3X2XA

Crystal structure of metallo-beta-lactamase h48a from thermotoga maritima
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
227
Chain Sequence
b'GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase H48A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 64
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2xA00
3KNSA 5ACQA 4Z5ZA 5K4KA 4RAWA 3TP9A 4ZO3A 5LSCA 2YNUA 4RM5A 4XWTA 3BK2A 3P2UA 2YCBA 3X2XA 1X8HA 2QINA 4P62A 1WUOA 2YNVA 3RKJA 4YSLA 3SFPA 3X30A 4TZFA 5B1UA 1YCFA 5EWAA 2BG6A 1WRAA 1JJEA 5HIOA 2H6AA 2WYMC 1X8GA 5A87A 4KEQA 3IE2A 5ACRA 4WD6A 2Q9UA 1JT1A 3AF5A 4EYFA 2Q0IA 3LVZA 1SMLA 5EV6A 5HIQA 1DD6A 4Z5YA 4ZO2A 5AXRA 4C1GA 2VW8A 3DHAA 3R2UA 5B15A 4ZNBA 4EXYA 2FHXB 4PVTA 4FR7A 3SPUA 3RKKA 1BC2A 3ZQ4A 4B87A 2FU8A 1HLKA 1ZNBA 2BG8A 2P97A 4FEKA 3DHCA 3ADRA 4UWPB 5EVKA 5ACTA 3DH8A 5IQKA 3KL7A 5K0WA 4RBSA 2M5DA 4RL2A 4BZ3A 1VGNA 4C1CA 2NYPA 3A4YA 3RPCA 3X2YA 4YSKA 3I0VA 3T9MA 4AWYB 4NQ4A 2WRSA 2M5CA 1P9EA 5FQAA 1JJTA 4F6HA 5EW0A 2BMIA 1K07A 5HH4A 3BK1A 4H0DA 2I7VA 2ZO4A 4J5HA 4GYQA 4BP0A 2ZNBA 2YNTA 2Y8AA 2R2DA 2HB9A 3AF6A 5AHRA 2P18A 4U4LA 1E5DA 3VPEA 3ZNBA 3FAIA 4XUKA 1DXKA 2I7XA 4HL1A 1Y44A 4AX1B 5ACXA 5HH6A 2ZZIA 3IOFA 3L6NA 3IE1A 2QJSA 3BC2A 1KO2A 4EY2A 5A0VA 1YCHA 4TYFA 4TZBA 5KIKA 4UBQA 3SBLA 4J5FA 5ACVA 3DHBA 1YCGA 3QH8A 3I13A 3H3EA 4DILA 4C1HA 1WUPA 2BFZA 2CBNA 3IDZA 5LCFA 1VJNA 4EYBA 2BTNA 1L9YA 2E7YA 3ZWFA 4UWSB 2OHIA 4JO0A 4D02A 2AIOA 2Q42A 2Y8BA 5AXOA 2YNVB 1A8TA 4TYTA 1ZTCA 2WYMA 4GYUA 1XM8A 3PG4A 5FQCA 5A0TA 3Q6VA 3SRXA 2QDSA 5HIPA 5DPXA 4EXSA 4D1UA 3KNRA 5AEBA 3S0ZA 5LMCA 4C09A 4XWWA 5LM6A 5AYAA 1XTOA 4ZEJA 2GFKA 5LS3A 1KR3A 2BGAA 2BIBA 2BR6A 4YSBA 1VMEA 3G1PA 2QEDA 5EVDA 2Y87A 4NQ5A 4C1DA 2FU7A 4D1VA 2BFLA 5HH5A 5LCHA 2GFJA 2A7MA 4EYLA 3IOGA 4Z6XA 3IELA 2XF4A 2BG8B 2GMNA 2OHJA 3IEMA 4C1FA 3SD9A 4DIKA 3I14A 4AD9A 2FU6A 2I7TA 1X8IA 5FQBA 4TZEA 5K4NA 1MQOA 5HISA 4RL0A 4UWRB 4D1TA 3F9OA 1ZKPA 2NZFA 4AWZA 3JXPA 1BMCA 3PY6A 3T3OA 4Z7RA 2BG2A 2XR1A 2BFKA 2YNTB 5ACWA 3ESHA 3BV6A 2DKFA 2GCUA 3I15A 3IE0A 2FHXA 2YZ3A 5ACPA 4C1EA 3FCZA 4KEPA 1WW1A 4NQ6A 5LLDA 2Q0JA 4O98A 4Z67A 1QH5A 5EH9A 2FU9A 3X2ZA 4V0HA 2P4ZA 2UYXA 4UAMA 4HL2A 2BC2A 3ZR9A 5LCAA 2WYLA 5ACSA 3MD7A 4TZ9A 3I11A 2P1EA 1A7TA 2NXAA 1KO3A 2AZ4A 4LE6A 2BFZB 2QDTA 1M2XA 2DOOA 1DDKA 4UWOB 4FSBA 2ZWRA 2WHGA 4HKYA 3PY5A 5B3RA 2YNWA 4RAMA 5ACUA 5K4MA 5EHTA 5EVBA 1BVTA 5LE1A 4AX0B 3T3NA 3VQZA 4Z60A 4NQ2A 4F6ZA 2OHHA 2NZEA 5KILA 3IEKA 4UA4A 2BG7A 5AHOA 4CHLA 5A5ZA 4GCWA 4D1WA 1QH3A 3WXCA 4PVOA 2FM6A 3SW3A 2GKLA 2FK6A 3AJ3A 4EFZA 5EV8A
chains in the Genus database with same CATH superfamily
3KNSA 5ACQA 4Z5ZA 5A23A 5K4KA 4RAWA 3TP9A 4ZO3A 5LSCA 2YNUA 4RM5A 4XWTA 3BK2A 3P2UA 2YCBA 3X2XA 1X8HA 2QINA 4P62A 1WUOA 2YNVA 3RKJA 4YSLA 3SFPA 3X30A 4TZFA 5B1UA 1YCFA 5EWAA 2BG6A 1WRAA 1JJEA 5HIOA 2H6AA 2WYMC 1X8GA 5A87A 4KEQA 3IE2A 5ACRA 4WD6A 2YHEA 2Q9UA 4AV7A 1JT1A 3AF5A 4EYFA 2Q0IA 3LVZA 1SMLA 5EV6A 5HIQA 1DD6A 4AXHA 4Z5YA 4ZO2A 5AXRA 4C1GA 2VW8A 3DHAA 3R2UA 5B15A 4ZNBA 4EXYA 2FHXB 4PVTA 4FR7A 3SPUA 3RKKA 1BC2A 3ZQ4A 4B87A 2FU8A 1HLKA 1ZNBA 2BG8A 2P97A 4FEKA 3DHCA 3ADRA 4UWPB 5EVKA 5ACTA 3DH8A 5IQKA 3KL7A 5K0WA 4RBSA 2M5DA 4RL2A 4BZ3A 1VGNA 4C1CA 2NYPA 3A4YA 3RPCA 3X2YA 4YSKA 3I0VA 3T9MA 4AWYB 4NQ4A 2WRSA 2M5CA 1P9EA 5FQAA 1JJTA 4F6HA 5EW0A 2BMIA 1K07A 5HH4A 3BK1A 4H0DA 2I7VA 2ZO4A 4J5HA 4GYQA 4BP0A 2ZNBA 2YNTA 2Y8AA 2R2DA 2HB9A 3AF6A 5AHRA 2P18A 4U4LA 1E5DA 3VPEA 3ZNBA 3FAIA 4XUKA 1DXKA 2I7XA 4HL1A 1Y44A 4AX1B 5ACXA 5HH6A 2CFZA 2ZZIA 3IOFA 3L6NA 3IE1A 2QJSA 3BC2A 1KO2A 4EY2A 5A0VA 1YCHA 4TYFA 4TZBA 5KIKA 4UBQA 3SBLA 4J5FA 5ACVA 3DHBA 1YCGA 3QH8A 3I13A 3H3EA 4DILA 4C1HA 1WUPA 2BFZA 2CBNA 3IDZA 5LCFA 1VJNA 4EYBA 2BTNA 1L9YA 2E7YA 3ZWFA 4UWSB 2OHIA 4JO0A 4D02A 2AIOA 2CG2A 2Q42A 2Y8BA 5AXOA 2YNVB 1A8TA 4TYTA 1ZTCA 2WYMA 4GYUA 1XM8A 3PG4A 5FQCA 5A0TA 3Q6VA 3SRXA 2QDSA 5HIPA 5DPXA 4EXSA 4D1UA 3KNRA 5AEBA 3S0ZA 5LMCA 4C09A 4XWWA 5LM6A 5AYAA 1XTOA 4ZEJA 2GFKA 5LS3A 1KR3A 2BGAA 2BIBA 2BR6A 4YSBA 1VMEA 3G1PA 2QEDA 5EVDA 2Y87A 4NQ5A 4C1DA 2FU7A 4PDXA 4D1VA 2BFLA 5HH5A 5LCHA 2GFJA 2A7MA 4EYLA 3IOGA 4Z6XA 3IELA 2XF4A 2BG8B 2GMNA 2OHJA 3IEMA 4C1FA 3SD9A 4DIKA 3I14A 4AD9A 2FU6A 2I7TA 1X8IA 5FQBA 4TZEA 5K4NA 1MQOA 5HISA 4RL0A 4UWRB 4D1TA 3F9OA 1ZKPA 2NZFA 4AWZA 3JXPA 1BMCA 5AJLA 3PY6A 3T3OA 4Z7RA 2BG2A 2XR1A 2BFKA 2YNTB 2CG3A 5ACWA 3ESHA 3BV6A 2DKFA 2GCUA 3I15A 3IE0A 2FHXA 2YZ3A 5ACPA 4C1EA 3FCZA 4KEPA 1WW1A 4NQ6A 5LLDA 2Q0JA 4O98A 4Z67A 1QH5A 5EH9A 2FU9A 3X2ZA 4V0HA 2P4ZA 2UYXA 4UAMA 4HL2A 2BC2A 3ZR9A 5LCAA 2WYLA 5ACSA 3MD7A 4TZ9A 3I11A 2P1EA 1A7TA 2NXAA 1KO3A 2AZ4A 4LE6A 2BFZB 2QDTA 1M2XA 2DOOA 1DDKA 4UWOB 4FSBA 2ZWRA 2WHGA 2CFUA 4HKYA 3PY5A 5B3RA 2YNWA 4RAMA 5ACUA 5K4MA 5EHTA 5EVBA 1BVTA 5LE1A 4AX0B 3T3NA 3VQZA 4Z60A 4NQ2A 4F6ZA 2OHHA 2NZEA 5KILA 3IEKA 4UA4A 2BG7A 5AHOA 4CHLA 4NURA 5A5ZA 4GCWA 5AIJA 4D1WA 1QH3A 3WXCA 4PVOA 2FM6A 3SW3A 2GKLA 2FK6A 3AJ3A 4EFZA 5EV8A
chains in the Genus database with same CATH topology
3KNSA 5ACQA 4Z5ZA 5K4KA 4RAWA 3TP9A 4ZO3A 5LSCA 2YNUA 4RM5A 4XWTA 3BK2A 3P2UA 2YCBA 3X2XA 1X8HA 2QINA 4P62A 1WUOA 2YNVA 3RKJA 4YSLA 3SFPA 3X30A 4TZFA 5B1UA 1YCFA 5EWAA 2BG6A 1WRAA 1JJEA 5HIOA 2H6AA 2WYMC 1X8GA 5A87A 4KEQA 3IE2A 5ACRA 4WD6A 2Q9UA 1JT1A 3AF5A 4EYFA 2Q0IA 3LVZA 1SMLA 5EV6A 5HIQA 1DD6A 4Z5YA 4ZO2A 5AXRA 4C1GA 2VW8A 3DHAA 3R2UA 5B15A 4ZNBA 4EXYA 2FHXB 4PVTA 4FR7A 3SPUA 3RKKA 1BC2A 3ZQ4A 4B87A 2FU8A 1HLKA 1ZNBA 2BG8A 2P97A 4FEKA 3DHCA 3ADRA 4UWPB 5EVKA 5ACTA 3DH8A 5IQKA 3KL7A 5K0WA 4RBSA 2M5DA 4RL2A 4BZ3A 1VGNA 4C1CA 2NYPA 3A4YA 3RPCA 3X2YA 4YSKA 3I0VA 3T9MA 4AWYB 4NQ4A 2WRSA 2M5CA 1P9EA 5FQAA 1JJTA 4F6HA 5EW0A 2BMIA 1K07A 5HH4A 3BK1A 4H0DA 2I7VA 2ZO4A 4J5HA 4GYQA 4BP0A 2ZNBA 2YNTA 2Y8AA 2R2DA 2HB9A 3AF6A 5AHRA 2P18A 4U4LA 1E5DA 3VPEA 3ZNBA 3FAIA 4XUKA 1DXKA 2I7XA 4HL1A 1Y44A 4AX1B 5ACXA 5HH6A 2ZZIA 3IOFA 3L6NA 3IE1A 2QJSA 3BC2A 1KO2A 4EY2A 5A0VA 1YCHA 4TYFA 4TZBA 5KIKA 4UBQA 3SBLA 4J5FA 5ACVA 3DHBA 1YCGA 3QH8A 3I13A 3H3EA 4DILA 4C1HA 1WUPA 2BFZA 2CBNA 3IDZA 5LCFA 1VJNA 4EYBA 2BTNA 1L9YA 2E7YA 3ZWFA 4UWSB 2OHIA 4JO0A 4D02A 2AIOA 2Q42A 2Y8BA 5AXOA 2YNVB 1A8TA 4TYTA 1ZTCA 2WYMA 4GYUA 1XM8A 3PG4A 5FQCA 5A0TA 3Q6VA 3SRXA 2QDSA 5HIPA 5DPXA 4EXSA 4D1UA 3KNRA 5AEBA 3S0ZA 5LMCA 4C09A 4XWWA 5LM6A 5AYAA 1XTOA 4ZEJA 2GFKA 5LS3A 1KR3A 2BGAA 2BIBA 2BR6A 4YSBA 1VMEA 3G1PA 2QEDA 5EVDA 2Y87A 4NQ5A 4C1DA 2FU7A 4D1VA 2BFLA 5HH5A 5LCHA 2GFJA 2A7MA 4EYLA 3IOGA 4Z6XA 3IELA 2XF4A 2BG8B 2GMNA 2OHJA 3IEMA 4C1FA 3SD9A 4DIKA 3I14A 4AD9A 2FU6A 2I7TA 1X8IA 5FQBA 4TZEA 5K4NA 1MQOA 5HISA 4RL0A 4UWRB 4D1TA 3F9OA 1ZKPA 2NZFA 4AWZA 3JXPA 1BMCA 3PY6A 3T3OA 4Z7RA 2BG2A 2XR1A 2BFKA 2YNTB 5ACWA 3ESHA 3BV6A 2DKFA 2GCUA 3I15A 3IE0A 2FHXA 2YZ3A 5ACPA 4C1EA 3FCZA 4KEPA 1WW1A 4NQ6A 5LLDA 2Q0JA 4O98A 4Z67A 1QH5A 5EH9A 2FU9A 3X2ZA 4V0HA 2P4ZA 2UYXA 4UAMA 4HL2A 2BC2A 3ZR9A 5LCAA 2WYLA 5ACSA 3MD7A 4TZ9A 3I11A 2P1EA 1A7TA 2NXAA 1KO3A 2AZ4A 4LE6A 2BFZB 2QDTA 1M2XA 2DOOA 1DDKA 4UWOB 4FSBA 2ZWRA 2WHGA 4HKYA 3PY5A 5B3RA 2YNWA 4RAMA 5ACUA 5K4MA 5EHTA 5EVBA 1BVTA 5LE1A 4AX0B 3T3NA 3VQZA 4Z60A 4NQ2A 4F6ZA 2OHHA 2NZEA 5KILA 3IEKA 4UA4A 2BG7A 5AHOA 4CHLA 5A5ZA 4GCWA 4D1WA 1QH3A 3WXCA 4PVOA 2FM6A 3SW3A 2GKLA 2FK6A 3AJ3A 4EFZA 5EV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KNS A;  5ACQ A;  4Z5Z A;  5K4K A;  4RAW A;  3TP9 A;  4ZO3 A;  5LSC A;  2YNU A;  4RM5 A;  4XWT A;  3BK2 A;  3P2U A;  2YCB A;  3X2X A;  1X8H A;  2QIN A;  4P62 A;  1WUO A;  2YNV A;  3RKJ A;  4YSL A;  3SFP A;  3X30 A;  4TZF A;  5B1U A;  1YCF A;  5EWA A;  2BG6 A;  1WRA A;  1JJE A;  5HIO A;  2H6A A;  2WYM C;  1X8G A;  5A87 A;  4KEQ A;  3IE2 A;  5ACR A;  4WD6 A;  2Q9U A;  1JT1 A;  3AF5 A;  4EYF A;  2Q0I A;  3LVZ A;  1SML A;  5EV6 A;  5HIQ A;  1DD6 A;  4Z5Y A;  4ZO2 A;  5AXR A;  4C1G A;  2VW8 A;  3DHA A;  3R2U A;  5B15 A;  4ZNB A;  4EXY A;  2FHX B;  4PVT A;  4FR7 A;  3SPU A;  3RKK A;  1BC2 A;  3ZQ4 A;  4B87 A;  2FU8 A;  1HLK A;  1ZNB A;  2BG8 A;  2P97 A;  4FEK A;  3DHC A;  3ADR A;  4UWP B;  5EVK A;  5ACT A;  3DH8 A;  5IQK A;  3KL7 A;  5K0W A;  4RBS A;  2M5D A;  4RL2 A;  4BZ3 A;  1VGN A;  4C1C A;  2NYP A;  3A4Y A;  3RPC A;  3X2Y A;  4YSK A;  3I0V A;  3T9M A;  4AWY B;  4NQ4 A;  2WRS A;  2M5C A;  1P9E A;  5FQA A;  1JJT A;  4F6H A;  5EW0 A;  2BMI A;  1K07 A;  5HH4 A;  3BK1 A;  4H0D A;  2I7V A;  2ZO4 A;  4J5H A;  4GYQ A;  4BP0 A;  2ZNB A;  2YNT A;  2Y8A A;  2R2D A;  2HB9 A;  3AF6 A;  5AHR A;  2P18 A;  4U4L A;  1E5D A;  3VPE A;  3ZNB A;  3FAI A;  4XUK A;  1DXK A;  2I7X A;  4HL1 A;  1Y44 A;  4AX1 B;  5ACX A;  5HH6 A;  2ZZI A;  3IOF A;  3L6N A;  3IE1 A;  2QJS A;  3BC2 A;  1KO2 A;  4EY2 A;  5A0V A;  1YCH A;  4TYF A;  4TZB A;  5KIK A;  4UBQ A;  3SBL A;  4J5F A;  5ACV A;  3DHB A;  1YCG A;  3QH8 A;  3I13 A;  3H3E A;  4DIL A;  4C1H A;  1WUP A;  2BFZ A;  2CBN A;  3IDZ A;  5LCF A;  1VJN A;  4EYB A;  2BTN A;  1L9Y A;  2E7Y A;  3ZWF A;  4UWS B;  2OHI A;  4JO0 A;  4D02 A;  2AIO A;  2Q42 A;  2Y8B A;  5AXO A;  2YNV B;  1A8T A;  4TYT A;  1ZTC A;  2WYM A;  4GYU A;  1XM8 A;  3PG4 A;  5FQC A;  5A0T A;  3Q6V A;  3SRX A;  2QDS A;  5HIP A;  5DPX A;  4EXS A;  4D1U A;  3KNR A;  5AEB A;  3S0Z A;  5LMC A;  4C09 A;  4XWW A;  5LM6 A;  5AYA A;  1XTO A;  4ZEJ A;  2GFK A;  5LS3 A;  1KR3 A;  2BGA A;  2BIB A;  2BR6 A;  4YSB A;  1VME A;  3G1P A;  2QED A;  5EVD A;  2Y87 A;  4NQ5 A;  4C1D A;  2FU7 A;  4D1V A;  2BFL A;  5HH5 A;  5LCH A;  2GFJ A;  2A7M A;  4EYL A;  3IOG A;  4Z6X A;  3IEL A;  2XF4 A;  2BG8 B;  2GMN A;  2OHJ A;  3IEM A;  4C1F A;  3SD9 A;  4DIK A;  3I14 A;  4AD9 A;  2FU6 A;  2I7T A;  1X8I A;  5FQB A;  4TZE A;  5K4N A;  1MQO A;  5HIS A;  4RL0 A;  4UWR B;  4D1T A;  3F9O A;  1ZKP A;  2NZF A;  4AWZ A;  3JXP A;  1BMC A;  3PY6 A;  3T3O A;  4Z7R A;  2BG2 A;  2XR1 A;  2BFK A;  2YNT B;  5ACW A;  3ESH A;  3BV6 A;  2DKF A;  2GCU A;  3I15 A;  3IE0 A;  2FHX A;  2YZ3 A;  5ACP A;  4C1E A;  3FCZ A;  4KEP A;  1WW1 A;  4NQ6 A;  5LLD A;  2Q0J A;  4O98 A;  4Z67 A;  1QH5 A;  5EH9 A;  2FU9 A;  3X2Z A;  4V0H A;  2P4Z A;  2UYX A;  4UAM A;  4HL2 A;  2BC2 A;  3ZR9 A;  5LCA A;  2WYL A;  5ACS A;  3MD7 A;  4TZ9 A;  3I11 A;  2P1E A;  1A7T A;  2NXA A;  1KO3 A;  2AZ4 A;  4LE6 A;  2BFZ B;  2QDT A;  1M2X A;  2DOO A;  1DDK A;  4UWO B;  4FSB A;  2ZWR A;  2WHG A;  4HKY A;  3PY5 A;  5B3R A;  2YNW A;  4RAM A;  5ACU A;  5K4M A;  5EHT A;  5EVB A;  1BVT A;  5LE1 A;  4AX0 B;  3T3N A;  3VQZ A;  4Z60 A;  4NQ2 A;  4F6Z A;  2OHH A;  2NZE A;  5KIL A;  3IEK A;  4UA4 A;  2BG7 A;  5AHO A;  4CHL A;  5A5Z A;  4GCW A;  4D1W A;  1QH3 A;  3WXC A;  4PVO A;  2FM6 A;  3SW3 A;  2GKL A;  2FK6 A;  3AJ3 A;  4EFZ A;  5EV8 A; 
#chains in the Genus database with same CATH topology
 3KNS A;  5ACQ A;  4Z5Z A;  5A23 A;  5K4K A;  4RAW A;  3TP9 A;  4ZO3 A;  5LSC A;  2YNU A;  4RM5 A;  4XWT A;  3BK2 A;  3P2U A;  2YCB A;  3X2X A;  1X8H A;  2QIN A;  4P62 A;  1WUO A;  2YNV A;  3RKJ A;  4YSL A;  3SFP A;  3X30 A;  4TZF A;  5B1U A;  1YCF A;  5EWA A;  2BG6 A;  1WRA A;  1JJE A;  5HIO A;  2H6A A;  2WYM C;  1X8G A;  5A87 A;  4KEQ A;  3IE2 A;  5ACR A;  4WD6 A;  2YHE A;  2Q9U A;  4AV7 A;  1JT1 A;  3AF5 A;  4EYF A;  2Q0I A;  3LVZ A;  1SML A;  5EV6 A;  5HIQ A;  1DD6 A;  4AXH A;  4Z5Y A;  4ZO2 A;  5AXR A;  4C1G A;  2VW8 A;  3DHA A;  3R2U A;  5B15 A;  4ZNB A;  4EXY A;  2FHX B;  4PVT A;  4FR7 A;  3SPU A;  3RKK A;  1BC2 A;  3ZQ4 A;  4B87 A;  2FU8 A;  1HLK A;  1ZNB A;  2BG8 A;  2P97 A;  4FEK A;  3DHC A;  3ADR A;  4UWP B;  5EVK A;  5ACT A;  3DH8 A;  5IQK A;  3KL7 A;  5K0W A;  4RBS A;  2M5D A;  4RL2 A;  4BZ3 A;  1VGN A;  4C1C A;  2NYP A;  3A4Y A;  3RPC A;  3X2Y A;  4YSK A;  3I0V A;  3T9M A;  4AWY B;  4NQ4 A;  2WRS A;  2M5C A;  1P9E A;  5FQA A;  1JJT A;  4F6H A;  5EW0 A;  2BMI A;  1K07 A;  5HH4 A;  3BK1 A;  4H0D A;  2I7V A;  2ZO4 A;  4J5H A;  4GYQ A;  4BP0 A;  2ZNB A;  2YNT A;  2Y8A A;  2R2D A;  2HB9 A;  3AF6 A;  5AHR A;  2P18 A;  4U4L A;  1E5D A;  3VPE A;  3ZNB A;  3FAI A;  4XUK A;  1DXK A;  2I7X A;  4HL1 A;  1Y44 A;  4AX1 B;  5ACX A;  5HH6 A;  2CFZ A;  2ZZI A;  3IOF A;  3L6N A;  3IE1 A;  2QJS A;  3BC2 A;  1KO2 A;  4EY2 A;  5A0V A;  1YCH A;  4TYF A;  4TZB A;  5KIK A;  4UBQ A;  3SBL A;  4J5F A;  5ACV A;  3DHB A;  1YCG A;  3QH8 A;  3I13 A;  3H3E A;  4DIL A;  4C1H A;  1WUP A;  2BFZ A;  2CBN A;  3IDZ A;  5LCF A;  1VJN A;  4EYB A;  2BTN A;  1L9Y A;  2E7Y A;  3ZWF A;  4UWS B;  2OHI A;  4JO0 A;  4D02 A;  2AIO A;  2CG2 A;  2Q42 A;  2Y8B A;  5AXO A;  2YNV B;  1A8T A;  4TYT A;  1ZTC A;  2WYM A;  4GYU A;  1XM8 A;  3PG4 A;  5FQC A;  5A0T A;  3Q6V A;  3SRX A;  2QDS A;  5HIP A;  5DPX A;  4EXS A;  4D1U A;  3KNR A;  5AEB A;  3S0Z A;  5LMC A;  4C09 A;  4XWW A;  5LM6 A;  5AYA A;  1XTO A;  4ZEJ A;  2GFK A;  5LS3 A;  1KR3 A;  2BGA A;  2BIB A;  2BR6 A;  4YSB A;  1VME A;  3G1P A;  2QED A;  5EVD A;  2Y87 A;  4NQ5 A;  4C1D A;  2FU7 A;  4PDX A;  4D1V A;  2BFL A;  5HH5 A;  5LCH A;  2GFJ A;  2A7M A;  4EYL A;  3IOG A;  4Z6X A;  3IEL A;  2XF4 A;  2BG8 B;  2GMN A;  2OHJ A;  3IEM A;  4C1F A;  3SD9 A;  4DIK A;  3I14 A;  4AD9 A;  2FU6 A;  2I7T A;  1X8I A;  5FQB A;  4TZE A;  5K4N A;  1MQO A;  5HIS A;  4RL0 A;  4UWR B;  4D1T A;  3F9O A;  1ZKP A;  2NZF A;  4AWZ A;  3JXP A;  1BMC A;  5AJL A;  3PY6 A;  3T3O A;  4Z7R A;  2BG2 A;  2XR1 A;  2BFK A;  2YNT B;  2CG3 A;  5ACW A;  3ESH A;  3BV6 A;  2DKF A;  2GCU A;  3I15 A;  3IE0 A;  2FHX A;  2YZ3 A;  5ACP A;  4C1E A;  3FCZ A;  4KEP A;  1WW1 A;  4NQ6 A;  5LLD A;  2Q0J A;  4O98 A;  4Z67 A;  1QH5 A;  5EH9 A;  2FU9 A;  3X2Z A;  4V0H A;  2P4Z A;  2UYX A;  4UAM A;  4HL2 A;  2BC2 A;  3ZR9 A;  5LCA A;  2WYL A;  5ACS A;  3MD7 A;  4TZ9 A;  3I11 A;  2P1E A;  1A7T A;  2NXA A;  1KO3 A;  2AZ4 A;  4LE6 A;  2BFZ B;  2QDT A;  1M2X A;  2DOO A;  1DDK A;  4UWO B;  4FSB A;  2ZWR A;  2WHG A;  2CFU A;  4HKY A;  3PY5 A;  5B3R A;  2YNW A;  4RAM A;  5ACU A;  5K4M A;  5EHT A;  5EVB A;  1BVT A;  5LE1 A;  4AX0 B;  3T3N A;  3VQZ A;  4Z60 A;  4NQ2 A;  4F6Z A;  2OHH A;  2NZE A;  5KIL A;  3IEK A;  4UA4 A;  2BG7 A;  5AHO A;  4CHL A;  4NUR A;  5A5Z A;  4GCW A;  5AIJ A;  4D1W A;  1QH3 A;  3WXC A;  4PVO A;  2FM6 A;  3SW3 A;  2GKL A;  2FK6 A;  3AJ3 A;  4EFZ A;  5EV8 A; 
#chains in the Genus database with same CATH homology
 3KNS A;  5ACQ A;  4Z5Z A;  5K4K A;  4RAW A;  3TP9 A;  4ZO3 A;  5LSC A;  2YNU A;  4RM5 A;  4XWT A;  3BK2 A;  3P2U A;  2YCB A;  3X2X A;  1X8H A;  2QIN A;  4P62 A;  1WUO A;  2YNV A;  3RKJ A;  4YSL A;  3SFP A;  3X30 A;  4TZF A;  5B1U A;  1YCF A;  5EWA A;  2BG6 A;  1WRA A;  1JJE A;  5HIO A;  2H6A A;  2WYM C;  1X8G A;  5A87 A;  4KEQ A;  3IE2 A;  5ACR A;  4WD6 A;  2Q9U A;  1JT1 A;  3AF5 A;  4EYF A;  2Q0I A;  3LVZ A;  1SML A;  5EV6 A;  5HIQ A;  1DD6 A;  4Z5Y A;  4ZO2 A;  5AXR A;  4C1G A;  2VW8 A;  3DHA A;  3R2U A;  5B15 A;  4ZNB A;  4EXY A;  2FHX B;  4PVT A;  4FR7 A;  3SPU A;  3RKK A;  1BC2 A;  3ZQ4 A;  4B87 A;  2FU8 A;  1HLK A;  1ZNB A;  2BG8 A;  2P97 A;  4FEK A;  3DHC A;  3ADR A;  4UWP B;  5EVK A;  5ACT A;  3DH8 A;  5IQK A;  3KL7 A;  5K0W A;  4RBS A;  2M5D A;  4RL2 A;  4BZ3 A;  1VGN A;  4C1C A;  2NYP A;  3A4Y A;  3RPC A;  3X2Y A;  4YSK A;  3I0V A;  3T9M A;  4AWY B;  4NQ4 A;  2WRS A;  2M5C A;  1P9E A;  5FQA A;  1JJT A;  4F6H A;  5EW0 A;  2BMI A;  1K07 A;  5HH4 A;  3BK1 A;  4H0D A;  2I7V A;  2ZO4 A;  4J5H A;  4GYQ A;  4BP0 A;  2ZNB A;  2YNT A;  2Y8A A;  2R2D A;  2HB9 A;  3AF6 A;  5AHR A;  2P18 A;  4U4L A;  1E5D A;  3VPE A;  3ZNB A;  3FAI A;  4XUK A;  1DXK A;  2I7X A;  4HL1 A;  1Y44 A;  4AX1 B;  5ACX A;  5HH6 A;  2ZZI A;  3IOF A;  3L6N A;  3IE1 A;  2QJS A;  3BC2 A;  1KO2 A;  4EY2 A;  5A0V A;  1YCH A;  4TYF A;  4TZB A;  5KIK A;  4UBQ A;  3SBL A;  4J5F A;  5ACV A;  3DHB A;  1YCG A;  3QH8 A;  3I13 A;  3H3E A;  4DIL A;  4C1H A;  1WUP A;  2BFZ A;  2CBN A;  3IDZ A;  5LCF A;  1VJN A;  4EYB A;  2BTN A;  1L9Y A;  2E7Y A;  3ZWF A;  4UWS B;  2OHI A;  4JO0 A;  4D02 A;  2AIO A;  2Q42 A;  2Y8B A;  5AXO A;  2YNV B;  1A8T A;  4TYT A;  1ZTC A;  2WYM A;  4GYU A;  1XM8 A;  3PG4 A;  5FQC A;  5A0T A;  3Q6V A;  3SRX A;  2QDS A;  5HIP A;  5DPX A;  4EXS A;  4D1U A;  3KNR A;  5AEB A;  3S0Z A;  5LMC A;  4C09 A;  4XWW A;  5LM6 A;  5AYA A;  1XTO A;  4ZEJ A;  2GFK A;  5LS3 A;  1KR3 A;  2BGA A;  2BIB A;  2BR6 A;  4YSB A;  1VME A;  3G1P A;  2QED A;  5EVD A;  2Y87 A;  4NQ5 A;  4C1D A;  2FU7 A;  4D1V A;  2BFL A;  5HH5 A;  5LCH A;  2GFJ A;  2A7M A;  4EYL A;  3IOG A;  4Z6X A;  3IEL A;  2XF4 A;  2BG8 B;  2GMN A;  2OHJ A;  3IEM A;  4C1F A;  3SD9 A;  4DIK A;  3I14 A;  4AD9 A;  2FU6 A;  2I7T A;  1X8I A;  5FQB A;  4TZE A;  5K4N A;  1MQO A;  5HIS A;  4RL0 A;  4UWR B;  4D1T A;  3F9O A;  1ZKP A;  2NZF A;  4AWZ A;  3JXP A;  1BMC A;  3PY6 A;  3T3O A;  4Z7R A;  2BG2 A;  2XR1 A;  2BFK A;  2YNT B;  5ACW A;  3ESH A;  3BV6 A;  2DKF A;  2GCU A;  3I15 A;  3IE0 A;  2FHX A;  2YZ3 A;  5ACP A;  4C1E A;  3FCZ A;  4KEP A;  1WW1 A;  4NQ6 A;  5LLD A;  2Q0J A;  4O98 A;  4Z67 A;  1QH5 A;  5EH9 A;  2FU9 A;  3X2Z A;  4V0H A;  2P4Z A;  2UYX A;  4UAM A;  4HL2 A;  2BC2 A;  3ZR9 A;  5LCA A;  2WYL A;  5ACS A;  3MD7 A;  4TZ9 A;  3I11 A;  2P1E A;  1A7T A;  2NXA A;  1KO3 A;  2AZ4 A;  4LE6 A;  2BFZ B;  2QDT A;  1M2X A;  2DOO A;  1DDK A;  4UWO B;  4FSB A;  2ZWR A;  2WHG A;  4HKY A;  3PY5 A;  5B3R A;  2YNW A;  4RAM A;  5ACU A;  5K4M A;  5EHT A;  5EVB A;  1BVT A;  5LE1 A;  4AX0 B;  3T3N A;  3VQZ A;  4Z60 A;  4NQ2 A;  4F6Z A;  2OHH A;  2NZE A;  5KIL A;  3IEK A;  4UA4 A;  2BG7 A;  5AHO A;  4CHL A;  5A5Z A;  4GCW A;  4D1W A;  1QH3 A;  3WXC A;  4PVO A;  2FM6 A;  3SW3 A;  2GKL A;  2FK6 A;  3AJ3 A;  4EFZ A;  5EV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...