3X2XA

Crystal structure of metallo-beta-lactamase h48a from thermotoga maritima
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase H48A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 64
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2xA00
4D1WA 2OHJA 1X8IA 2M5CA 2QDSA 3DH8A 1VJNA 2OHIA 4Z5YA 4C1DA 2XF4A 4RM5A 1BVTA 3PY6A 4FEKA 5A0VA 1XTOA 2YNUA 5ACPA 5EVDA 2BG6A 2Y87A 4F6HA 5ACSA 2BG2A 3X30A 3TP9A 3X2ZA 3IEMA 4UWRB 4AD9A 3DHCA 4C1GA 3P2UA 3G1PA 2UYXA 4NQ5A 1A7TA 4RAMA 1MQOA 3L6NA 4XWWA 4Z5ZA 3IOGA 4CHLA 5KIKA 2QDTA 2DKFA 2FM6A 4NQ2A 2OHHA 5B3RA 1WW1A 5ACXA 4V0HA 1SMLA 3PY5A 1ZNBA 2YNTB 3IEKA 3DHAA 3X2XA 4F6ZA 2M5DA 2WYLA 2VW8A 2WYMC 3H3EA 1E5DA 2ZO4A 1WUPA 5LCFA 3KNRA 2BIBA 5HIQA 4UWPB 3BC2A 4TYTA 2AZ4A 4C1CA 1BC2A 2NZFA 2FU7A 1K07A 2FU9A 2BC2A 5LE1A 2Q0JA 5ACRA 2P18A 4JO0A 4KEQA 5EW0A 3ESHA 4ZO2A 1ZTCA 4TZ9A 3T9MA 4D02A 1JJEA 4EYBA 3SPUA 3ZQ4A 5EHTA 5EV8A 5AYAA 1YCFA 2P1EA 4UWSB 3I0VA 3LVZA 4AX0B 2GMNA 3SD9A 1HLKA 3SBLA 4GYQA 2BG8B 5LLDA 2XR1A 4EYLA 4EXSA 5ACQA 3IE2A 1YCGA 2GFJA 3IDZA 2NZEA 4O98A 1Y44A 4XUKA 5AEBA 1DD6A 4BP0A 2YNTA 5EVKA 2FK6A 1X8HA 5HH5A 3SRXA 2ZNBA 4KEPA 3BV6A 4TYFA 3VPEA 2QEDA 4PVOA 2BMIA 1DDKA 2BG7A 4YSLA 4RL2A 2BR6A 2E7YA 4HKYA 4TZEA 2YNVB 1JJTA 1XM8A 4B87A 3FCZA 4D1VA 4D1TA 2I7VA 2QINA 4FSBA 2Q9UA 5K4NA 1A8TA 4AWZA 5KILA 5LS3A 5AXOA 3IOFA 3AJ3A 3AF5A 2GKLA 3QH8A 1DXKA 4HL1A 5HH6A 2FU6A 4P62A 5ACUA 2YNWA 2FHXB 5EH9A 4ZNBA 3SW3A 1ZKPA 2H6AA 4D1UA 3JXPA 2BTNA 5K4KA 4RL0A 2HB9A 3A4YA 2Q42A 4C09A 3WXCA 2A7MA 4AWYB 3IE0A 2BFKA 2Y8AA 3IELA 4DILA 4UBQA 1JT1A 2BG8A 4UWOB 4RBSA 2AIOA 4J5FA 4TZBA 5K0WA 5ACTA 4GYUA 4XWTA 2I7TA 3BK2A 2WYMA 5ACVA 4LE6A 4Z67A 1QH5A 3I15A 1P9EA 4Z6XA 4YSBA 5EVBA 3PG4A 3VQZA 2YNVA 3AF6A 4EFZA 4EY2A 2P4ZA 2BFZB 5EWAA 4TZFA 2ZWRA 4FR7A 4U4LA 2GFKA 5AHRA 1X8GA 5LCAA 5EV6A 3ZWFA 5FQBA 3S0ZA 5AHOA 2DOOA 3T3OA 2Q0IA 4GCWA 1WRAA 3SFPA 5K4MA 2WHGA 2FHXA 3RKJA 4PVTA 3RPCA 4UA4A 3ZR9A 3ZNBA 5HIOA 4ZO3A 1QH3A 3DHBA 3RKKA 2QJSA 3KL7A 5IQKA 5A5ZA 2YZ3A 4C1EA 1KO3A 5AXRA 2BFLA 3I13A 5B15A 2ZZIA 3X2YA 1L9YA 4BZ3A 3KNSA 4HL2A 4WD6A 5HH4A 3MD7A 4C1HA 4UAMA 2R2DA 4Z7RA 3FAIA 5A87A 1WUOA 3I14A 1BMCA 5LMCA 1VGNA 5HIPA 2P97A 5FQCA 3I11A 3T3NA 4C1FA 5LSCA 4YSKA 4RAWA 2I7XA 2YCBA 3R2UA 2BGAA 4Z60A 4ZEJA 1VMEA 2NYPA 2BFZA 5DPXA 4J5HA 4DIKA 3IE1A 5LCHA 1KO2A 4EYFA 5B1UA 1YCHA 4EXYA 2FU8A 4NQ4A 5A0TA 3ADRA 4NQ6A 3BK1A 1M2XA 4H0DA 3F9OA 5LM6A 5HISA 1KR3A 3Q6VA 5ACWA 2NXAA 4AX1B 2Y8BA 5FQAA 2WRSA 2GCUA 2CBNA
chains in the Genus database with same CATH superfamily
4D1WA 2OHJA 1X8IA 2M5CA 2QDSA 3DH8A 1VJNA 2OHIA 4Z5YA 4C1DA 2XF4A 4RM5A 1BVTA 3PY6A 4FEKA 5A0VA 1XTOA 2YNUA 5ACPA 5EVDA 2BG6A 2Y87A 4F6HA 5ACSA 2BG2A 3X30A 3TP9A 4AV7A 3X2ZA 3IEMA 4UWRB 4AD9A 3DHCA 4NURA 4C1GA 5AIJA 3P2UA 3G1PA 2UYXA 4NQ5A 1A7TA 4RAMA 1MQOA 3L6NA 4XWWA 4Z5ZA 3IOGA 4CHLA 5KIKA 2QDTA 2DKFA 2FM6A 4NQ2A 2OHHA 5B3RA 1WW1A 5ACXA 4V0HA 1SMLA 3PY5A 1ZNBA 2YNTB 3IEKA 3DHAA 3X2XA 4F6ZA 2M5DA 2WYLA 2VW8A 2WYMC 3H3EA 1E5DA 2ZO4A 1WUPA 5LCFA 3KNRA 2BIBA 5HIQA 4UWPB 3BC2A 4TYTA 2AZ4A 4C1CA 1BC2A 2NZFA 2FU7A 1K07A 2FU9A 2BC2A 5LE1A 2Q0JA 5ACRA 2P18A 4JO0A 4KEQA 5EW0A 3ESHA 4ZO2A 1ZTCA 4TZ9A 3T9MA 4D02A 1JJEA 5AJLA 4EYBA 3SPUA 3ZQ4A 2YHEA 5EHTA 5EV8A 5AYAA 1YCFA 2P1EA 4UWSB 3I0VA 3LVZA 4AX0B 2GMNA 3SD9A 1HLKA 3SBLA 4GYQA 2BG8B 5LLDA 2XR1A 4EYLA 4EXSA 5ACQA 3IE2A 1YCGA 2GFJA 3IDZA 2NZEA 4O98A 1Y44A 4XUKA 5AEBA 1DD6A 4BP0A 2YNTA 5EVKA 2FK6A 1X8HA 5HH5A 3SRXA 2ZNBA 4KEPA 3BV6A 4TYFA 3VPEA 2QEDA 4PVOA 2BMIA 1DDKA 2BG7A 4YSLA 4RL2A 2BR6A 2E7YA 4HKYA 4TZEA 2YNVB 1JJTA 1XM8A 4B87A 3FCZA 4D1VA 4D1TA 2I7VA 4PDXA 2QINA 4FSBA 2Q9UA 5K4NA 1A8TA 4AWZA 5KILA 5LS3A 5AXOA 3IOFA 3AJ3A 3AF5A 2GKLA 3QH8A 1DXKA 4HL1A 5HH6A 2FU6A 4P62A 5ACUA 2YNWA 2FHXB 5EH9A 4ZNBA 3SW3A 1ZKPA 2H6AA 4D1UA 3JXPA 2BTNA 5K4KA 4RL0A 2HB9A 3A4YA 2CFUA 2Q42A 4C09A 3WXCA 2A7MA 4AWYB 3IE0A 2BFKA 2Y8AA 3IELA 4DILA 4UBQA 1JT1A 2BG8A 4UWOB 4RBSA 2AIOA 4J5FA 2CG3A 4TZBA 5K0WA 5ACTA 4GYUA 2CFZA 2CG2A 4XWTA 2I7TA 3BK2A 2WYMA 5ACVA 4LE6A 4Z67A 1QH5A 3I15A 1P9EA 4Z6XA 4YSBA 5EVBA 3PG4A 3VQZA 4AXHA 2YNVA 3AF6A 4EFZA 4EY2A 2P4ZA 2BFZB 5EWAA 4TZFA 2ZWRA 4FR7A 4U4LA 2GFKA 5A23A 5AHRA 1X8GA 5LCAA 5EV6A 3ZWFA 5FQBA 3S0ZA 5AHOA 2DOOA 3T3OA 2Q0IA 4GCWA 1WRAA 3SFPA 5K4MA 2WHGA 2FHXA 3RKJA 4PVTA 3RPCA 4UA4A 3ZR9A 3ZNBA 5HIOA 4ZO3A 1QH3A 3DHBA 3RKKA 2QJSA 3KL7A 5IQKA 5A5ZA 2YZ3A 4C1EA 1KO3A 5AXRA 2BFLA 3I13A 5B15A 2ZZIA 3X2YA 1L9YA 4BZ3A 3KNSA 4HL2A 4WD6A 5HH4A 3MD7A 4C1HA 4UAMA 2R2DA 4Z7RA 3FAIA 5A87A 1WUOA 3I14A 1BMCA 5LMCA 1VGNA 5HIPA 2P97A 5FQCA 3I11A 3T3NA 4C1FA 5LSCA 4YSKA 4RAWA 2I7XA 2YCBA 3R2UA 2BGAA 4Z60A 4ZEJA 1VMEA 2NYPA 2BFZA 5DPXA 4J5HA 4DIKA 3IE1A 5LCHA 1KO2A 4EYFA 5B1UA 1YCHA 4EXYA 2FU8A 4NQ4A 5A0TA 3ADRA 4NQ6A 3BK1A 1M2XA 4H0DA 3F9OA 5LM6A 5HISA 1KR3A 3Q6VA 5ACWA 2NXAA 4AX1B 2Y8BA 5FQAA 2WRSA 2GCUA 2CBNA
chains in the Genus database with same CATH topology
4D1WA 2OHJA 1X8IA 2M5CA 2QDSA 3DH8A 1VJNA 2OHIA 4Z5YA 4C1DA 2XF4A 4RM5A 1BVTA 3PY6A 4FEKA 5A0VA 1XTOA 2YNUA 5ACPA 5EVDA 2BG6A 2Y87A 4F6HA 5ACSA 2BG2A 3X30A 3TP9A 3X2ZA 3IEMA 4UWRB 4AD9A 3DHCA 4C1GA 3P2UA 3G1PA 2UYXA 4NQ5A 1A7TA 4RAMA 1MQOA 3L6NA 4XWWA 4Z5ZA 3IOGA 4CHLA 5KIKA 2QDTA 2DKFA 2FM6A 4NQ2A 2OHHA 5B3RA 1WW1A 5ACXA 4V0HA 1SMLA 3PY5A 1ZNBA 2YNTB 3IEKA 3DHAA 3X2XA 4F6ZA 2M5DA 2WYLA 2VW8A 2WYMC 3H3EA 1E5DA 2ZO4A 1WUPA 5LCFA 3KNRA 2BIBA 5HIQA 4UWPB 3BC2A 4TYTA 2AZ4A 4C1CA 1BC2A 2NZFA 2FU7A 1K07A 2FU9A 2BC2A 5LE1A 2Q0JA 5ACRA 2P18A 4JO0A 4KEQA 5EW0A 3ESHA 4ZO2A 1ZTCA 4TZ9A 3T9MA 4D02A 1JJEA 4EYBA 3SPUA 3ZQ4A 5EHTA 5EV8A 5AYAA 1YCFA 2P1EA 4UWSB 3I0VA 3LVZA 4AX0B 2GMNA 3SD9A 1HLKA 3SBLA 4GYQA 2BG8B 5LLDA 2XR1A 4EYLA 4EXSA 5ACQA 3IE2A 1YCGA 2GFJA 3IDZA 2NZEA 4O98A 1Y44A 4XUKA 5AEBA 1DD6A 4BP0A 2YNTA 5EVKA 2FK6A 1X8HA 5HH5A 3SRXA 2ZNBA 4KEPA 3BV6A 4TYFA 3VPEA 2QEDA 4PVOA 2BMIA 1DDKA 2BG7A 4YSLA 4RL2A 2BR6A 2E7YA 4HKYA 4TZEA 2YNVB 1JJTA 1XM8A 4B87A 3FCZA 4D1VA 4D1TA 2I7VA 2QINA 4FSBA 2Q9UA 5K4NA 1A8TA 4AWZA 5KILA 5LS3A 5AXOA 3IOFA 3AJ3A 3AF5A 2GKLA 3QH8A 1DXKA 4HL1A 5HH6A 2FU6A 4P62A 5ACUA 2YNWA 2FHXB 5EH9A 4ZNBA 3SW3A 1ZKPA 2H6AA 4D1UA 3JXPA 2BTNA 5K4KA 4RL0A 2HB9A 3A4YA 2Q42A 4C09A 3WXCA 2A7MA 4AWYB 3IE0A 2BFKA 2Y8AA 3IELA 4DILA 4UBQA 1JT1A 2BG8A 4UWOB 4RBSA 2AIOA 4J5FA 4TZBA 5K0WA 5ACTA 4GYUA 4XWTA 2I7TA 3BK2A 2WYMA 5ACVA 4LE6A 4Z67A 1QH5A 3I15A 1P9EA 4Z6XA 4YSBA 5EVBA 3PG4A 3VQZA 2YNVA 3AF6A 4EFZA 4EY2A 2P4ZA 2BFZB 5EWAA 4TZFA 2ZWRA 4FR7A 4U4LA 2GFKA 5AHRA 1X8GA 5LCAA 5EV6A 3ZWFA 5FQBA 3S0ZA 5AHOA 2DOOA 3T3OA 2Q0IA 4GCWA 1WRAA 3SFPA 5K4MA 2WHGA 2FHXA 3RKJA 4PVTA 3RPCA 4UA4A 3ZR9A 3ZNBA 5HIOA 4ZO3A 1QH3A 3DHBA 3RKKA 2QJSA 3KL7A 5IQKA 5A5ZA 2YZ3A 4C1EA 1KO3A 5AXRA 2BFLA 3I13A 5B15A 2ZZIA 3X2YA 1L9YA 4BZ3A 3KNSA 4HL2A 4WD6A 5HH4A 3MD7A 4C1HA 4UAMA 2R2DA 4Z7RA 3FAIA 5A87A 1WUOA 3I14A 1BMCA 5LMCA 1VGNA 5HIPA 2P97A 5FQCA 3I11A 3T3NA 4C1FA 5LSCA 4YSKA 4RAWA 2I7XA 2YCBA 3R2UA 2BGAA 4Z60A 4ZEJA 1VMEA 2NYPA 2BFZA 5DPXA 4J5HA 4DIKA 3IE1A 5LCHA 1KO2A 4EYFA 5B1UA 1YCHA 4EXYA 2FU8A 4NQ4A 5A0TA 3ADRA 4NQ6A 3BK1A 1M2XA 4H0DA 3F9OA 5LM6A 5HISA 1KR3A 3Q6VA 5ACWA 2NXAA 4AX1B 2Y8BA 5FQAA 2WRSA 2GCUA 2CBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1W A;  2OHJ A;  1X8I A;  2M5C A;  2QDS A;  3DH8 A;  1VJN A;  2OHI A;  4Z5Y A;  4C1D A;  2XF4 A;  4RM5 A;  1BVT A;  3PY6 A;  4FEK A;  5A0V A;  1XTO A;  2YNU A;  5ACP A;  5EVD A;  2BG6 A;  2Y87 A;  4F6H A;  5ACS A;  2BG2 A;  3X30 A;  3TP9 A;  3X2Z A;  3IEM A;  4UWR B;  4AD9 A;  3DHC A;  4C1G A;  3P2U A;  3G1P A;  2UYX A;  4NQ5 A;  1A7T A;  4RAM A;  1MQO A;  3L6N A;  4XWW A;  4Z5Z A;  3IOG A;  4CHL A;  5KIK A;  2QDT A;  2DKF A;  2FM6 A;  4NQ2 A;  2OHH A;  5B3R A;  1WW1 A;  5ACX A;  4V0H A;  1SML A;  3PY5 A;  1ZNB A;  2YNT B;  3IEK A;  3DHA A;  3X2X A;  4F6Z A;  2M5D A;  2WYL A;  2VW8 A;  2WYM C;  3H3E A;  1E5D A;  2ZO4 A;  1WUP A;  5LCF A;  3KNR A;  2BIB A;  5HIQ A;  4UWP B;  3BC2 A;  4TYT A;  2AZ4 A;  4C1C A;  1BC2 A;  2NZF A;  2FU7 A;  1K07 A;  2FU9 A;  2BC2 A;  5LE1 A;  2Q0J A;  5ACR A;  2P18 A;  4JO0 A;  4KEQ A;  5EW0 A;  3ESH A;  4ZO2 A;  1ZTC A;  4TZ9 A;  3T9M A;  4D02 A;  1JJE A;  4EYB A;  3SPU A;  3ZQ4 A;  5EHT A;  5EV8 A;  5AYA A;  1YCF A;  2P1E A;  4UWS B;  3I0V A;  3LVZ A;  4AX0 B;  2GMN A;  3SD9 A;  1HLK A;  3SBL A;  4GYQ A;  2BG8 B;  5LLD A;  2XR1 A;  4EYL A;  4EXS A;  5ACQ A;  3IE2 A;  1YCG A;  2GFJ A;  3IDZ A;  2NZE A;  4O98 A;  1Y44 A;  4XUK A;  5AEB A;  1DD6 A;  4BP0 A;  2YNT A;  5EVK A;  2FK6 A;  1X8H A;  5HH5 A;  3SRX A;  2ZNB A;  4KEP A;  3BV6 A;  4TYF A;  3VPE A;  2QED A;  4PVO A;  2BMI A;  1DDK A;  2BG7 A;  4YSL A;  4RL2 A;  2BR6 A;  2E7Y A;  4HKY A;  4TZE A;  2YNV B;  1JJT A;  1XM8 A;  4B87 A;  3FCZ A;  4D1V A;  4D1T A;  2I7V A;  2QIN A;  4FSB A;  2Q9U A;  5K4N A;  1A8T A;  4AWZ A;  5KIL A;  5LS3 A;  5AXO A;  3IOF A;  3AJ3 A;  3AF5 A;  2GKL A;  3QH8 A;  1DXK A;  4HL1 A;  5HH6 A;  2FU6 A;  4P62 A;  5ACU A;  2YNW A;  2FHX B;  5EH9 A;  4ZNB A;  3SW3 A;  1ZKP A;  2H6A A;  4D1U A;  3JXP A;  2BTN A;  5K4K A;  4RL0 A;  2HB9 A;  3A4Y A;  2Q42 A;  4C09 A;  3WXC A;  2A7M A;  4AWY B;  3IE0 A;  2BFK A;  2Y8A A;  3IEL A;  4DIL A;  4UBQ A;  1JT1 A;  2BG8 A;  4UWO B;  4RBS A;  2AIO A;  4J5F A;  4TZB A;  5K0W A;  5ACT A;  4GYU A;  4XWT A;  2I7T A;  3BK2 A;  2WYM A;  5ACV A;  4LE6 A;  4Z67 A;  1QH5 A;  3I15 A;  1P9E A;  4Z6X A;  4YSB A;  5EVB A;  3PG4 A;  3VQZ A;  2YNV A;  3AF6 A;  4EFZ A;  4EY2 A;  2P4Z A;  2BFZ B;  5EWA A;  4TZF A;  2ZWR A;  4FR7 A;  4U4L A;  2GFK A;  5AHR A;  1X8G A;  5LCA A;  5EV6 A;  3ZWF A;  5FQB A;  3S0Z A;  5AHO A;  2DOO A;  3T3O A;  2Q0I A;  4GCW A;  1WRA A;  3SFP A;  5K4M A;  2WHG A;  2FHX A;  3RKJ A;  4PVT A;  3RPC A;  4UA4 A;  3ZR9 A;  3ZNB A;  5HIO A;  4ZO3 A;  1QH3 A;  3DHB A;  3RKK A;  2QJS A;  3KL7 A;  5IQK A;  5A5Z A;  2YZ3 A;  4C1E A;  1KO3 A;  5AXR A;  2BFL A;  3I13 A;  5B15 A;  2ZZI A;  3X2Y A;  1L9Y A;  4BZ3 A;  3KNS A;  4HL2 A;  4WD6 A;  5HH4 A;  3MD7 A;  4C1H A;  4UAM A;  2R2D A;  4Z7R A;  3FAI A;  5A87 A;  1WUO A;  3I14 A;  1BMC A;  5LMC A;  1VGN A;  5HIP A;  2P97 A;  5FQC A;  3I11 A;  3T3N A;  4C1F A;  5LSC A;  4YSK A;  4RAW A;  2I7X A;  2YCB A;  3R2U A;  2BGA A;  4Z60 A;  4ZEJ A;  1VME A;  2NYP A;  2BFZ A;  5DPX A;  4J5H A;  4DIK A;  3IE1 A;  5LCH A;  1KO2 A;  4EYF A;  5B1U A;  1YCH A;  4EXY A;  2FU8 A;  4NQ4 A;  5A0T A;  3ADR A;  4NQ6 A;  3BK1 A;  1M2X A;  4H0D A;  3F9O A;  5LM6 A;  5HIS A;  1KR3 A;  3Q6V A;  5ACW A;  2NXA A;  4AX1 B;  2Y8B A;  5FQA A;  2WRS A;  2GCU A;  2CBN A; 
#chains in the Genus database with same CATH topology
 4D1W A;  2OHJ A;  1X8I A;  2M5C A;  2QDS A;  3DH8 A;  1VJN A;  2OHI A;  4Z5Y A;  4C1D A;  2XF4 A;  4RM5 A;  1BVT A;  3PY6 A;  4FEK A;  5A0V A;  1XTO A;  2YNU A;  5ACP A;  5EVD A;  2BG6 A;  2Y87 A;  4F6H A;  5ACS A;  2BG2 A;  3X30 A;  3TP9 A;  4AV7 A;  3X2Z A;  3IEM A;  4UWR B;  4AD9 A;  3DHC A;  4NUR A;  4C1G A;  5AIJ A;  3P2U A;  3G1P A;  2UYX A;  4NQ5 A;  1A7T A;  4RAM A;  1MQO A;  3L6N A;  4XWW A;  4Z5Z A;  3IOG A;  4CHL A;  5KIK A;  2QDT A;  2DKF A;  2FM6 A;  4NQ2 A;  2OHH A;  5B3R A;  1WW1 A;  5ACX A;  4V0H A;  1SML A;  3PY5 A;  1ZNB A;  2YNT B;  3IEK A;  3DHA A;  3X2X A;  4F6Z A;  2M5D A;  2WYL A;  2VW8 A;  2WYM C;  3H3E A;  1E5D A;  2ZO4 A;  1WUP A;  5LCF A;  3KNR A;  2BIB A;  5HIQ A;  4UWP B;  3BC2 A;  4TYT A;  2AZ4 A;  4C1C A;  1BC2 A;  2NZF A;  2FU7 A;  1K07 A;  2FU9 A;  2BC2 A;  5LE1 A;  2Q0J A;  5ACR A;  2P18 A;  4JO0 A;  4KEQ A;  5EW0 A;  3ESH A;  4ZO2 A;  1ZTC A;  4TZ9 A;  3T9M A;  4D02 A;  1JJE A;  5AJL A;  4EYB A;  3SPU A;  3ZQ4 A;  2YHE A;  5EHT A;  5EV8 A;  5AYA A;  1YCF A;  2P1E A;  4UWS B;  3I0V A;  3LVZ A;  4AX0 B;  2GMN A;  3SD9 A;  1HLK A;  3SBL A;  4GYQ A;  2BG8 B;  5LLD A;  2XR1 A;  4EYL A;  4EXS A;  5ACQ A;  3IE2 A;  1YCG A;  2GFJ A;  3IDZ A;  2NZE A;  4O98 A;  1Y44 A;  4XUK A;  5AEB A;  1DD6 A;  4BP0 A;  2YNT A;  5EVK A;  2FK6 A;  1X8H A;  5HH5 A;  3SRX A;  2ZNB A;  4KEP A;  3BV6 A;  4TYF A;  3VPE A;  2QED A;  4PVO A;  2BMI A;  1DDK A;  2BG7 A;  4YSL A;  4RL2 A;  2BR6 A;  2E7Y A;  4HKY A;  4TZE A;  2YNV B;  1JJT A;  1XM8 A;  4B87 A;  3FCZ A;  4D1V A;  4D1T A;  2I7V A;  4PDX A;  2QIN A;  4FSB A;  2Q9U A;  5K4N A;  1A8T A;  4AWZ A;  5KIL A;  5LS3 A;  5AXO A;  3IOF A;  3AJ3 A;  3AF5 A;  2GKL A;  3QH8 A;  1DXK A;  4HL1 A;  5HH6 A;  2FU6 A;  4P62 A;  5ACU A;  2YNW A;  2FHX B;  5EH9 A;  4ZNB A;  3SW3 A;  1ZKP A;  2H6A A;  4D1U A;  3JXP A;  2BTN A;  5K4K A;  4RL0 A;  2HB9 A;  3A4Y A;  2CFU A;  2Q42 A;  4C09 A;  3WXC A;  2A7M A;  4AWY B;  3IE0 A;  2BFK A;  2Y8A A;  3IEL A;  4DIL A;  4UBQ A;  1JT1 A;  2BG8 A;  4UWO B;  4RBS A;  2AIO A;  4J5F A;  2CG3 A;  4TZB A;  5K0W A;  5ACT A;  4GYU A;  2CFZ A;  2CG2 A;  4XWT A;  2I7T A;  3BK2 A;  2WYM A;  5ACV A;  4LE6 A;  4Z67 A;  1QH5 A;  3I15 A;  1P9E A;  4Z6X A;  4YSB A;  5EVB A;  3PG4 A;  3VQZ A;  4AXH A;  2YNV A;  3AF6 A;  4EFZ A;  4EY2 A;  2P4Z A;  2BFZ B;  5EWA A;  4TZF A;  2ZWR A;  4FR7 A;  4U4L A;  2GFK A;  5A23 A;  5AHR A;  1X8G A;  5LCA A;  5EV6 A;  3ZWF A;  5FQB A;  3S0Z A;  5AHO A;  2DOO A;  3T3O A;  2Q0I A;  4GCW A;  1WRA A;  3SFP A;  5K4M A;  2WHG A;  2FHX A;  3RKJ A;  4PVT A;  3RPC A;  4UA4 A;  3ZR9 A;  3ZNB A;  5HIO A;  4ZO3 A;  1QH3 A;  3DHB A;  3RKK A;  2QJS A;  3KL7 A;  5IQK A;  5A5Z A;  2YZ3 A;  4C1E A;  1KO3 A;  5AXR A;  2BFL A;  3I13 A;  5B15 A;  2ZZI A;  3X2Y A;  1L9Y A;  4BZ3 A;  3KNS A;  4HL2 A;  4WD6 A;  5HH4 A;  3MD7 A;  4C1H A;  4UAM A;  2R2D A;  4Z7R A;  3FAI A;  5A87 A;  1WUO A;  3I14 A;  1BMC A;  5LMC A;  1VGN A;  5HIP A;  2P97 A;  5FQC A;  3I11 A;  3T3N A;  4C1F A;  5LSC A;  4YSK A;  4RAW A;  2I7X A;  2YCB A;  3R2U A;  2BGA A;  4Z60 A;  4ZEJ A;  1VME A;  2NYP A;  2BFZ A;  5DPX A;  4J5H A;  4DIK A;  3IE1 A;  5LCH A;  1KO2 A;  4EYF A;  5B1U A;  1YCH A;  4EXY A;  2FU8 A;  4NQ4 A;  5A0T A;  3ADR A;  4NQ6 A;  3BK1 A;  1M2X A;  4H0D A;  3F9O A;  5LM6 A;  5HIS A;  1KR3 A;  3Q6V A;  5ACW A;  2NXA A;  4AX1 B;  2Y8B A;  5FQA A;  2WRS A;  2GCU A;  2CBN A; 
#chains in the Genus database with same CATH homology
 4D1W A;  2OHJ A;  1X8I A;  2M5C A;  2QDS A;  3DH8 A;  1VJN A;  2OHI A;  4Z5Y A;  4C1D A;  2XF4 A;  4RM5 A;  1BVT A;  3PY6 A;  4FEK A;  5A0V A;  1XTO A;  2YNU A;  5ACP A;  5EVD A;  2BG6 A;  2Y87 A;  4F6H A;  5ACS A;  2BG2 A;  3X30 A;  3TP9 A;  3X2Z A;  3IEM A;  4UWR B;  4AD9 A;  3DHC A;  4C1G A;  3P2U A;  3G1P A;  2UYX A;  4NQ5 A;  1A7T A;  4RAM A;  1MQO A;  3L6N A;  4XWW A;  4Z5Z A;  3IOG A;  4CHL A;  5KIK A;  2QDT A;  2DKF A;  2FM6 A;  4NQ2 A;  2OHH A;  5B3R A;  1WW1 A;  5ACX A;  4V0H A;  1SML A;  3PY5 A;  1ZNB A;  2YNT B;  3IEK A;  3DHA A;  3X2X A;  4F6Z A;  2M5D A;  2WYL A;  2VW8 A;  2WYM C;  3H3E A;  1E5D A;  2ZO4 A;  1WUP A;  5LCF A;  3KNR A;  2BIB A;  5HIQ A;  4UWP B;  3BC2 A;  4TYT A;  2AZ4 A;  4C1C A;  1BC2 A;  2NZF A;  2FU7 A;  1K07 A;  2FU9 A;  2BC2 A;  5LE1 A;  2Q0J A;  5ACR A;  2P18 A;  4JO0 A;  4KEQ A;  5EW0 A;  3ESH A;  4ZO2 A;  1ZTC A;  4TZ9 A;  3T9M A;  4D02 A;  1JJE A;  4EYB A;  3SPU A;  3ZQ4 A;  5EHT A;  5EV8 A;  5AYA A;  1YCF A;  2P1E A;  4UWS B;  3I0V A;  3LVZ A;  4AX0 B;  2GMN A;  3SD9 A;  1HLK A;  3SBL A;  4GYQ A;  2BG8 B;  5LLD A;  2XR1 A;  4EYL A;  4EXS A;  5ACQ A;  3IE2 A;  1YCG A;  2GFJ A;  3IDZ A;  2NZE A;  4O98 A;  1Y44 A;  4XUK A;  5AEB A;  1DD6 A;  4BP0 A;  2YNT A;  5EVK A;  2FK6 A;  1X8H A;  5HH5 A;  3SRX A;  2ZNB A;  4KEP A;  3BV6 A;  4TYF A;  3VPE A;  2QED A;  4PVO A;  2BMI A;  1DDK A;  2BG7 A;  4YSL A;  4RL2 A;  2BR6 A;  2E7Y A;  4HKY A;  4TZE A;  2YNV B;  1JJT A;  1XM8 A;  4B87 A;  3FCZ A;  4D1V A;  4D1T A;  2I7V A;  2QIN A;  4FSB A;  2Q9U A;  5K4N A;  1A8T A;  4AWZ A;  5KIL A;  5LS3 A;  5AXO A;  3IOF A;  3AJ3 A;  3AF5 A;  2GKL A;  3QH8 A;  1DXK A;  4HL1 A;  5HH6 A;  2FU6 A;  4P62 A;  5ACU A;  2YNW A;  2FHX B;  5EH9 A;  4ZNB A;  3SW3 A;  1ZKP A;  2H6A A;  4D1U A;  3JXP A;  2BTN A;  5K4K A;  4RL0 A;  2HB9 A;  3A4Y A;  2Q42 A;  4C09 A;  3WXC A;  2A7M A;  4AWY B;  3IE0 A;  2BFK A;  2Y8A A;  3IEL A;  4DIL A;  4UBQ A;  1JT1 A;  2BG8 A;  4UWO B;  4RBS A;  2AIO A;  4J5F A;  4TZB A;  5K0W A;  5ACT A;  4GYU A;  4XWT A;  2I7T A;  3BK2 A;  2WYM A;  5ACV A;  4LE6 A;  4Z67 A;  1QH5 A;  3I15 A;  1P9E A;  4Z6X A;  4YSB A;  5EVB A;  3PG4 A;  3VQZ A;  2YNV A;  3AF6 A;  4EFZ A;  4EY2 A;  2P4Z A;  2BFZ B;  5EWA A;  4TZF A;  2ZWR A;  4FR7 A;  4U4L A;  2GFK A;  5AHR A;  1X8G A;  5LCA A;  5EV6 A;  3ZWF A;  5FQB A;  3S0Z A;  5AHO A;  2DOO A;  3T3O A;  2Q0I A;  4GCW A;  1WRA A;  3SFP A;  5K4M A;  2WHG A;  2FHX A;  3RKJ A;  4PVT A;  3RPC A;  4UA4 A;  3ZR9 A;  3ZNB A;  5HIO A;  4ZO3 A;  1QH3 A;  3DHB A;  3RKK A;  2QJS A;  3KL7 A;  5IQK A;  5A5Z A;  2YZ3 A;  4C1E A;  1KO3 A;  5AXR A;  2BFL A;  3I13 A;  5B15 A;  2ZZI A;  3X2Y A;  1L9Y A;  4BZ3 A;  3KNS A;  4HL2 A;  4WD6 A;  5HH4 A;  3MD7 A;  4C1H A;  4UAM A;  2R2D A;  4Z7R A;  3FAI A;  5A87 A;  1WUO A;  3I14 A;  1BMC A;  5LMC A;  1VGN A;  5HIP A;  2P97 A;  5FQC A;  3I11 A;  3T3N A;  4C1F A;  5LSC A;  4YSK A;  4RAW A;  2I7X A;  2YCB A;  3R2U A;  2BGA A;  4Z60 A;  4ZEJ A;  1VME A;  2NYP A;  2BFZ A;  5DPX A;  4J5H A;  4DIK A;  3IE1 A;  5LCH A;  1KO2 A;  4EYF A;  5B1U A;  1YCH A;  4EXY A;  2FU8 A;  4NQ4 A;  5A0T A;  3ADR A;  4NQ6 A;  3BK1 A;  1M2X A;  4H0D A;  3F9O A;  5LM6 A;  5HIS A;  1KR3 A;  3Q6V A;  5ACW A;  2NXA A;  4AX1 B;  2Y8B A;  5FQA A;  2WRS A;  2GCU A;  2CBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...