2XR1A 4TZBA 3PY5A 4PVOA 1WRAA 2YCBA 3X30A 5EV8A 4ZNBA 3AJ3A 5KILA 4C09A 2BFKA 5HH6A 2ZO4A 3I11A 2VW8A 4NQ2A 3F9OA 4UAMA 5B3RA 5AXRA 4LE6A 5HISA 1BC2A 2CFUA 1Y44A 2FM6A 5HIQA 3SFPA 2WYMA 1K07A 5FQBA 5LLDA 1JJEA 1DDKA 4HL2A 5K4NA 2Y8BA 2BTNA 2XF4A 4TYFA 5LCFA 2NXAA 4AV7A 1KR3A 3IOGA 3SRXA 2BC2A 4D1VA 4DILA 4CHLA 2BR6A 3BK2A 2AIOA 4C1DA 4D02A 3ADRA 4BP0A 2YNVA 3DHBA 2H6AA 5ACWA 4ZO2A 5EHTA 3ESHA 5FQAA 3X2XA 1MQOA 4C1EA 5AJLA 1QH3A 3SD9A 1X8IA 1M2XA 2FHXB 3RPCA 1ZTCA 1P9EA 5ACSA 5ACQA 4AWYB 1BMCA 1VJNA 4XWWA 4AX0B 5K4MA 5HH5A 4J5FA 2GFJA 2CBNA 4NQ6A 5IQKA 4EXSA 4RL2A 1YCHA 4V0HA 4FR7A 2GCUA 2YNTA 2R2DA 3BV6A 4F6HA 4ZO3A 1ZKPA 3RKJA 2WHGA 5AHOA 4D1WA 2FU8A 5B15A 4XUKA 5EVDA 2Q0IA 4TZEA 2Q9UA 2YZ3A 5FQCA 4EFZA 4C1HA 2BG6A 2Q42A 2FU6A 3IELA 4DIKA 2BFZA 5EVBA 4GCWA 2FU9A 1ZNBA 2DOOA 5A23A 3PY6A 4YSBA 2CG3A 4EY2A 4EYFA 2DKFA 4C1GA 3DHCA 5ACXA 2QJSA 2YNTB 5HIPA 4TYTA 4F6ZA 1XTOA 4Z60A 4AX1B 3S0ZA
chains in the Genus database with same CATH topology
2GKLA 5EW0A 3I0VA 2P4ZA 5ACTA 2YNWA 4U4LA 3T9MA 5AHRA 5K0WA 3FAIA 3IE2A 4P62A 2BGAA 4EXYA 4KEPA 2QDSA 4D1UA 4Z6XA 4YSLA 4GYUA 3DHAA 5AXOA 3BC2A 5DPXA 2ZZIA 1BVTA 1X8HA 3KNSA 3I14A 3JXPA 4Z5YA 3VQZA 1WW1A 4UWOB 5AEBA 3A4YA 3IE0A 5ACPA 3R2UA 1XM8A 3I13A 2M5CA 2I7VA 2P97A 4H0DA 3KNRA 3QH8A 2WRSA 4B87A 1WUPA 2BG8A 1QH5A 4EYLA 1E5DA 5EVKA 3SBLA 4AD9A 4O98A 2E7YA 5ACRA 1JJTA 3IE1A 2OHHA 3T3NA 2NZEA 5EH9A 4PVTA 3KL7A 2YNVB 3I15A 1YCGA 3P2UA 1JT1A 3IOFA 1DXKA 1L9YA 4RL0A 1KO3A 5HH4A 1KO2A 2QEDA 5LCAA 3WXCA 4NQ4A 3PG4A 1YCFA 5LSCA 4TZ9A 5AYAA 5K4KA 2HB9A 4GYQA 4EYBA 1SMLA 1HLKA 2FU7A 1VMEA 3MD7A 3X2YA 2WYLA 4UBQA 2Y87A 2BG8B 2FHXA 2P18A 3SPUA 3ZR9A 5A0VA 3BK1A 3L6NA 3H3EA 4FEKA 4BZ3A 2NYPA 2AZ4A 5LMCA 5LCHA 2NZFA 5EWAA 1X8GA 4JO0A 2GFKA 4NQ5A 5HIOA 2YNUA 4C1CA 3Q6VA 4WD6A 5A0TA 1VGNA 5LE1A 2Q0JA 2UYXA 2I7XA 4J5HA 4RBSA 5A5ZA 4UA4A 5LS3A 3ZWFA 2M5DA 3DH8A 2BFZB 4Z67A 2Y8AA 3IEKA 2WYMC 3IEMA 2BMIA 3RKKA 4XWTA 5B1UA 4C1FA 4D1TA 3G1PA 2BG2A 2BFLA 3LVZA 4RM5A 4KEQA 2GMNA 2BG7A 4UWSB 4AWZA 4RAWA 2QINA 4UWRB 5ACUA 4TZFA 3TP9A 1WUOA 2QDTA 5LM6A 2FK6A 5EV6A 4YSKA 4Z5ZA 3IDZA 4FSBA 5KIKA 5A87A 3AF5A 4HL1A 4Z7RA 1A7TA 3SW3A 1A8TA 4RAMA 5ACVA 1DD6A 2ZWRA 3VPEA 4UWPB 2BIBA 4ZEJA 3ZQ4A 3FCZA 3AF6A 2OHJA 3ZNBA 2I7TA 4HKYA 2ZNBA 3T3OA 2OHIA 3X2ZA 2A7MA 2P1EA 2XR1A 4TZBA 3PY5A 4PVOA 1WRAA 2YCBA 3X30A 5EV8A 4ZNBA 3AJ3A 5KILA 4C09A 2BFKA 5HH6A 2ZO4A 3I11A 2VW8A 4NQ2A 3F9OA 4UAMA 5B3RA 5AXRA 4LE6A 5HISA 1BC2A 1Y44A 2FM6A 5HIQA 3SFPA 2WYMA 1K07A 5FQBA 5LLDA 1JJEA 1DDKA 4HL2A 5K4NA 2Y8BA 2BTNA 2XF4A 4TYFA 5LCFA 2NXAA 1KR3A 3IOGA 3SRXA 2BC2A 4D1VA 4DILA 4CHLA 2BR6A 3BK2A 2AIOA 4C1DA 4D02A 3ADRA 4BP0A 2YNVA 3DHBA 2H6AA 5ACWA 4ZO2A 5EHTA 3ESHA 5FQAA 3X2XA 1MQOA 4C1EA 1QH3A 3SD9A 1X8IA 1M2XA 2FHXB 3RPCA 1ZTCA 1P9EA 5ACSA 5ACQA 4AWYB 1BMCA 1VJNA 4XWWA 4AX0B 5K4MA 5HH5A 4J5FA 2GFJA 2CBNA 4NQ6A 5IQKA 4EXSA 4RL2A 1YCHA 4V0HA 4FR7A 2GCUA 2YNTA 2R2DA 3BV6A 4F6HA 4ZO3A 1ZKPA 3RKJA 2WHGA 5AHOA 4D1WA 2FU8A 5B15A 4XUKA 5EVDA 2Q0IA 4TZEA 2Q9UA 2YZ3A 5FQCA 4EFZA 4C1HA 2BG6A 2Q42A 2FU6A 3IELA 4DIKA 2BFZA 5EVBA 4GCWA 2FU9A 1ZNBA 2DOOA 3PY6A 4YSBA 4EY2A 4EYFA 2DKFA 4C1GA 3DHCA 5ACXA 2QJSA 2YNTB 5HIPA 4TYTA 4F6ZA 1XTOA 4Z60A 4AX1B 3S0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GKL A;  5EW0 A;  3I0V A;  2P4Z A;  5ACT A;  2YNW A;  4U4L A;  3T9M A;  5AHR A;  5K0W A;  3FAI A;  3IE2 A;  4P62 A;  2BGA A;  4EXY A;  4KEP A;  2QDS A;  4D1U A;  4Z6X A;  4YSL A;  4GYU A;  3DHA A;  5AXO A;  3BC2 A;  5DPX A;  2ZZI A;  1BVT A;  1X8H A;  3KNS A;  3I14 A;  3JXP A;  4Z5Y A;  3VQZ A;  1WW1 A;  4UWO B;  5AEB A;  3A4Y A;  3IE0 A;  5ACP A;  3R2U A;  1XM8 A;  3I13 A;  2M5C A;  2I7V A;  2P97 A;  4H0D A;  3KNR A;  3QH8 A;  2WRS A;  4B87 A;  1WUP A;  2BG8 A;  1QH5 A;  4EYL A;  1E5D A;  5EVK A;  3SBL A;  4AD9 A;  4O98 A;  2E7Y A;  5ACR A;  1JJT A;  3IE1 A;  2OHH A;  3T3N A;  2NZE A;  5EH9 A;  4PVT A;  3KL7 A;  2YNV B;  3I15 A;  1YCG A;  3P2U A;  1JT1 A;  3IOF A;  1DXK A;  1L9Y A;  4RL0 A;  1KO3 A;  5HH4 A;  1KO2 A;  2QED A;  5LCA A;  3WXC A;  4NQ4 A;  3PG4 A;  1YCF A;  5LSC A;  4TZ9 A;  5AYA A;  5K4K A;  2HB9 A;  4GYQ A;  4EYB A;  1SML A;  1HLK A;  2FU7 A;  1VME A;  3MD7 A;  3X2Y A;  2WYL A;  4UBQ A;  2Y87 A;  2BG8 B;  2FHX A;  2P18 A;  3SPU A;  3ZR9 A;  5A0V A;  3BK1 A;  3L6N A;  3H3E A;  4FEK A;  4BZ3 A;  2NYP A;  2AZ4 A;  5LMC A;  5LCH A;  2NZF A;  5EWA A;  1X8G A;  4JO0 A;  2GFK A;  4NQ5 A;  5HIO A;  2YNU A;  4C1C A;  3Q6V A;  4WD6 A;  5A0T A;  1VGN A;  5LE1 A;  2Q0J A;  2UYX A;  2I7X A;  4J5H A;  4RBS A;  5A5Z A;  4UA4 A;  5LS3 A;  3ZWF A;  2M5D A;  3DH8 A;  2BFZ B;  4Z67 A;  2Y8A A;  3IEK A;  2WYM C;  3IEM A;  2BMI A;  3RKK A;  4XWT A;  5B1U A;  4C1F A;  4D1T A;  3G1P A;  2BG2 A;  2BFL A;  3LVZ A;  4RM5 A;  4KEQ A;  2GMN A;  2BG7 A;  4UWS B;  4AWZ A;  4RAW A;  2QIN A;  4UWR B;  5ACU A;  4TZF A;  3TP9 A;  1WUO A;  2QDT A;  5LM6 A;  2FK6 A;  5EV6 A;  4YSK A;  4Z5Z A;  3IDZ A;  4FSB A;  5KIK A;  5A87 A;  3AF5 A;  4HL1 A;  4Z7R A;  1A7T A;  3SW3 A;  1A8T A;  4RAM A;  5ACV A;  1DD6 A;  2ZWR A;  3VPE A;  4UWP B;  2BIB A;  4ZEJ A;  3ZQ4 A;  3FCZ A;  3AF6 A;  2OHJ A;  3ZNB A;  2I7T A;  4HKY A;  2ZNB A;  3T3O A;  2OHI A;  3X2Z A;  2A7M A;  2P1E A;  2XR1 A;  4TZB A;  3PY5 A;  4PVO A;  1WRA A;  2YCB A;  3X30 A;  5EV8 A;  4ZNB A;  3AJ3 A;  5KIL A;  4C09 A;  2BFK A;  5HH6 A;  2ZO4 A;  3I11 A;  2VW8 A;  4NQ2 A;  3F9O A;  4UAM A;  5B3R A;  5AXR A;  4LE6 A;  5HIS A;  1BC2 A;  1Y44 A;  2FM6 A;  5HIQ A;  3SFP A;  2WYM A;  1K07 A;  5FQB A;  5LLD A;  1JJE A;  1DDK A;  4HL2 A;  5K4N A;  2Y8B A;  2BTN A;  2XF4 A;  4TYF A;  5LCF A;  2NXA A;  1KR3 A;  3IOG A;  3SRX A;  2BC2 A;  4D1V A;  4DIL A;  4CHL A;  2BR6 A;  3BK2 A;  2AIO A;  4C1D A;  4D02 A;  3ADR A;  4BP0 A;  2YNV A;  3DHB A;  2H6A A;  5ACW A;  4ZO2 A;  5EHT A;  3ESH A;  5FQA A;  3X2X A;  1MQO A;  4C1E A;  1QH3 A;  3SD9 A;  1X8I A;  1M2X A;  2FHX B;  3RPC A;  1ZTC A;  1P9E A;  5ACS A;  5ACQ A;  4AWY B;  1BMC A;  1VJN A;  4XWW A;  4AX0 B;  5K4M A;  5HH5 A;  4J5F A;  2GFJ A;  2CBN A;  4NQ6 A;  5IQK A;  4EXS A;  4RL2 A;  1YCH A;  4V0H A;  4FR7 A;  2GCU A;  2YNT A;  2R2D A;  3BV6 A;  4F6H A;  4ZO3 A;  1ZKP A;  3RKJ A;  2WHG A;  5AHO A;  4D1W A;  2FU8 A;  5B15 A;  4XUK A;  5EVD A;  2Q0I A;  4TZE A;  2Q9U A;  2YZ3 A;  5FQC A;  4EFZ A;  4C1H A;  2BG6 A;  2Q42 A;  2FU6 A;  3IEL A;  4DIK A;  2BFZ A;  5EVB A;  4GCW A;  2FU9 A;  1ZNB A;  2DOO A;  3PY6 A;  4YSB A;  4EY2 A;  4EYF A;  2DKF A;  4C1G A;  3DHC A;  5ACX A;  2QJS A;  2YNT B;  5HIP A;  4TYT A;  4F6Z A;  1XTO A;  4Z60 A;  4AX1 B;  3S0Z A; 
#chains in the Genus database with same CATH topology
 2GKL A;  5EW0 A;  3I0V A;  2P4Z A;  5ACT A;  2YNW A;  4U4L A;  3T9M A;  5AHR A;  5K0W A;  3FAI A;  3IE2 A;  4P62 A;  2BGA A;  4EXY A;  4KEP A;  4NUR A;  2QDS A;  4D1U A;  4Z6X A;  4YSL A;  4GYU A;  4PDX A;  3DHA A;  5AXO A;  3BC2 A;  5DPX A;  2ZZI A;  1BVT A;  1X8H A;  3KNS A;  3I14 A;  3JXP A;  4Z5Y A;  3VQZ A;  2YHE A;  1WW1 A;  4UWO B;  5AEB A;  3A4Y A;  3IE0 A;  5ACP A;  3R2U A;  1XM8 A;  3I13 A;  2M5C A;  2I7V A;  2P97 A;  4H0D A;  2CG2 A;  3KNR A;  3QH8 A;  2WRS A;  4B87 A;  1WUP A;  2BG8 A;  1QH5 A;  4EYL A;  1E5D A;  5EVK A;  3SBL A;  4AD9 A;  4O98 A;  2E7Y A;  5ACR A;  1JJT A;  3IE1 A;  2OHH A;  3T3N A;  2NZE A;  5EH9 A;  4PVT A;  3KL7 A;  2YNV B;  3I15 A;  4AXH A;  1YCG A;  3P2U A;  1JT1 A;  3IOF A;  1DXK A;  1L9Y A;  4RL0 A;  1KO3 A;  5HH4 A;  1KO2 A;  2QED A;  5LCA A;  3WXC A;  4NQ4 A;  3PG4 A;  1YCF A;  5LSC A;  4TZ9 A;  5AYA A;  5K4K A;  2HB9 A;  4GYQ A;  4EYB A;  1SML A;  1HLK A;  2FU7 A;  1VME A;  3MD7 A;  3X2Y A;  2WYL A;  4UBQ A;  2Y87 A;  2BG8 B;  2FHX A;  2P18 A;  3SPU A;  3ZR9 A;  5A0V A;  3BK1 A;  3L6N A;  3H3E A;  4FEK A;  4BZ3 A;  2NYP A;  2AZ4 A;  5LMC A;  5LCH A;  2NZF A;  5EWA A;  1X8G A;  4JO0 A;  2GFK A;  4NQ5 A;  5HIO A;  2YNU A;  4C1C A;  3Q6V A;  4WD6 A;  5A0T A;  1VGN A;  5LE1 A;  2Q0J A;  2UYX A;  2I7X A;  4J5H A;  4RBS A;  5A5Z A;  4UA4 A;  5LS3 A;  3ZWF A;  2M5D A;  3DH8 A;  2BFZ B;  4Z67 A;  2Y8A A;  3IEK A;  2WYM C;  3IEM A;  2BMI A;  3RKK A;  4XWT A;  5B1U A;  4C1F A;  4D1T A;  3G1P A;  5AIJ A;  2BG2 A;  2BFL A;  3LVZ A;  4RM5 A;  4KEQ A;  2CFZ A;  2GMN A;  2BG7 A;  4UWS B;  4AWZ A;  4RAW A;  2QIN A;  4UWR B;  5ACU A;  4TZF A;  3TP9 A;  1WUO A;  2QDT A;  5LM6 A;  2FK6 A;  5EV6 A;  4YSK A;  4Z5Z A;  3IDZ A;  4FSB A;  5KIK A;  5A87 A;  3AF5 A;  4HL1 A;  4Z7R A;  1A7T A;  3SW3 A;  1A8T A;  4RAM A;  5ACV A;  1DD6 A;  2ZWR A;  3VPE A;  4UWP B;  2BIB A;  4ZEJ A;  3ZQ4 A;  3FCZ A;  3AF6 A;  2OHJ A;  3ZNB A;  2I7T A;  4HKY A;  2ZNB A;  3T3O A;  2OHI A;  3X2Z A;  2A7M A;  2P1E A;  2XR1 A;  4TZB A;  3PY5 A;  4PVO A;  1WRA A;  2YCB A;  3X30 A;  5EV8 A;  4ZNB A;  3AJ3 A;  5KIL A;  4C09 A;  2BFK A;  5HH6 A;  2ZO4 A;  3I11 A;  2VW8 A;  4NQ2 A;  3F9O A;  4UAM A;  5B3R A;  5AXR A;  4LE6 A;  5HIS A;  1BC2 A;  2CFU A;  1Y44 A;  2FM6 A;  5HIQ A;  3SFP A;  2WYM A;  1K07 A;  5FQB A;  5LLD A;  1JJE A;  1DDK A;  4HL2 A;  5K4N A;  2Y8B A;  2BTN A;  2XF4 A;  4TYF A;  5LCF A;  2NXA A;  4AV7 A;  1KR3 A;  3IOG A;  3SRX A;  2BC2 A;  4D1V A;  4DIL A;  4CHL A;  2BR6 A;  3BK2 A;  2AIO A;  4C1D A;  4D02 A;  3ADR A;  4BP0 A;  2YNV A;  3DHB A;  2H6A A;  5ACW A;  4ZO2 A;  5EHT A;  3ESH A;  5FQA A;  3X2X A;  1MQO A;  4C1E A;  5AJL A;  1QH3 A;  3SD9 A;  1X8I A;  1M2X A;  2FHX B;  3RPC A;  1ZTC A;  1P9E A;  5ACS A;  5ACQ A;  4AWY B;  1BMC A;  1VJN A;  4XWW A;  4AX0 B;  5K4M A;  5HH5 A;  4J5F A;  2GFJ A;  2CBN A;  4NQ6 A;  5IQK A;  4EXS A;  4RL2 A;  1YCH A;  4V0H A;  4FR7 A;  2GCU A;  2YNT A;  2R2D A;  3BV6 A;  4F6H A;  4ZO3 A;  1ZKP A;  3RKJ A;  2WHG A;  5AHO A;  4D1W A;  2FU8 A;  5B15 A;  4XUK A;  5EVD A;  2Q0I A;  4TZE A;  2Q9U A;  2YZ3 A;  5FQC A;  4EFZ A;  4C1H A;  2BG6 A;  2Q42 A;  2FU6 A;  3IEL A;  4DIK A;  2BFZ A;  5EVB A;  4GCW A;  2FU9 A;  1ZNB A;  2DOO A;  5A23 A;  3PY6 A;  4YSB A;  2CG3 A;  4EY2 A;  4EYF A;  2DKF A;  4C1G A;  3DHC A;  5ACX A;  2QJS A;  2YNT B;  5HIP A;  4TYT A;  4F6Z A;  1XTO A;  4Z60 A;  4AX1 B;  3S0Z A; 
#chains in the Genus database with same CATH homology
 2GKL A;  5EW0 A;  3I0V A;  2P4Z A;  5ACT A;  2YNW A;  4U4L A;  3T9M A;  5AHR A;  5K0W A;  3FAI A;  3IE2 A;  4P62 A;  2BGA A;  4EXY A;  4KEP A;  2QDS A;  4D1U A;  4Z6X A;  4YSL A;  4GYU A;  3DHA A;  5AXO A;  3BC2 A;  5DPX A;  2ZZI A;  1BVT A;  1X8H A;  3KNS A;  3I14 A;  3JXP A;  4Z5Y A;  3VQZ A;  1WW1 A;  4UWO B;  5AEB A;  3A4Y A;  3IE0 A;  5ACP A;  3R2U A;  1XM8 A;  3I13 A;  2M5C A;  2I7V A;  2P97 A;  4H0D A;  3KNR A;  3QH8 A;  2WRS A;  4B87 A;  1WUP A;  2BG8 A;  1QH5 A;  4EYL A;  1E5D A;  5EVK A;  3SBL A;  4AD9 A;  4O98 A;  2E7Y A;  5ACR A;  1JJT A;  3IE1 A;  2OHH A;  3T3N A;  2NZE A;  5EH9 A;  4PVT A;  3KL7 A;  2YNV B;  3I15 A;  1YCG A;  3P2U A;  1JT1 A;  3IOF A;  1DXK A;  1L9Y A;  4RL0 A;  1KO3 A;  5HH4 A;  1KO2 A;  2QED A;  5LCA A;  3WXC A;  4NQ4 A;  3PG4 A;  1YCF A;  5LSC A;  4TZ9 A;  5AYA A;  5K4K A;  2HB9 A;  4GYQ A;  4EYB A;  1SML A;  1HLK A;  2FU7 A;  1VME A;  3MD7 A;  3X2Y A;  2WYL A;  4UBQ A;  2Y87 A;  2BG8 B;  2FHX A;  2P18 A;  3SPU A;  3ZR9 A;  5A0V A;  3BK1 A;  3L6N A;  3H3E A;  4FEK A;  4BZ3 A;  2NYP A;  2AZ4 A;  5LMC A;  5LCH A;  2NZF A;  5EWA A;  1X8G A;  4JO0 A;  2GFK A;  4NQ5 A;  5HIO A;  2YNU A;  4C1C A;  3Q6V A;  4WD6 A;  5A0T A;  1VGN A;  5LE1 A;  2Q0J A;  2UYX A;  2I7X A;  4J5H A;  4RBS A;  5A5Z A;  4UA4 A;  5LS3 A;  3ZWF A;  2M5D A;  3DH8 A;  2BFZ B;  4Z67 A;  2Y8A A;  3IEK A;  2WYM C;  3IEM A;  2BMI A;  3RKK A;  4XWT A;  5B1U A;  4C1F A;  4D1T A;  3G1P A;  2BG2 A;  2BFL A;  3LVZ A;  4RM5 A;  4KEQ A;  2GMN A;  2BG7 A;  4UWS B;  4AWZ A;  4RAW A;  2QIN A;  4UWR B;  5ACU A;  4TZF A;  3TP9 A;  1WUO A;  2QDT A;  5LM6 A;  2FK6 A;  5EV6 A;  4YSK A;  4Z5Z A;  3IDZ A;  4FSB A;  5KIK A;  5A87 A;  3AF5 A;  4HL1 A;  4Z7R A;  1A7T A;  3SW3 A;  1A8T A;  4RAM A;  5ACV A;  1DD6 A;  2ZWR A;  3VPE A;  4UWP B;  2BIB A;  4ZEJ A;  3ZQ4 A;  3FCZ A;  3AF6 A;  2OHJ A;  3ZNB A;  2I7T A;  4HKY A;  2ZNB A;  3T3O A;  2OHI A;  3X2Z A;  2A7M A;  2P1E A;  2XR1 A;  4TZB A;  3PY5 A;  4PVO A;  1WRA A;  2YCB A;  3X30 A;  5EV8 A;  4ZNB A;  3AJ3 A;  5KIL A;  4C09 A;  2BFK A;  5HH6 A;  2ZO4 A;  3I11 A;  2VW8 A;  4NQ2 A;  3F9O A;  4UAM A;  5B3R A;  5AXR A;  4LE6 A;  5HIS A;  1BC2 A;  1Y44 A;  2FM6 A;  5HIQ A;  3SFP A;  2WYM A;  1K07 A;  5FQB A;  5LLD A;  1JJE A;  1DDK A;  4HL2 A;  5K4N A;  2Y8B A;  2BTN A;  2XF4 A;  4TYF A;  5LCF A;  2NXA A;  1KR3 A;  3IOG A;  3SRX A;  2BC2 A;  4D1V A;  4DIL A;  4CHL A;  2BR6 A;  3BK2 A;  2AIO A;  4C1D A;  4D02 A;  3ADR A;  4BP0 A;  2YNV A;  3DHB A;  2H6A A;  5ACW A;  4ZO2 A;  5EHT A;  3ESH A;  5FQA A;  3X2X A;  1MQO A;  4C1E A;  1QH3 A;  3SD9 A;  1X8I A;  1M2X A;  2FHX B;  3RPC A;  1ZTC A;  1P9E A;  5ACS A;  5ACQ A;  4AWY B;  1BMC A;  1VJN A;  4XWW A;  4AX0 B;  5K4M A;  5HH5 A;  4J5F A;  2GFJ A;  2CBN A;  4NQ6 A;  5IQK A;  4EXS A;  4RL2 A;  1YCH A;  4V0H A;  4FR7 A;  2GCU A;  2YNT A;  2R2D A;  3BV6 A;  4F6H A;  4ZO3 A;  1ZKP A;  3RKJ A;  2WHG A;  5AHO A;  4D1W A;  2FU8 A;  5B15 A;  4XUK A;  5EVD A;  2Q0I A;  4TZE A;  2Q9U A;  2YZ3 A;  5FQC A;  4EFZ A;  4C1H A;  2BG6 A;  2Q42 A;  2FU6 A;  3IEL A;  4DIK A;  2BFZ A;  5EVB A;  4GCW A;  2FU9 A;  1ZNB A;  2DOO A;  3PY6 A;  4YSB A;  4EY2 A;  4EYF A;  2DKF A;  4C1G A;  3DHC A;  5ACX A;  2QJS A;  2YNT B;  5HIP A;  4TYT A;  4F6Z A;  1XTO A;  4Z60 A;  4AX1 B;  3S0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...