3X2XA

Crystal structure of metallo-beta-lactamase h48a from thermotoga maritima
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTAGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of metallo-beta-lactamase H48A from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
total genus 64
structure length 227
sequence length 227
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x2xA00
4B87A 1BMCA 4TZFA 4BP0A 3H3EA 4TYTA 3X2XA 3FCZA 5AXOA 3RKKA 2Q0JA 3IOFA 2AZ4A 2M5CA 2Q0IA 4H0DA 2Y8BA 4F6HA 1X8IA 2DKFA 4C09A 4EXYA 3I15A 4WD6A 1KO3A 5K4MA 4AX0B 4ZEJA 2WYMA 5A0TA 2GKLA 4NQ6A 1ZTCA 3X2YA 3IE1A 2BFKA 5IQKA 2YNTB 2GCUA 3RPCA 2GFJA 4Z5YA 4UWOB 4RL2A 4NQ5A 2NXAA 2BFZB 4RL0A 2NYPA 2ZZIA 4BZ3A 4Z5ZA 2GFKA 1XM8A 3IE2A 1BC2A 5EV8A 3I0VA 3ZR9A 3KNSA 2HB9A 2Q9UA 2I7XA 5A5ZA 2XR1A 5HISA 3I11A 4Z67A 2GMNA 2FU6A 4Z7RA 5K4KA 1VMEA 3PY5A 4UBQA 4U4LA 5ACUA 2OHIA 3IELA 5B15A 4TZ9A 1A7TA 5ACVA 2YNVB 2BR6A 4RAWA 4C1CA 5ACRA 3VQZA 3T3OA 3AF5A 4HKYA 3L6NA 5EVBA 4UA4A 5LS3A 1WRAA 2QDSA 3G1PA 3R2UA 4TZBA 1ZNBA 4EFZA 5AYAA 1VGNA 4NQ4A 4D1VA 3F9OA 5ACPA 1L9YA 5LCFA 1XTOA 4KEPA 2H6AA 3FAIA 4CHLA 3TP9A 2ZWRA 4JO0A 5FQAA 1YCGA 5LMCA 4EYLA 4TYFA 5EV6A 2FU7A 2QINA 2NZEA 3MD7A 2YZ3A 4HL1A 5AHOA 5B1UA 5LCHA 5LSCA 4D1WA 4Z60A 3IOGA 4UWRB 4UWPB 3ZWFA 4O98A 3WXCA 5EHTA 2WRSA 2YNTA 4EYFA 1P9EA 4XWWA 3VPEA 3ZQ4A 5KILA 4TZEA 3T3NA 5HH4A 3DH8A 2A7MA 2BG6A 2Y87A 4DILA 2QDTA 4J5HA 1E5DA 2WYMC 4EXSA 2WHGA 2I7VA 2M5DA 4ZO2A 2FHXA 3SD9A 2BG8A 3BV6A 3ADRA 1K07A 2I7TA 3I13A 4YSKA 2WYLA 4ZNBA 1MQOA 3IE0A 3BK2A 4GYQA 1SMLA 3X2ZA 1DDKA 4NQ2A 2P97A 5ACWA 4EYBA 3ESHA 5AXRA 3SFPA 2FK6A 3S0ZA 2FM6A 2FU9A 2QEDA 4GYUA 4UAMA 2DOOA 5EW0A 1YCHA 2ZNBA 5A0VA 3JXPA 4AX1B 3T9MA 5ACSA 2FHXB 4GCWA 5ACTA 4PVOA 3RKJA 3KNRA 4XUKA 1QH5A 2BFLA 3IEMA 5B3RA 2BC2A 4AD9A 3DHAA 3SW3A 2P4ZA 3DHBA 4RM5A 4LE6A 5EVDA 2OHHA 3SRXA 5LCAA 3BK1A 5HIOA 4D1UA 3SBLA 3PY6A 1DXKA 3QH8A 5HIQA 1WUOA 4F6ZA 4C1DA 5K0WA 4YSLA 1X8GA 2BG2A 5EVKA 2BIBA 4DIKA 2BFZA 2YNVA 2YNUA 4YSBA 3P2UA 2R2DA 1DD6A 4D1TA 5AEBA 4RAMA 2BG7A 1JJTA 1WUPA 2Q42A 5LLDA 3IEKA 2AIOA 5A87A 5LM6A 3IDZA 1KR3A 2VW8A 2YCBA 4P62A 1HLKA 5HH6A 2BTNA 1ZKPA 4AWZA 4FEKA 5ACXA 5FQCA 3A4YA 5K4NA 4J5FA 4C1EA 5DPXA 1BVTA 5AHRA 2ZO4A 3KL7A 1Y44A 3BC2A 4XWTA 4UWSB 5EH9A 1M2XA 1A8TA 4EY2A 1QH3A 2BGAA 2CBNA 5HIPA 2YNWA 4RBSA 4PVTA 2BMIA 5ACQA 2QJSA 5EWAA 4AWYB 2FU8A 3ZNBA 5LE1A 1VJNA 5HH5A 2NZFA 3PG4A 5FQBA 3SPUA 1JT1A 1JJEA 4KEQA 3DHCA 4FSBA 2BG8B 1YCFA 3LVZA 4ZO3A 4Z6XA 3X30A 3AF6A 3I14A 2P18A 2Y8AA 4D02A 4C1GA 4C1FA 4C1HA 4V0HA 4HL2A 1KO2A 2XF4A 2OHJA 3Q6VA 2P1EA 1X8HA 5KIKA 2E7YA 4FR7A 2UYXA 3AJ3A 1WW1A
chains in the Genus database with same CATH superfamily
4B87A 1BMCA 4TZFA 4AXHA 4BP0A 3H3EA 4TYTA 3X2XA 3FCZA 5AXOA 3RKKA 2Q0JA 3IOFA 2AZ4A 2M5CA 2Q0IA 4H0DA 2Y8BA 4F6HA 1X8IA 2DKFA 4C09A 4EXYA 3I15A 4WD6A 1KO3A 5K4MA 4AX0B 4ZEJA 5AJLA 2WYMA 5A0TA 2GKLA 4NQ6A 2YHEA 1ZTCA 3X2YA 3IE1A 2BFKA 5IQKA 2YNTB 2GCUA 3RPCA 2GFJA 4Z5YA 4UWOB 4RL2A 4NQ5A 2NXAA 2BFZB 4RL0A 2NYPA 2ZZIA 4BZ3A 4Z5ZA 2GFKA 2CFUA 1XM8A 3IE2A 1BC2A 5EV8A 3I0VA 3ZR9A 3KNSA 2HB9A 2Q9UA 2I7XA 5A5ZA 2XR1A 5HISA 3I11A 4Z67A 2GMNA 2FU6A 4Z7RA 5K4KA 1VMEA 3PY5A 4UBQA 4U4LA 5ACUA 2OHIA 3IELA 5B15A 4TZ9A 1A7TA 5ACVA 2YNVB 2BR6A 4RAWA 4C1CA 5ACRA 3VQZA 3T3OA 3AF5A 4HKYA 3L6NA 5EVBA 4UA4A 5LS3A 1WRAA 2QDSA 3G1PA 3R2UA 4TZBA 1ZNBA 4EFZA 5AYAA 1VGNA 4NQ4A 2CG2A 4D1VA 3F9OA 5ACPA 1L9YA 5LCFA 1XTOA 4KEPA 2H6AA 3FAIA 4NURA 4CHLA 3TP9A 2ZWRA 4JO0A 5FQAA 1YCGA 5LMCA 4EYLA 4TYFA 5EV6A 2FU7A 2QINA 2CG3A 2NZEA 3MD7A 2YZ3A 4HL1A 5AHOA 5B1UA 5LCHA 5LSCA 4D1WA 4Z60A 3IOGA 4UWRB 4UWPB 3ZWFA 4O98A 3WXCA 5EHTA 2WRSA 2YNTA 4EYFA 1P9EA 4XWWA 4AV7A 3VPEA 3ZQ4A 5KILA 4TZEA 3T3NA 5HH4A 3DH8A 2A7MA 2BG6A 2Y87A 4DILA 2QDTA 4J5HA 1E5DA 2WYMC 4EXSA 2WHGA 2I7VA 2M5DA 4ZO2A 2FHXA 3SD9A 2BG8A 3BV6A 3ADRA 1K07A 4PDXA 2I7TA 3I13A 4YSKA 2WYLA 4ZNBA 1MQOA 3IE0A 3BK2A 4GYQA 1SMLA 3X2ZA 1DDKA 4NQ2A 2P97A 5ACWA 4EYBA 3ESHA 5AXRA 3SFPA 2FK6A 3S0ZA 2FM6A 2FU9A 2QEDA 4GYUA 4UAMA 2DOOA 5EW0A 1YCHA 2ZNBA 5A0VA 3JXPA 4AX1B 3T9MA 5ACSA 2FHXB 4GCWA 5ACTA 4PVOA 3RKJA 3KNRA 4XUKA 1QH5A 2BFLA 3IEMA 5B3RA 2BC2A 4AD9A 3DHAA 3SW3A 2P4ZA 3DHBA 4RM5A 4LE6A 5EVDA 2OHHA 3SRXA 5LCAA 3BK1A 5HIOA 4D1UA 3SBLA 3PY6A 1DXKA 3QH8A 5HIQA 1WUOA 4F6ZA 4C1DA 2CFZA 5K0WA 4YSLA 1X8GA 2BG2A 5EVKA 2BIBA 4DIKA 2BFZA 2YNVA 2YNUA 4YSBA 3P2UA 2R2DA 1DD6A 4D1TA 5A23A 5AEBA 4RAMA 2BG7A 1JJTA 1WUPA 2Q42A 5LLDA 3IEKA 2AIOA 5A87A 5LM6A 3IDZA 1KR3A 2VW8A 2YCBA 4P62A 1HLKA 5HH6A 2BTNA 1ZKPA 4AWZA 4FEKA 5ACXA 5FQCA 3A4YA 5K4NA 4J5FA 4C1EA 5DPXA 1BVTA 5AHRA 2ZO4A 3KL7A 1Y44A 3BC2A 4XWTA 4UWSB 5EH9A 1M2XA 5AIJA 1A8TA 4EY2A 1QH3A 2BGAA 2CBNA 5HIPA 2YNWA 4RBSA 4PVTA 2BMIA 5ACQA 2QJSA 5EWAA 4AWYB 2FU8A 3ZNBA 5LE1A 1VJNA 5HH5A 2NZFA 3PG4A 5FQBA 3SPUA 1JT1A 1JJEA 4KEQA 3DHCA 4FSBA 2BG8B 1YCFA 3LVZA 4ZO3A 4Z6XA 3X30A 3AF6A 3I14A 2P18A 2Y8AA 4D02A 4C1GA 4C1FA 4C1HA 4V0HA 4HL2A 1KO2A 2XF4A 2OHJA 3Q6VA 2P1EA 1X8HA 5KIKA 2E7YA 4FR7A 2UYXA 3AJ3A 1WW1A
chains in the Genus database with same CATH topology
4B87A 1BMCA 4TZFA 4BP0A 3H3EA 4TYTA 3X2XA 3FCZA 5AXOA 3RKKA 2Q0JA 3IOFA 2AZ4A 2M5CA 2Q0IA 4H0DA 2Y8BA 4F6HA 1X8IA 2DKFA 4C09A 4EXYA 3I15A 4WD6A 1KO3A 5K4MA 4AX0B 4ZEJA 2WYMA 5A0TA 2GKLA 4NQ6A 1ZTCA 3X2YA 3IE1A 2BFKA 5IQKA 2YNTB 2GCUA 3RPCA 2GFJA 4Z5YA 4UWOB 4RL2A 4NQ5A 2NXAA 2BFZB 4RL0A 2NYPA 2ZZIA 4BZ3A 4Z5ZA 2GFKA 1XM8A 3IE2A 1BC2A 5EV8A 3I0VA 3ZR9A 3KNSA 2HB9A 2Q9UA 2I7XA 5A5ZA 2XR1A 5HISA 3I11A 4Z67A 2GMNA 2FU6A 4Z7RA 5K4KA 1VMEA 3PY5A 4UBQA 4U4LA 5ACUA 2OHIA 3IELA 5B15A 4TZ9A 1A7TA 5ACVA 2YNVB 2BR6A 4RAWA 4C1CA 5ACRA 3VQZA 3T3OA 3AF5A 4HKYA 3L6NA 5EVBA 4UA4A 5LS3A 1WRAA 2QDSA 3G1PA 3R2UA 4TZBA 1ZNBA 4EFZA 5AYAA 1VGNA 4NQ4A 4D1VA 3F9OA 5ACPA 1L9YA 5LCFA 1XTOA 4KEPA 2H6AA 3FAIA 4CHLA 3TP9A 2ZWRA 4JO0A 5FQAA 1YCGA 5LMCA 4EYLA 4TYFA 5EV6A 2FU7A 2QINA 2NZEA 3MD7A 2YZ3A 4HL1A 5AHOA 5B1UA 5LCHA 5LSCA 4D1WA 4Z60A 3IOGA 4UWRB 4UWPB 3ZWFA 4O98A 3WXCA 5EHTA 2WRSA 2YNTA 4EYFA 1P9EA 4XWWA 3VPEA 3ZQ4A 5KILA 4TZEA 3T3NA 5HH4A 3DH8A 2A7MA 2BG6A 2Y87A 4DILA 2QDTA 4J5HA 1E5DA 2WYMC 4EXSA 2WHGA 2I7VA 2M5DA 4ZO2A 2FHXA 3SD9A 2BG8A 3BV6A 3ADRA 1K07A 2I7TA 3I13A 4YSKA 2WYLA 4ZNBA 1MQOA 3IE0A 3BK2A 4GYQA 1SMLA 3X2ZA 1DDKA 4NQ2A 2P97A 5ACWA 4EYBA 3ESHA 5AXRA 3SFPA 2FK6A 3S0ZA 2FM6A 2FU9A 2QEDA 4GYUA 4UAMA 2DOOA 5EW0A 1YCHA 2ZNBA 5A0VA 3JXPA 4AX1B 3T9MA 5ACSA 2FHXB 4GCWA 5ACTA 4PVOA 3RKJA 3KNRA 4XUKA 1QH5A 2BFLA 3IEMA 5B3RA 2BC2A 4AD9A 3DHAA 3SW3A 2P4ZA 3DHBA 4RM5A 4LE6A 5EVDA 2OHHA 3SRXA 5LCAA 3BK1A 5HIOA 4D1UA 3SBLA 3PY6A 1DXKA 3QH8A 5HIQA 1WUOA 4F6ZA 4C1DA 5K0WA 4YSLA 1X8GA 2BG2A 5EVKA 2BIBA 4DIKA 2BFZA 2YNVA 2YNUA 4YSBA 3P2UA 2R2DA 1DD6A 4D1TA 5AEBA 4RAMA 2BG7A 1JJTA 1WUPA 2Q42A 5LLDA 3IEKA 2AIOA 5A87A 5LM6A 3IDZA 1KR3A 2VW8A 2YCBA 4P62A 1HLKA 5HH6A 2BTNA 1ZKPA 4AWZA 4FEKA 5ACXA 5FQCA 3A4YA 5K4NA 4J5FA 4C1EA 5DPXA 1BVTA 5AHRA 2ZO4A 3KL7A 1Y44A 3BC2A 4XWTA 4UWSB 5EH9A 1M2XA 1A8TA 4EY2A 1QH3A 2BGAA 2CBNA 5HIPA 2YNWA 4RBSA 4PVTA 2BMIA 5ACQA 2QJSA 5EWAA 4AWYB 2FU8A 3ZNBA 5LE1A 1VJNA 5HH5A 2NZFA 3PG4A 5FQBA 3SPUA 1JT1A 1JJEA 4KEQA 3DHCA 4FSBA 2BG8B 1YCFA 3LVZA 4ZO3A 4Z6XA 3X30A 3AF6A 3I14A 2P18A 2Y8AA 4D02A 4C1GA 4C1FA 4C1HA 4V0HA 4HL2A 1KO2A 2XF4A 2OHJA 3Q6VA 2P1EA 1X8HA 5KIKA 2E7YA 4FR7A 2UYXA 3AJ3A 1WW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B87 A;  1BMC A;  4TZF A;  4BP0 A;  3H3E A;  4TYT A;  3X2X A;  3FCZ A;  5AXO A;  3RKK A;  2Q0J A;  3IOF A;  2AZ4 A;  2M5C A;  2Q0I A;  4H0D A;  2Y8B A;  4F6H A;  1X8I A;  2DKF A;  4C09 A;  4EXY A;  3I15 A;  4WD6 A;  1KO3 A;  5K4M A;  4AX0 B;  4ZEJ A;  2WYM A;  5A0T A;  2GKL A;  4NQ6 A;  1ZTC A;  3X2Y A;  3IE1 A;  2BFK A;  5IQK A;  2YNT B;  2GCU A;  3RPC A;  2GFJ A;  4Z5Y A;  4UWO B;  4RL2 A;  4NQ5 A;  2NXA A;  2BFZ B;  4RL0 A;  2NYP A;  2ZZI A;  4BZ3 A;  4Z5Z A;  2GFK A;  1XM8 A;  3IE2 A;  1BC2 A;  5EV8 A;  3I0V A;  3ZR9 A;  3KNS A;  2HB9 A;  2Q9U A;  2I7X A;  5A5Z A;  2XR1 A;  5HIS A;  3I11 A;  4Z67 A;  2GMN A;  2FU6 A;  4Z7R A;  5K4K A;  1VME A;  3PY5 A;  4UBQ A;  4U4L A;  5ACU A;  2OHI A;  3IEL A;  5B15 A;  4TZ9 A;  1A7T A;  5ACV A;  2YNV B;  2BR6 A;  4RAW A;  4C1C A;  5ACR A;  3VQZ A;  3T3O A;  3AF5 A;  4HKY A;  3L6N A;  5EVB A;  4UA4 A;  5LS3 A;  1WRA A;  2QDS A;  3G1P A;  3R2U A;  4TZB A;  1ZNB A;  4EFZ A;  5AYA A;  1VGN A;  4NQ4 A;  4D1V A;  3F9O A;  5ACP A;  1L9Y A;  5LCF A;  1XTO A;  4KEP A;  2H6A A;  3FAI A;  4CHL A;  3TP9 A;  2ZWR A;  4JO0 A;  5FQA A;  1YCG A;  5LMC A;  4EYL A;  4TYF A;  5EV6 A;  2FU7 A;  2QIN A;  2NZE A;  3MD7 A;  2YZ3 A;  4HL1 A;  5AHO A;  5B1U A;  5LCH A;  5LSC A;  4D1W A;  4Z60 A;  3IOG A;  4UWR B;  4UWP B;  3ZWF A;  4O98 A;  3WXC A;  5EHT A;  2WRS A;  2YNT A;  4EYF A;  1P9E A;  4XWW A;  3VPE A;  3ZQ4 A;  5KIL A;  4TZE A;  3T3N A;  5HH4 A;  3DH8 A;  2A7M A;  2BG6 A;  2Y87 A;  4DIL A;  2QDT A;  4J5H A;  1E5D A;  2WYM C;  4EXS A;  2WHG A;  2I7V A;  2M5D A;  4ZO2 A;  2FHX A;  3SD9 A;  2BG8 A;  3BV6 A;  3ADR A;  1K07 A;  2I7T A;  3I13 A;  4YSK A;  2WYL A;  4ZNB A;  1MQO A;  3IE0 A;  3BK2 A;  4GYQ A;  1SML A;  3X2Z A;  1DDK A;  4NQ2 A;  2P97 A;  5ACW A;  4EYB A;  3ESH A;  5AXR A;  3SFP A;  2FK6 A;  3S0Z A;  2FM6 A;  2FU9 A;  2QED A;  4GYU A;  4UAM A;  2DOO A;  5EW0 A;  1YCH A;  2ZNB A;  5A0V A;  3JXP A;  4AX1 B;  3T9M A;  5ACS A;  2FHX B;  4GCW A;  5ACT A;  4PVO A;  3RKJ A;  3KNR A;  4XUK A;  1QH5 A;  2BFL A;  3IEM A;  5B3R A;  2BC2 A;  4AD9 A;  3DHA A;  3SW3 A;  2P4Z A;  3DHB A;  4RM5 A;  4LE6 A;  5EVD A;  2OHH A;  3SRX A;  5LCA A;  3BK1 A;  5HIO A;  4D1U A;  3SBL A;  3PY6 A;  1DXK A;  3QH8 A;  5HIQ A;  1WUO A;  4F6Z A;  4C1D A;  5K0W A;  4YSL A;  1X8G A;  2BG2 A;  5EVK A;  2BIB A;  4DIK A;  2BFZ A;  2YNV A;  2YNU A;  4YSB A;  3P2U A;  2R2D A;  1DD6 A;  4D1T A;  5AEB A;  4RAM A;  2BG7 A;  1JJT A;  1WUP A;  2Q42 A;  5LLD A;  3IEK A;  2AIO A;  5A87 A;  5LM6 A;  3IDZ A;  1KR3 A;  2VW8 A;  2YCB A;  4P62 A;  1HLK A;  5HH6 A;  2BTN A;  1ZKP A;  4AWZ A;  4FEK A;  5ACX A;  5FQC A;  3A4Y A;  5K4N A;  4J5F A;  4C1E A;  5DPX A;  1BVT A;  5AHR A;  2ZO4 A;  3KL7 A;  1Y44 A;  3BC2 A;  4XWT A;  4UWS B;  5EH9 A;  1M2X A;  1A8T A;  4EY2 A;  1QH3 A;  2BGA A;  2CBN A;  5HIP A;  2YNW A;  4RBS A;  4PVT A;  2BMI A;  5ACQ A;  2QJS A;  5EWA A;  4AWY B;  2FU8 A;  3ZNB A;  5LE1 A;  1VJN A;  5HH5 A;  2NZF A;  3PG4 A;  5FQB A;  3SPU A;  1JT1 A;  1JJE A;  4KEQ A;  3DHC A;  4FSB A;  2BG8 B;  1YCF A;  3LVZ A;  4ZO3 A;  4Z6X A;  3X30 A;  3AF6 A;  3I14 A;  2P18 A;  2Y8A A;  4D02 A;  4C1G A;  4C1F A;  4C1H A;  4V0H A;  4HL2 A;  1KO2 A;  2XF4 A;  2OHJ A;  3Q6V A;  2P1E A;  1X8H A;  5KIK A;  2E7Y A;  4FR7 A;  2UYX A;  3AJ3 A;  1WW1 A; 
#chains in the Genus database with same CATH topology
 4B87 A;  1BMC A;  4TZF A;  4AXH A;  4BP0 A;  3H3E A;  4TYT A;  3X2X A;  3FCZ A;  5AXO A;  3RKK A;  2Q0J A;  3IOF A;  2AZ4 A;  2M5C A;  2Q0I A;  4H0D A;  2Y8B A;  4F6H A;  1X8I A;  2DKF A;  4C09 A;  4EXY A;  3I15 A;  4WD6 A;  1KO3 A;  5K4M A;  4AX0 B;  4ZEJ A;  5AJL A;  2WYM A;  5A0T A;  2GKL A;  4NQ6 A;  2YHE A;  1ZTC A;  3X2Y A;  3IE1 A;  2BFK A;  5IQK A;  2YNT B;  2GCU A;  3RPC A;  2GFJ A;  4Z5Y A;  4UWO B;  4RL2 A;  4NQ5 A;  2NXA A;  2BFZ B;  4RL0 A;  2NYP A;  2ZZI A;  4BZ3 A;  4Z5Z A;  2GFK A;  2CFU A;  1XM8 A;  3IE2 A;  1BC2 A;  5EV8 A;  3I0V A;  3ZR9 A;  3KNS A;  2HB9 A;  2Q9U A;  2I7X A;  5A5Z A;  2XR1 A;  5HIS A;  3I11 A;  4Z67 A;  2GMN A;  2FU6 A;  4Z7R A;  5K4K A;  1VME A;  3PY5 A;  4UBQ A;  4U4L A;  5ACU A;  2OHI A;  3IEL A;  5B15 A;  4TZ9 A;  1A7T A;  5ACV A;  2YNV B;  2BR6 A;  4RAW A;  4C1C A;  5ACR A;  3VQZ A;  3T3O A;  3AF5 A;  4HKY A;  3L6N A;  5EVB A;  4UA4 A;  5LS3 A;  1WRA A;  2QDS A;  3G1P A;  3R2U A;  4TZB A;  1ZNB A;  4EFZ A;  5AYA A;  1VGN A;  4NQ4 A;  2CG2 A;  4D1V A;  3F9O A;  5ACP A;  1L9Y A;  5LCF A;  1XTO A;  4KEP A;  2H6A A;  3FAI A;  4NUR A;  4CHL A;  3TP9 A;  2ZWR A;  4JO0 A;  5FQA A;  1YCG A;  5LMC A;  4EYL A;  4TYF A;  5EV6 A;  2FU7 A;  2QIN A;  2CG3 A;  2NZE A;  3MD7 A;  2YZ3 A;  4HL1 A;  5AHO A;  5B1U A;  5LCH A;  5LSC A;  4D1W A;  4Z60 A;  3IOG A;  4UWR B;  4UWP B;  3ZWF A;  4O98 A;  3WXC A;  5EHT A;  2WRS A;  2YNT A;  4EYF A;  1P9E A;  4XWW A;  4AV7 A;  3VPE A;  3ZQ4 A;  5KIL A;  4TZE A;  3T3N A;  5HH4 A;  3DH8 A;  2A7M A;  2BG6 A;  2Y87 A;  4DIL A;  2QDT A;  4J5H A;  1E5D A;  2WYM C;  4EXS A;  2WHG A;  2I7V A;  2M5D A;  4ZO2 A;  2FHX A;  3SD9 A;  2BG8 A;  3BV6 A;  3ADR A;  1K07 A;  4PDX A;  2I7T A;  3I13 A;  4YSK A;  2WYL A;  4ZNB A;  1MQO A;  3IE0 A;  3BK2 A;  4GYQ A;  1SML A;  3X2Z A;  1DDK A;  4NQ2 A;  2P97 A;  5ACW A;  4EYB A;  3ESH A;  5AXR A;  3SFP A;  2FK6 A;  3S0Z A;  2FM6 A;  2FU9 A;  2QED A;  4GYU A;  4UAM A;  2DOO A;  5EW0 A;  1YCH A;  2ZNB A;  5A0V A;  3JXP A;  4AX1 B;  3T9M A;  5ACS A;  2FHX B;  4GCW A;  5ACT A;  4PVO A;  3RKJ A;  3KNR A;  4XUK A;  1QH5 A;  2BFL A;  3IEM A;  5B3R A;  2BC2 A;  4AD9 A;  3DHA A;  3SW3 A;  2P4Z A;  3DHB A;  4RM5 A;  4LE6 A;  5EVD A;  2OHH A;  3SRX A;  5LCA A;  3BK1 A;  5HIO A;  4D1U A;  3SBL A;  3PY6 A;  1DXK A;  3QH8 A;  5HIQ A;  1WUO A;  4F6Z A;  4C1D A;  2CFZ A;  5K0W A;  4YSL A;  1X8G A;  2BG2 A;  5EVK A;  2BIB A;  4DIK A;  2BFZ A;  2YNV A;  2YNU A;  4YSB A;  3P2U A;  2R2D A;  1DD6 A;  4D1T A;  5A23 A;  5AEB A;  4RAM A;  2BG7 A;  1JJT A;  1WUP A;  2Q42 A;  5LLD A;  3IEK A;  2AIO A;  5A87 A;  5LM6 A;  3IDZ A;  1KR3 A;  2VW8 A;  2YCB A;  4P62 A;  1HLK A;  5HH6 A;  2BTN A;  1ZKP A;  4AWZ A;  4FEK A;  5ACX A;  5FQC A;  3A4Y A;  5K4N A;  4J5F A;  4C1E A;  5DPX A;  1BVT A;  5AHR A;  2ZO4 A;  3KL7 A;  1Y44 A;  3BC2 A;  4XWT A;  4UWS B;  5EH9 A;  1M2X A;  5AIJ A;  1A8T A;  4EY2 A;  1QH3 A;  2BGA A;  2CBN A;  5HIP A;  2YNW A;  4RBS A;  4PVT A;  2BMI A;  5ACQ A;  2QJS A;  5EWA A;  4AWY B;  2FU8 A;  3ZNB A;  5LE1 A;  1VJN A;  5HH5 A;  2NZF A;  3PG4 A;  5FQB A;  3SPU A;  1JT1 A;  1JJE A;  4KEQ A;  3DHC A;  4FSB A;  2BG8 B;  1YCF A;  3LVZ A;  4ZO3 A;  4Z6X A;  3X30 A;  3AF6 A;  3I14 A;  2P18 A;  2Y8A A;  4D02 A;  4C1G A;  4C1F A;  4C1H A;  4V0H A;  4HL2 A;  1KO2 A;  2XF4 A;  2OHJ A;  3Q6V A;  2P1E A;  1X8H A;  5KIK A;  2E7Y A;  4FR7 A;  2UYX A;  3AJ3 A;  1WW1 A; 
#chains in the Genus database with same CATH homology
 4B87 A;  1BMC A;  4TZF A;  4BP0 A;  3H3E A;  4TYT A;  3X2X A;  3FCZ A;  5AXO A;  3RKK A;  2Q0J A;  3IOF A;  2AZ4 A;  2M5C A;  2Q0I A;  4H0D A;  2Y8B A;  4F6H A;  1X8I A;  2DKF A;  4C09 A;  4EXY A;  3I15 A;  4WD6 A;  1KO3 A;  5K4M A;  4AX0 B;  4ZEJ A;  2WYM A;  5A0T A;  2GKL A;  4NQ6 A;  1ZTC A;  3X2Y A;  3IE1 A;  2BFK A;  5IQK A;  2YNT B;  2GCU A;  3RPC A;  2GFJ A;  4Z5Y A;  4UWO B;  4RL2 A;  4NQ5 A;  2NXA A;  2BFZ B;  4RL0 A;  2NYP A;  2ZZI A;  4BZ3 A;  4Z5Z A;  2GFK A;  1XM8 A;  3IE2 A;  1BC2 A;  5EV8 A;  3I0V A;  3ZR9 A;  3KNS A;  2HB9 A;  2Q9U A;  2I7X A;  5A5Z A;  2XR1 A;  5HIS A;  3I11 A;  4Z67 A;  2GMN A;  2FU6 A;  4Z7R A;  5K4K A;  1VME A;  3PY5 A;  4UBQ A;  4U4L A;  5ACU A;  2OHI A;  3IEL A;  5B15 A;  4TZ9 A;  1A7T A;  5ACV A;  2YNV B;  2BR6 A;  4RAW A;  4C1C A;  5ACR A;  3VQZ A;  3T3O A;  3AF5 A;  4HKY A;  3L6N A;  5EVB A;  4UA4 A;  5LS3 A;  1WRA A;  2QDS A;  3G1P A;  3R2U A;  4TZB A;  1ZNB A;  4EFZ A;  5AYA A;  1VGN A;  4NQ4 A;  4D1V A;  3F9O A;  5ACP A;  1L9Y A;  5LCF A;  1XTO A;  4KEP A;  2H6A A;  3FAI A;  4CHL A;  3TP9 A;  2ZWR A;  4JO0 A;  5FQA A;  1YCG A;  5LMC A;  4EYL A;  4TYF A;  5EV6 A;  2FU7 A;  2QIN A;  2NZE A;  3MD7 A;  2YZ3 A;  4HL1 A;  5AHO A;  5B1U A;  5LCH A;  5LSC A;  4D1W A;  4Z60 A;  3IOG A;  4UWR B;  4UWP B;  3ZWF A;  4O98 A;  3WXC A;  5EHT A;  2WRS A;  2YNT A;  4EYF A;  1P9E A;  4XWW A;  3VPE A;  3ZQ4 A;  5KIL A;  4TZE A;  3T3N A;  5HH4 A;  3DH8 A;  2A7M A;  2BG6 A;  2Y87 A;  4DIL A;  2QDT A;  4J5H A;  1E5D A;  2WYM C;  4EXS A;  2WHG A;  2I7V A;  2M5D A;  4ZO2 A;  2FHX A;  3SD9 A;  2BG8 A;  3BV6 A;  3ADR A;  1K07 A;  2I7T A;  3I13 A;  4YSK A;  2WYL A;  4ZNB A;  1MQO A;  3IE0 A;  3BK2 A;  4GYQ A;  1SML A;  3X2Z A;  1DDK A;  4NQ2 A;  2P97 A;  5ACW A;  4EYB A;  3ESH A;  5AXR A;  3SFP A;  2FK6 A;  3S0Z A;  2FM6 A;  2FU9 A;  2QED A;  4GYU A;  4UAM A;  2DOO A;  5EW0 A;  1YCH A;  2ZNB A;  5A0V A;  3JXP A;  4AX1 B;  3T9M A;  5ACS A;  2FHX B;  4GCW A;  5ACT A;  4PVO A;  3RKJ A;  3KNR A;  4XUK A;  1QH5 A;  2BFL A;  3IEM A;  5B3R A;  2BC2 A;  4AD9 A;  3DHA A;  3SW3 A;  2P4Z A;  3DHB A;  4RM5 A;  4LE6 A;  5EVD A;  2OHH A;  3SRX A;  5LCA A;  3BK1 A;  5HIO A;  4D1U A;  3SBL A;  3PY6 A;  1DXK A;  3QH8 A;  5HIQ A;  1WUO A;  4F6Z A;  4C1D A;  5K0W A;  4YSL A;  1X8G A;  2BG2 A;  5EVK A;  2BIB A;  4DIK A;  2BFZ A;  2YNV A;  2YNU A;  4YSB A;  3P2U A;  2R2D A;  1DD6 A;  4D1T A;  5AEB A;  4RAM A;  2BG7 A;  1JJT A;  1WUP A;  2Q42 A;  5LLD A;  3IEK A;  2AIO A;  5A87 A;  5LM6 A;  3IDZ A;  1KR3 A;  2VW8 A;  2YCB A;  4P62 A;  1HLK A;  5HH6 A;  2BTN A;  1ZKP A;  4AWZ A;  4FEK A;  5ACX A;  5FQC A;  3A4Y A;  5K4N A;  4J5F A;  4C1E A;  5DPX A;  1BVT A;  5AHR A;  2ZO4 A;  3KL7 A;  1Y44 A;  3BC2 A;  4XWT A;  4UWS B;  5EH9 A;  1M2X A;  1A8T A;  4EY2 A;  1QH3 A;  2BGA A;  2CBN A;  5HIP A;  2YNW A;  4RBS A;  4PVT A;  2BMI A;  5ACQ A;  2QJS A;  5EWA A;  4AWY B;  2FU8 A;  3ZNB A;  5LE1 A;  1VJN A;  5HH5 A;  2NZF A;  3PG4 A;  5FQB A;  3SPU A;  1JT1 A;  1JJE A;  4KEQ A;  3DHC A;  4FSB A;  2BG8 B;  1YCF A;  3LVZ A;  4ZO3 A;  4Z6X A;  3X30 A;  3AF6 A;  3I14 A;  2P18 A;  2Y8A A;  4D02 A;  4C1G A;  4C1F A;  4C1H A;  4V0H A;  4HL2 A;  1KO2 A;  2XF4 A;  2OHJ A;  3Q6V A;  2P1E A;  1X8H A;  5KIK A;  2E7Y A;  4FR7 A;  2UYX A;  3AJ3 A;  1WW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...