3X2XA

Crystal structure of metallo-beta-lactamase h48a from thermotoga maritima
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase H48A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
total genus 64
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2xA00
2P18A 2Y87A 2I7TA 4YSKA 5DPXA 1BMCA 1VMEA 2XR1A 3FAIA 3SFPA 1MQOA 5A0TA 4DIKA 2ZO4A 3MD7A 1E5DA 5LE1A 2FK6A 2YNVA 4EFZA 2BG8A 4LE6A 4RM5A 5EV6A 1X8GA 5EWAA 3A4YA 2WYLA 2FU6A 2ZZIA 4TZEA 5B1UA 1K07A 4J5HA 4C1EA 4FSBA 4Z5ZA 4UWSB 5K0WA 3X2YA 4NQ5A 3IE2A 1WUPA 4FR7A 5LCHA 2WRSA 2DOOA 4GCWA 4EY2A 2A7MA 5HISA 5ACWA 5A5ZA 4XUKA 3IEMA 1VGNA 2YNTB 2BC2A 4UWPB 1DDKA 2GKLA 1HLKA 5EV8A 3RKJA 2M5DA 2CBNA 4UWOB 5IQKA 3RPCA 5HH5A 4D1UA 3I14A 4BZ3A 1ZNBA 2QDSA 2BR6A 2YNTA 3DHCA 4D1WA 1KO2A 2FU8A 5A0VA 4TZ9A 1X8HA 4HL1A 4KEPA 4C1GA 2BMIA 4RBSA 1JJTA 2BFKA 4AWYB 4HL2A 1WUOA 5K4MA 4EXSA 1DXKA 2GMNA 2VW8A 4H0DA 5AHOA 1M2XA 1A7TA 4Z6XA 2FU9A 2GFJA 2I7XA 4Z60A 2GFKA 4YSBA 4NQ4A 2FU7A 4UWRB 3ZWFA 4PVTA 4DILA 4F6ZA 3TP9A 4UBQA 5A87A 5ACVA 5KIKA 2NXAA 1YCGA 2P97A 3DHAA 2Q9UA 3KNRA 1DD6A 5HIQA 3PY6A 3ADRA 4TZFA 2NYPA 3WXCA 4WD6A 2HB9A 2ZWRA 2BIBA 2E7YA 4D1TA 3S0ZA 3P2UA 2H6AA 4EYLA 4XWWA 3QH8A 3PG4A 3IELA 2WYMA 2BTNA 3T3OA 5HIPA 1SMLA 4ZO3A 3LVZA 5EVDA 1KO3A 3ZQ4A 5FQAA 3IOGA 3PY5A 2Y8AA 3H3EA 3SW3A 4C1DA 2WHGA 3L6NA 2BGAA 1BVTA 1KR3A 1P9EA 2M5CA 3JXPA 5LCFA 3Q6VA 4BP0A 5ACUA 4F6HA 1A8TA 4HKYA 5AYAA 3IEKA 4J5FA 2AZ4A 2Q0JA 5LLDA 3DHBA 5AHRA 4YSLA 4JO0A 2Y8BA 2UYXA 3VQZA 5AXOA 3BC2A 1X8IA 5B15A 3SD9A 2FHXB 1WRAA 5LS3A 4Z5YA 3R2UA 2Q0IA 1BC2A 2NZEA 5ACSA 3G1PA 2BFZB 5EHTA 4XWTA 1Y44A 3F9OA 2ZNBA 5EVKA 3IE0A 4GYUA 2FHXA 4U4LA 4CHLA 4TYFA 5KILA 5ACXA 2OHIA 2FM6A 5ACQA 5AXRA 2YZ3A 5ACPA 2QINA 5LMCA 4AX0B 2YNVB 3AF5A 2BG8B 4RL0A 3IOFA 1ZTCA 3RKKA 3BV6A 3I11A 4ZO2A 2DKFA 3X2XA 5HIOA 1ZKPA 4C1CA 4C1FA 4D1VA 3IDZA 4EXYA 3SPUA 5K4NA 4FEKA 3KNSA 3VPEA 2QEDA 5LM6A 4UA4A 4UAMA 1WW1A 2R2DA 2YCBA 3T3NA 1JT1A 4Z67A 3IE1A 3X30A 1YCFA 1QH5A 5AEBA 4ZEJA 3SBLA 3FCZA 3ZNBA 3ZR9A 1XTOA 4RAMA 4AD9A 1VJNA 2QJSA 2BG2A 2OHJA 4TYTA 4D02A 2GCUA 5LSCA 4RAWA 2P1EA 2YNWA 4AX1B 4PVOA 2BG7A 3AF6A 4P62A 4EYBA 1L9YA 4RL2A 3I0VA 3X2ZA 3SRXA 4EYFA 2I7VA 4NQ6A 5ACRA 2QDTA 3BK2A 5HH4A 4KEQA 3I15A 5B3RA 4Z7RA 4TZBA 2Q42A 3DH8A 4AWZA 4B87A 5EW0A 4GYQA 5FQBA 3I13A 2NZFA 2AIOA 3AJ3A 5ACTA 2WYMC 2XF4A 2YNUA 1QH3A 5K4KA 3T9MA 3ESHA 5EVBA 5LCAA 3KL7A 3BK1A 1YCHA 2BG6A 5FQCA 4C1HA 1JJEA 5EH9A 2BFLA 4C09A 2P4ZA 4O98A 1XM8A 4V0HA 2OHHA 4ZNBA 2BFZA 5HH6A 4NQ2A
chains in the Genus database with same CATH superfamily
2P18A 2Y87A 2I7TA 4YSKA 5DPXA 1BMCA 1VMEA 2XR1A 3FAIA 3SFPA 1MQOA 5A0TA 4DIKA 2ZO4A 3MD7A 1E5DA 5LE1A 2FK6A 2YNVA 4EFZA 2BG8A 4LE6A 4RM5A 5EV6A 1X8GA 5EWAA 3A4YA 2WYLA 2FU6A 2ZZIA 4TZEA 5B1UA 1K07A 4J5HA 4C1EA 5AIJA 4FSBA 4Z5ZA 4UWSB 5K0WA 3X2YA 4NQ5A 4AV7A 3IE2A 1WUPA 4FR7A 5LCHA 2WRSA 2DOOA 4GCWA 4EY2A 2A7MA 5HISA 5ACWA 5A5ZA 4XUKA 3IEMA 1VGNA 2YNTB 2BC2A 2CG2A 4UWPB 1DDKA 2GKLA 1HLKA 5EV8A 3RKJA 2M5DA 2CBNA 4UWOB 5IQKA 3RPCA 5HH5A 4D1UA 3I14A 4BZ3A 1ZNBA 2QDSA 2BR6A 2YNTA 3DHCA 4D1WA 1KO2A 2FU8A 5A0VA 4TZ9A 1X8HA 4HL1A 4KEPA 4C1GA 2BMIA 4RBSA 1JJTA 2BFKA 4AWYB 4HL2A 1WUOA 5K4MA 4EXSA 1DXKA 2GMNA 2VW8A 4H0DA 5AHOA 1M2XA 1A7TA 4Z6XA 2FU9A 2GFJA 2I7XA 4Z60A 2GFKA 4YSBA 4NQ4A 2FU7A 4UWRB 3ZWFA 4PVTA 4DILA 4F6ZA 3TP9A 4UBQA 5A87A 5ACVA 5KIKA 2NXAA 1YCGA 2CFUA 2P97A 4PDXA 3DHAA 2Q9UA 3KNRA 1DD6A 5HIQA 2CFZA 3PY6A 3ADRA 4TZFA 2NYPA 3WXCA 4WD6A 2HB9A 2ZWRA 2BIBA 2E7YA 4D1TA 3S0ZA 3P2UA 2H6AA 4EYLA 4XWWA 3QH8A 3PG4A 3IELA 2WYMA 2BTNA 3T3OA 5HIPA 1SMLA 4ZO3A 3LVZA 5EVDA 1KO3A 3ZQ4A 5FQAA 3IOGA 3PY5A 2Y8AA 3H3EA 3SW3A 4C1DA 2WHGA 3L6NA 2BGAA 1BVTA 1KR3A 1P9EA 2M5CA 3JXPA 5LCFA 3Q6VA 4BP0A 5ACUA 4F6HA 1A8TA 4HKYA 5AYAA 3IEKA 4J5FA 2AZ4A 2Q0JA 5LLDA 3DHBA 5AHRA 4YSLA 4JO0A 2Y8BA 2UYXA 3VQZA 5AXOA 3BC2A 1X8IA 5B15A 3SD9A 2FHXB 1WRAA 5LS3A 4Z5YA 3R2UA 2Q0IA 1BC2A 2NZEA 5ACSA 3G1PA 2BFZB 5EHTA 4XWTA 1Y44A 3F9OA 2ZNBA 5EVKA 3IE0A 4GYUA 2FHXA 4U4LA 4CHLA 4TYFA 5KILA 5ACXA 2OHIA 2FM6A 5ACQA 5AXRA 2YZ3A 5ACPA 2QINA 5LMCA 4AX0B 2YNVB 3AF5A 2BG8B 4RL0A 3IOFA 1ZTCA 3RKKA 3BV6A 3I11A 4ZO2A 2DKFA 3X2XA 4AXHA 5HIOA 1ZKPA 4C1CA 4C1FA 4D1VA 3IDZA 4EXYA 3SPUA 5K4NA 4FEKA 3KNSA 3VPEA 2QEDA 5LM6A 4UA4A 4UAMA 1WW1A 5A23A 2R2DA 2YCBA 3T3NA 1JT1A 2YHEA 4Z67A 3IE1A 3X30A 1YCFA 2CG3A 1QH5A 5AEBA 4ZEJA 3SBLA 3FCZA 3ZNBA 3ZR9A 1XTOA 4RAMA 4AD9A 1VJNA 2QJSA 2BG2A 2OHJA 4TYTA 4D02A 2GCUA 5LSCA 4RAWA 2P1EA 2YNWA 4AX1B 4PVOA 2BG7A 3AF6A 4P62A 4EYBA 1L9YA 4RL2A 3I0VA 3X2ZA 3SRXA 4EYFA 4NURA 2I7VA 4NQ6A 5ACRA 2QDTA 3BK2A 5HH4A 4KEQA 3I15A 5B3RA 4Z7RA 4TZBA 2Q42A 3DH8A 4AWZA 4B87A 5EW0A 4GYQA 5FQBA 3I13A 2NZFA 2AIOA 3AJ3A 5ACTA 2WYMC 2XF4A 2YNUA 5AJLA 1QH3A 5K4KA 3T9MA 3ESHA 5EVBA 5LCAA 3KL7A 3BK1A 1YCHA 2BG6A 5FQCA 4C1HA 1JJEA 5EH9A 2BFLA 4C09A 2P4ZA 4O98A 1XM8A 4V0HA 2OHHA 4ZNBA 2BFZA 5HH6A 4NQ2A
chains in the Genus database with same CATH topology
2P18A 2Y87A 2I7TA 4YSKA 5DPXA 1BMCA 1VMEA 2XR1A 3FAIA 3SFPA 1MQOA 5A0TA 4DIKA 2ZO4A 3MD7A 1E5DA 5LE1A 2FK6A 2YNVA 4EFZA 2BG8A 4LE6A 4RM5A 5EV6A 1X8GA 5EWAA 3A4YA 2WYLA 2FU6A 2ZZIA 4TZEA 5B1UA 1K07A 4J5HA 4C1EA 4FSBA 4Z5ZA 4UWSB 5K0WA 3X2YA 4NQ5A 3IE2A 1WUPA 4FR7A 5LCHA 2WRSA 2DOOA 4GCWA 4EY2A 2A7MA 5HISA 5ACWA 5A5ZA 4XUKA 3IEMA 1VGNA 2YNTB 2BC2A 4UWPB 1DDKA 2GKLA 1HLKA 5EV8A 3RKJA 2M5DA 2CBNA 4UWOB 5IQKA 3RPCA 5HH5A 4D1UA 3I14A 4BZ3A 1ZNBA 2QDSA 2BR6A 2YNTA 3DHCA 4D1WA 1KO2A 2FU8A 5A0VA 4TZ9A 1X8HA 4HL1A 4KEPA 4C1GA 2BMIA 4RBSA 1JJTA 2BFKA 4AWYB 4HL2A 1WUOA 5K4MA 4EXSA 1DXKA 2GMNA 2VW8A 4H0DA 5AHOA 1M2XA 1A7TA 4Z6XA 2FU9A 2GFJA 2I7XA 4Z60A 2GFKA 4YSBA 4NQ4A 2FU7A 4UWRB 3ZWFA 4PVTA 4DILA 4F6ZA 3TP9A 4UBQA 5A87A 5ACVA 5KIKA 2NXAA 1YCGA 2P97A 3DHAA 2Q9UA 3KNRA 1DD6A 5HIQA 3PY6A 3ADRA 4TZFA 2NYPA 3WXCA 4WD6A 2HB9A 2ZWRA 2BIBA 2E7YA 4D1TA 3S0ZA 3P2UA 2H6AA 4EYLA 4XWWA 3QH8A 3PG4A 3IELA 2WYMA 2BTNA 3T3OA 5HIPA 1SMLA 4ZO3A 3LVZA 5EVDA 1KO3A 3ZQ4A 5FQAA 3IOGA 3PY5A 2Y8AA 3H3EA 3SW3A 4C1DA 2WHGA 3L6NA 2BGAA 1BVTA 1KR3A 1P9EA 2M5CA 3JXPA 5LCFA 3Q6VA 4BP0A 5ACUA 4F6HA 1A8TA 4HKYA 5AYAA 3IEKA 4J5FA 2AZ4A 2Q0JA 5LLDA 3DHBA 5AHRA 4YSLA 4JO0A 2Y8BA 2UYXA 3VQZA 5AXOA 3BC2A 1X8IA 5B15A 3SD9A 2FHXB 1WRAA 5LS3A 4Z5YA 3R2UA 2Q0IA 1BC2A 2NZEA 5ACSA 3G1PA 2BFZB 5EHTA 4XWTA 1Y44A 3F9OA 2ZNBA 5EVKA 3IE0A 4GYUA 2FHXA 4U4LA 4CHLA 4TYFA 5KILA 5ACXA 2OHIA 2FM6A 5ACQA 5AXRA 2YZ3A 5ACPA 2QINA 5LMCA 4AX0B 2YNVB 3AF5A 2BG8B 4RL0A 3IOFA 1ZTCA 3RKKA 3BV6A 3I11A 4ZO2A 2DKFA 3X2XA 5HIOA 1ZKPA 4C1CA 4C1FA 4D1VA 3IDZA 4EXYA 3SPUA 5K4NA 4FEKA 3KNSA 3VPEA 2QEDA 5LM6A 4UA4A 4UAMA 1WW1A 2R2DA 2YCBA 3T3NA 1JT1A 4Z67A 3IE1A 3X30A 1YCFA 1QH5A 5AEBA 4ZEJA 3SBLA 3FCZA 3ZNBA 3ZR9A 1XTOA 4RAMA 4AD9A 1VJNA 2QJSA 2BG2A 2OHJA 4TYTA 4D02A 2GCUA 5LSCA 4RAWA 2P1EA 2YNWA 4AX1B 4PVOA 2BG7A 3AF6A 4P62A 4EYBA 1L9YA 4RL2A 3I0VA 3X2ZA 3SRXA 4EYFA 2I7VA 4NQ6A 5ACRA 2QDTA 3BK2A 5HH4A 4KEQA 3I15A 5B3RA 4Z7RA 4TZBA 2Q42A 3DH8A 4AWZA 4B87A 5EW0A 4GYQA 5FQBA 3I13A 2NZFA 2AIOA 3AJ3A 5ACTA 2WYMC 2XF4A 2YNUA 1QH3A 5K4KA 3T9MA 3ESHA 5EVBA 5LCAA 3KL7A 3BK1A 1YCHA 2BG6A 5FQCA 4C1HA 1JJEA 5EH9A 2BFLA 4C09A 2P4ZA 4O98A 1XM8A 4V0HA 2OHHA 4ZNBA 2BFZA 5HH6A 4NQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P18 A;  2Y87 A;  2I7T A;  4YSK A;  5DPX A;  1BMC A;  1VME A;  2XR1 A;  3FAI A;  3SFP A;  1MQO A;  5A0T A;  4DIK A;  2ZO4 A;  3MD7 A;  1E5D A;  5LE1 A;  2FK6 A;  2YNV A;  4EFZ A;  2BG8 A;  4LE6 A;  4RM5 A;  5EV6 A;  1X8G A;  5EWA A;  3A4Y A;  2WYL A;  2FU6 A;  2ZZI A;  4TZE A;  5B1U A;  1K07 A;  4J5H A;  4C1E A;  4FSB A;  4Z5Z A;  4UWS B;  5K0W A;  3X2Y A;  4NQ5 A;  3IE2 A;  1WUP A;  4FR7 A;  5LCH A;  2WRS A;  2DOO A;  4GCW A;  4EY2 A;  2A7M A;  5HIS A;  5ACW A;  5A5Z A;  4XUK A;  3IEM A;  1VGN A;  2YNT B;  2BC2 A;  4UWP B;  1DDK A;  2GKL A;  1HLK A;  5EV8 A;  3RKJ A;  2M5D A;  2CBN A;  4UWO B;  5IQK A;  3RPC A;  5HH5 A;  4D1U A;  3I14 A;  4BZ3 A;  1ZNB A;  2QDS A;  2BR6 A;  2YNT A;  3DHC A;  4D1W A;  1KO2 A;  2FU8 A;  5A0V A;  4TZ9 A;  1X8H A;  4HL1 A;  4KEP A;  4C1G A;  2BMI A;  4RBS A;  1JJT A;  2BFK A;  4AWY B;  4HL2 A;  1WUO A;  5K4M A;  4EXS A;  1DXK A;  2GMN A;  2VW8 A;  4H0D A;  5AHO A;  1M2X A;  1A7T A;  4Z6X A;  2FU9 A;  2GFJ A;  2I7X A;  4Z60 A;  2GFK A;  4YSB A;  4NQ4 A;  2FU7 A;  4UWR B;  3ZWF A;  4PVT A;  4DIL A;  4F6Z A;  3TP9 A;  4UBQ A;  5A87 A;  5ACV A;  5KIK A;  2NXA A;  1YCG A;  2P97 A;  3DHA A;  2Q9U A;  3KNR A;  1DD6 A;  5HIQ A;  3PY6 A;  3ADR A;  4TZF A;  2NYP A;  3WXC A;  4WD6 A;  2HB9 A;  2ZWR A;  2BIB A;  2E7Y A;  4D1T A;  3S0Z A;  3P2U A;  2H6A A;  4EYL A;  4XWW A;  3QH8 A;  3PG4 A;  3IEL A;  2WYM A;  2BTN A;  3T3O A;  5HIP A;  1SML A;  4ZO3 A;  3LVZ A;  5EVD A;  1KO3 A;  3ZQ4 A;  5FQA A;  3IOG A;  3PY5 A;  2Y8A A;  3H3E A;  3SW3 A;  4C1D A;  2WHG A;  3L6N A;  2BGA A;  1BVT A;  1KR3 A;  1P9E A;  2M5C A;  3JXP A;  5LCF A;  3Q6V A;  4BP0 A;  5ACU A;  4F6H A;  1A8T A;  4HKY A;  5AYA A;  3IEK A;  4J5F A;  2AZ4 A;  2Q0J A;  5LLD A;  3DHB A;  5AHR A;  4YSL A;  4JO0 A;  2Y8B A;  2UYX A;  3VQZ A;  5AXO A;  3BC2 A;  1X8I A;  5B15 A;  3SD9 A;  2FHX B;  1WRA A;  5LS3 A;  4Z5Y A;  3R2U A;  2Q0I A;  1BC2 A;  2NZE A;  5ACS A;  3G1P A;  2BFZ B;  5EHT A;  4XWT A;  1Y44 A;  3F9O A;  2ZNB A;  5EVK A;  3IE0 A;  4GYU A;  2FHX A;  4U4L A;  4CHL A;  4TYF A;  5KIL A;  5ACX A;  2OHI A;  2FM6 A;  5ACQ A;  5AXR A;  2YZ3 A;  5ACP A;  2QIN A;  5LMC A;  4AX0 B;  2YNV B;  3AF5 A;  2BG8 B;  4RL0 A;  3IOF A;  1ZTC A;  3RKK A;  3BV6 A;  3I11 A;  4ZO2 A;  2DKF A;  3X2X A;  5HIO A;  1ZKP A;  4C1C A;  4C1F A;  4D1V A;  3IDZ A;  4EXY A;  3SPU A;  5K4N A;  4FEK A;  3KNS A;  3VPE A;  2QED A;  5LM6 A;  4UA4 A;  4UAM A;  1WW1 A;  2R2D A;  2YCB A;  3T3N A;  1JT1 A;  4Z67 A;  3IE1 A;  3X30 A;  1YCF A;  1QH5 A;  5AEB A;  4ZEJ A;  3SBL A;  3FCZ A;  3ZNB A;  3ZR9 A;  1XTO A;  4RAM A;  4AD9 A;  1VJN A;  2QJS A;  2BG2 A;  2OHJ A;  4TYT A;  4D02 A;  2GCU A;  5LSC A;  4RAW A;  2P1E A;  2YNW A;  4AX1 B;  4PVO A;  2BG7 A;  3AF6 A;  4P62 A;  4EYB A;  1L9Y A;  4RL2 A;  3I0V A;  3X2Z A;  3SRX A;  4EYF A;  2I7V A;  4NQ6 A;  5ACR A;  2QDT A;  3BK2 A;  5HH4 A;  4KEQ A;  3I15 A;  5B3R A;  4Z7R A;  4TZB A;  2Q42 A;  3DH8 A;  4AWZ A;  4B87 A;  5EW0 A;  4GYQ A;  5FQB A;  3I13 A;  2NZF A;  2AIO A;  3AJ3 A;  5ACT A;  2WYM C;  2XF4 A;  2YNU A;  1QH3 A;  5K4K A;  3T9M A;  3ESH A;  5EVB A;  5LCA A;  3KL7 A;  3BK1 A;  1YCH A;  2BG6 A;  5FQC A;  4C1H A;  1JJE A;  5EH9 A;  2BFL A;  4C09 A;  2P4Z A;  4O98 A;  1XM8 A;  4V0H A;  2OHH A;  4ZNB A;  2BFZ A;  5HH6 A;  4NQ2 A; 
#chains in the Genus database with same CATH topology
 2P18 A;  2Y87 A;  2I7T A;  4YSK A;  5DPX A;  1BMC A;  1VME A;  2XR1 A;  3FAI A;  3SFP A;  1MQO A;  5A0T A;  4DIK A;  2ZO4 A;  3MD7 A;  1E5D A;  5LE1 A;  2FK6 A;  2YNV A;  4EFZ A;  2BG8 A;  4LE6 A;  4RM5 A;  5EV6 A;  1X8G A;  5EWA A;  3A4Y A;  2WYL A;  2FU6 A;  2ZZI A;  4TZE A;  5B1U A;  1K07 A;  4J5H A;  4C1E A;  5AIJ A;  4FSB A;  4Z5Z A;  4UWS B;  5K0W A;  3X2Y A;  4NQ5 A;  4AV7 A;  3IE2 A;  1WUP A;  4FR7 A;  5LCH A;  2WRS A;  2DOO A;  4GCW A;  4EY2 A;  2A7M A;  5HIS A;  5ACW A;  5A5Z A;  4XUK A;  3IEM A;  1VGN A;  2YNT B;  2BC2 A;  2CG2 A;  4UWP B;  1DDK A;  2GKL A;  1HLK A;  5EV8 A;  3RKJ A;  2M5D A;  2CBN A;  4UWO B;  5IQK A;  3RPC A;  5HH5 A;  4D1U A;  3I14 A;  4BZ3 A;  1ZNB A;  2QDS A;  2BR6 A;  2YNT A;  3DHC A;  4D1W A;  1KO2 A;  2FU8 A;  5A0V A;  4TZ9 A;  1X8H A;  4HL1 A;  4KEP A;  4C1G A;  2BMI A;  4RBS A;  1JJT A;  2BFK A;  4AWY B;  4HL2 A;  1WUO A;  5K4M A;  4EXS A;  1DXK A;  2GMN A;  2VW8 A;  4H0D A;  5AHO A;  1M2X A;  1A7T A;  4Z6X A;  2FU9 A;  2GFJ A;  2I7X A;  4Z60 A;  2GFK A;  4YSB A;  4NQ4 A;  2FU7 A;  4UWR B;  3ZWF A;  4PVT A;  4DIL A;  4F6Z A;  3TP9 A;  4UBQ A;  5A87 A;  5ACV A;  5KIK A;  2NXA A;  1YCG A;  2CFU A;  2P97 A;  4PDX A;  3DHA A;  2Q9U A;  3KNR A;  1DD6 A;  5HIQ A;  2CFZ A;  3PY6 A;  3ADR A;  4TZF A;  2NYP A;  3WXC A;  4WD6 A;  2HB9 A;  2ZWR A;  2BIB A;  2E7Y A;  4D1T A;  3S0Z A;  3P2U A;  2H6A A;  4EYL A;  4XWW A;  3QH8 A;  3PG4 A;  3IEL A;  2WYM A;  2BTN A;  3T3O A;  5HIP A;  1SML A;  4ZO3 A;  3LVZ A;  5EVD A;  1KO3 A;  3ZQ4 A;  5FQA A;  3IOG A;  3PY5 A;  2Y8A A;  3H3E A;  3SW3 A;  4C1D A;  2WHG A;  3L6N A;  2BGA A;  1BVT A;  1KR3 A;  1P9E A;  2M5C A;  3JXP A;  5LCF A;  3Q6V A;  4BP0 A;  5ACU A;  4F6H A;  1A8T A;  4HKY A;  5AYA A;  3IEK A;  4J5F A;  2AZ4 A;  2Q0J A;  5LLD A;  3DHB A;  5AHR A;  4YSL A;  4JO0 A;  2Y8B A;  2UYX A;  3VQZ A;  5AXO A;  3BC2 A;  1X8I A;  5B15 A;  3SD9 A;  2FHX B;  1WRA A;  5LS3 A;  4Z5Y A;  3R2U A;  2Q0I A;  1BC2 A;  2NZE A;  5ACS A;  3G1P A;  2BFZ B;  5EHT A;  4XWT A;  1Y44 A;  3F9O A;  2ZNB A;  5EVK A;  3IE0 A;  4GYU A;  2FHX A;  4U4L A;  4CHL A;  4TYF A;  5KIL A;  5ACX A;  2OHI A;  2FM6 A;  5ACQ A;  5AXR A;  2YZ3 A;  5ACP A;  2QIN A;  5LMC A;  4AX0 B;  2YNV B;  3AF5 A;  2BG8 B;  4RL0 A;  3IOF A;  1ZTC A;  3RKK A;  3BV6 A;  3I11 A;  4ZO2 A;  2DKF A;  3X2X A;  4AXH A;  5HIO A;  1ZKP A;  4C1C A;  4C1F A;  4D1V A;  3IDZ A;  4EXY A;  3SPU A;  5K4N A;  4FEK A;  3KNS A;  3VPE A;  2QED A;  5LM6 A;  4UA4 A;  4UAM A;  1WW1 A;  5A23 A;  2R2D A;  2YCB A;  3T3N A;  1JT1 A;  2YHE A;  4Z67 A;  3IE1 A;  3X30 A;  1YCF A;  2CG3 A;  1QH5 A;  5AEB A;  4ZEJ A;  3SBL A;  3FCZ A;  3ZNB A;  3ZR9 A;  1XTO A;  4RAM A;  4AD9 A;  1VJN A;  2QJS A;  2BG2 A;  2OHJ A;  4TYT A;  4D02 A;  2GCU A;  5LSC A;  4RAW A;  2P1E A;  2YNW A;  4AX1 B;  4PVO A;  2BG7 A;  3AF6 A;  4P62 A;  4EYB A;  1L9Y A;  4RL2 A;  3I0V A;  3X2Z A;  3SRX A;  4EYF A;  4NUR A;  2I7V A;  4NQ6 A;  5ACR A;  2QDT A;  3BK2 A;  5HH4 A;  4KEQ A;  3I15 A;  5B3R A;  4Z7R A;  4TZB A;  2Q42 A;  3DH8 A;  4AWZ A;  4B87 A;  5EW0 A;  4GYQ A;  5FQB A;  3I13 A;  2NZF A;  2AIO A;  3AJ3 A;  5ACT A;  2WYM C;  2XF4 A;  2YNU A;  5AJL A;  1QH3 A;  5K4K A;  3T9M A;  3ESH A;  5EVB A;  5LCA A;  3KL7 A;  3BK1 A;  1YCH A;  2BG6 A;  5FQC A;  4C1H A;  1JJE A;  5EH9 A;  2BFL A;  4C09 A;  2P4Z A;  4O98 A;  1XM8 A;  4V0H A;  2OHH A;  4ZNB A;  2BFZ A;  5HH6 A;  4NQ2 A; 
#chains in the Genus database with same CATH homology
 2P18 A;  2Y87 A;  2I7T A;  4YSK A;  5DPX A;  1BMC A;  1VME A;  2XR1 A;  3FAI A;  3SFP A;  1MQO A;  5A0T A;  4DIK A;  2ZO4 A;  3MD7 A;  1E5D A;  5LE1 A;  2FK6 A;  2YNV A;  4EFZ A;  2BG8 A;  4LE6 A;  4RM5 A;  5EV6 A;  1X8G A;  5EWA A;  3A4Y A;  2WYL A;  2FU6 A;  2ZZI A;  4TZE A;  5B1U A;  1K07 A;  4J5H A;  4C1E A;  4FSB A;  4Z5Z A;  4UWS B;  5K0W A;  3X2Y A;  4NQ5 A;  3IE2 A;  1WUP A;  4FR7 A;  5LCH A;  2WRS A;  2DOO A;  4GCW A;  4EY2 A;  2A7M A;  5HIS A;  5ACW A;  5A5Z A;  4XUK A;  3IEM A;  1VGN A;  2YNT B;  2BC2 A;  4UWP B;  1DDK A;  2GKL A;  1HLK A;  5EV8 A;  3RKJ A;  2M5D A;  2CBN A;  4UWO B;  5IQK A;  3RPC A;  5HH5 A;  4D1U A;  3I14 A;  4BZ3 A;  1ZNB A;  2QDS A;  2BR6 A;  2YNT A;  3DHC A;  4D1W A;  1KO2 A;  2FU8 A;  5A0V A;  4TZ9 A;  1X8H A;  4HL1 A;  4KEP A;  4C1G A;  2BMI A;  4RBS A;  1JJT A;  2BFK A;  4AWY B;  4HL2 A;  1WUO A;  5K4M A;  4EXS A;  1DXK A;  2GMN A;  2VW8 A;  4H0D A;  5AHO A;  1M2X A;  1A7T A;  4Z6X A;  2FU9 A;  2GFJ A;  2I7X A;  4Z60 A;  2GFK A;  4YSB A;  4NQ4 A;  2FU7 A;  4UWR B;  3ZWF A;  4PVT A;  4DIL A;  4F6Z A;  3TP9 A;  4UBQ A;  5A87 A;  5ACV A;  5KIK A;  2NXA A;  1YCG A;  2P97 A;  3DHA A;  2Q9U A;  3KNR A;  1DD6 A;  5HIQ A;  3PY6 A;  3ADR A;  4TZF A;  2NYP A;  3WXC A;  4WD6 A;  2HB9 A;  2ZWR A;  2BIB A;  2E7Y A;  4D1T A;  3S0Z A;  3P2U A;  2H6A A;  4EYL A;  4XWW A;  3QH8 A;  3PG4 A;  3IEL A;  2WYM A;  2BTN A;  3T3O A;  5HIP A;  1SML A;  4ZO3 A;  3LVZ A;  5EVD A;  1KO3 A;  3ZQ4 A;  5FQA A;  3IOG A;  3PY5 A;  2Y8A A;  3H3E A;  3SW3 A;  4C1D A;  2WHG A;  3L6N A;  2BGA A;  1BVT A;  1KR3 A;  1P9E A;  2M5C A;  3JXP A;  5LCF A;  3Q6V A;  4BP0 A;  5ACU A;  4F6H A;  1A8T A;  4HKY A;  5AYA A;  3IEK A;  4J5F A;  2AZ4 A;  2Q0J A;  5LLD A;  3DHB A;  5AHR A;  4YSL A;  4JO0 A;  2Y8B A;  2UYX A;  3VQZ A;  5AXO A;  3BC2 A;  1X8I A;  5B15 A;  3SD9 A;  2FHX B;  1WRA A;  5LS3 A;  4Z5Y A;  3R2U A;  2Q0I A;  1BC2 A;  2NZE A;  5ACS A;  3G1P A;  2BFZ B;  5EHT A;  4XWT A;  1Y44 A;  3F9O A;  2ZNB A;  5EVK A;  3IE0 A;  4GYU A;  2FHX A;  4U4L A;  4CHL A;  4TYF A;  5KIL A;  5ACX A;  2OHI A;  2FM6 A;  5ACQ A;  5AXR A;  2YZ3 A;  5ACP A;  2QIN A;  5LMC A;  4AX0 B;  2YNV B;  3AF5 A;  2BG8 B;  4RL0 A;  3IOF A;  1ZTC A;  3RKK A;  3BV6 A;  3I11 A;  4ZO2 A;  2DKF A;  3X2X A;  5HIO A;  1ZKP A;  4C1C A;  4C1F A;  4D1V A;  3IDZ A;  4EXY A;  3SPU A;  5K4N A;  4FEK A;  3KNS A;  3VPE A;  2QED A;  5LM6 A;  4UA4 A;  4UAM A;  1WW1 A;  2R2D A;  2YCB A;  3T3N A;  1JT1 A;  4Z67 A;  3IE1 A;  3X30 A;  1YCF A;  1QH5 A;  5AEB A;  4ZEJ A;  3SBL A;  3FCZ A;  3ZNB A;  3ZR9 A;  1XTO A;  4RAM A;  4AD9 A;  1VJN A;  2QJS A;  2BG2 A;  2OHJ A;  4TYT A;  4D02 A;  2GCU A;  5LSC A;  4RAW A;  2P1E A;  2YNW A;  4AX1 B;  4PVO A;  2BG7 A;  3AF6 A;  4P62 A;  4EYB A;  1L9Y A;  4RL2 A;  3I0V A;  3X2Z A;  3SRX A;  4EYF A;  2I7V A;  4NQ6 A;  5ACR A;  2QDT A;  3BK2 A;  5HH4 A;  4KEQ A;  3I15 A;  5B3R A;  4Z7R A;  4TZB A;  2Q42 A;  3DH8 A;  4AWZ A;  4B87 A;  5EW0 A;  4GYQ A;  5FQB A;  3I13 A;  2NZF A;  2AIO A;  3AJ3 A;  5ACT A;  2WYM C;  2XF4 A;  2YNU A;  1QH3 A;  5K4K A;  3T9M A;  3ESH A;  5EVB A;  5LCA A;  3KL7 A;  3BK1 A;  1YCH A;  2BG6 A;  5FQC A;  4C1H A;  1JJE A;  5EH9 A;  2BFL A;  4C09 A;  2P4Z A;  4O98 A;  1XM8 A;  4V0H A;  2OHH A;  4ZNB A;  2BFZ A;  5HH6 A;  4NQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...