2P1EA

Crystal structure of the leishmania infantum glyoxalase ii with d-lactate at the active site
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
279
Chain Sequence
MRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLTYTFSTILSTHKHWDHSGGNAKLKAELVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalysis and Structural Properties of Leishmania infantum Glyoxalase II: Trypanothione Specificity and Phylogeny.
pubmed doi rcsb
source organism Leishmania infantum
molecule tags Hydrolase
molecule keywords Glyoxalase II
total genus 100
structure length 279
sequence length 293
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2p1eA00
4AWYB 4J5HA 5HISA 2YNWA 2P97A 3I11A 5A0TA 4C1HA 4O98A 5FQBA 2A7MA 5LCAA 5KILA 1BMCA 2FU7A 5HH4A 4UWRB 5KIKA 4EFZA 1VMEA 3H3EA 5EW0A 4HKYA 1X8GA 4PVOA 5ACVA 5K0WA 4RL2A 2GCUA 3DHCA 3MD7A 3VQZA 5LE1A 3I13A 3DHBA 5A0VA 1SMLA 3X2YA 2I7TA 4XWWA 5LCFA 1DDKA 3IE1A 4EYBA 5AXRA 2QJSA 3RKJA 3X30A 2P18A 5AHOA 2XR1A 4FSBA 2BGAA 3I0VA 2Y8BA 3SD9A 2ZZIA 2BC2A 4NQ5A 2GFJA 3ZR9A 4UBQA 1P9EA 2DOOA 4V0HA 4YSBA 3BC2A 5LCHA 2R2DA 4EYLA 4FEKA 3A4YA 1YCGA 2WHGA 5EV6A 1DD6A 2YNTA 2AZ4A 2BG6A 1MQOA 3SRXA 4XWTA 2BG2A 2BG7A 1QH3A 2ZWRA 1ZKPA 5A87A 5ACTA 5HIPA 3PG4A 4J5FA 1KR3A 3T9MA 2VW8A 4EY2A 4CHLA 4YSLA 1JJTA 4GCWA 5LM6A 3ADRA 3TP9A 4NQ2A 3VPEA 3SPUA 4D1UA 2ZNBA 5ACRA 1VJNA 5EH9A 2WYMA 1WUOA 2AIOA 3IDZA 3JXPA 3DHAA 2Q0IA 1YCHA 4BP0A 5AHRA 2E7YA 2YNTB 2Q9UA 2BG8B 4BZ3A 2FU9A 2Q42A 4P62A 4NQ6A 4TZBA 1M2XA 5B3RA 1WW1A 2GFKA 3L6NA 2QDSA 4TZ9A 4TYTA 5EVKA 5EWAA 2BFLA 2WRSA 5AEBA 3R2UA 3DH8A 4AD9A 4RAMA 2FK6A 2QEDA 4D1VA 1K07A 2P1EA 5FQCA 1X8IA 5ACXA 3KL7A 5K4MA 3AF5A 4Z6XA 4YSKA 4FR7A 2NZEA 4C1CA 4RAWA 2UYXA 2BR6A 2OHJA 1Y44A 2BFKA 5IQKA 2GKLA 2I7XA 4H0DA 4HL2A 2FHXB 2WYMC 3IE2A 4RM5A 4DIKA 4NQ4A 2YNVA 5ACUA 2HB9A 3IOGA 3ZQ4A 3WXCA 2YCBA 4ZNBA 3AF6A 4Z5YA 2QDTA 4ZEJA 1E5DA 2P4ZA 2H6AA 4LE6A 4F6ZA 2Y87A 2Y8AA 3SBLA 4C09A 4GYUA 4RBSA 2XF4A 2BFZB 4EXSA 1A7TA 4TZFA 4PVTA 4KEPA 5EVBA 2DKFA 5EHTA 4GYQA 4C1FA 2Q0JA 3X2XA 5LLDA 1DXKA 3KNRA 1HLKA 5HH5A 1VGNA 4XUKA 5LMCA 1KO3A 1L9YA 2FM6A 1BVTA 4HL1A 2YNVB 2NXAA 3I15A 4F6HA 4UWPB 3P2UA 5B15A 1JJEA 3I14A 4WD6A 4C1DA 2FHXA 1XTOA 2FU6A 3LVZA 5AXOA 5ACSA 3G1PA 4Z5ZA 4EYFA 5AYAA 5K4KA 1BC2A 3BV6A 3BK1A 5EVDA 2GMNA 4ZO3A 4UWSB 1YCFA 5HIQA 2CBNA 4D02A 4Z60A 2BFZA 2OHHA 3SW3A 5LSCA 2NZFA 3T3OA 2BTNA 3IEMA 1KO2A 3T3NA 3Q6VA 4Z67A 2BMIA 3ZWFA 5ACWA 3RKKA 4TZEA 2OHIA 4ZO2A 4C1GA 3F9OA 3RPCA 5DPXA 1WUPA 5ACQA 2YZ3A 4TYFA 4UA4A 3PY6A 4DILA 3PY5A 3FAIA 3IOFA 3IELA 3S0ZA 2BG8A 4UAMA 2FU8A 1WRAA 2YNUA 1X8HA 5A5ZA 4EXYA 2I7VA 4C1EA 3IEKA 3KNSA 4AX1B 1ZTCA 4RL0A 1XM8A 2QINA 4D1TA 3FCZA 3SFPA 5ACPA 4JO0A 5LS3A 4UWOB 3X2ZA 2NYPA 5FQAA 4KEQA 4AX0B 1QH5A 3QH8A 5B1UA 2ZO4A 3IE0A 3ESHA 1ZNBA 3ZNBA 3BK2A 1JT1A 4Z7RA 4AWZA 3AJ3A 5K4NA 5HIOA 4U4LA 4D1WA 5HH6A 1A8TA 2M5DA 2M5CA 2WYLA 4B87A 2BIBA 5EV8A
chains in the Genus database with same CATH superfamily
4AWYB 4J5HA 5HISA 2YNWA 2P97A 3I11A 5A0TA 4C1HA 4O98A 5FQBA 2A7MA 5LCAA 5KILA 1BMCA 2FU7A 5HH4A 4UWRB 5KIKA 4EFZA 1VMEA 3H3EA 5EW0A 4HKYA 1X8GA 4PVOA 5ACVA 5K0WA 4RL2A 2GCUA 3DHCA 3MD7A 3VQZA 5LE1A 3I13A 3DHBA 5A0VA 1SMLA 3X2YA 2I7TA 4XWWA 5LCFA 1DDKA 3IE1A 4EYBA 5AXRA 2QJSA 3RKJA 3X30A 2P18A 5AHOA 2XR1A 4FSBA 2BGAA 3I0VA 2Y8BA 3SD9A 2ZZIA 4NURA 2BC2A 4NQ5A 2GFJA 3ZR9A 4UBQA 1P9EA 2DOOA 4V0HA 4YSBA 3BC2A 5LCHA 2R2DA 4EYLA 4FEKA 3A4YA 1YCGA 2CG3A 2WHGA 5EV6A 1DD6A 2YNTA 2AZ4A 2BG6A 1MQOA 3SRXA 4XWTA 2BG2A 2BG7A 1QH3A 2CFZA 2ZWRA 1ZKPA 5A87A 5ACTA 5HIPA 3PG4A 4J5FA 1KR3A 3T9MA 2VW8A 4EY2A 4CHLA 4YSLA 1JJTA 4GCWA 5LM6A 3ADRA 3TP9A 4NQ2A 3VPEA 3SPUA 4D1UA 2ZNBA 5ACRA 1VJNA 5EH9A 2WYMA 1WUOA 2AIOA 3IDZA 3JXPA 3DHAA 2Q0IA 1YCHA 4BP0A 5AHRA 2YHEA 2E7YA 2YNTB 2Q9UA 2BG8B 4BZ3A 2FU9A 2Q42A 4P62A 4NQ6A 4TZBA 1M2XA 5B3RA 1WW1A 2GFKA 3L6NA 2QDSA 4TZ9A 4TYTA 5EVKA 5EWAA 2BFLA 2WRSA 5AEBA 3R2UA 3DH8A 4AD9A 4RAMA 2FK6A 2QEDA 4D1VA 1K07A 2P1EA 5FQCA 1X8IA 5ACXA 3KL7A 5K4MA 3AF5A 4Z6XA 4YSKA 4FR7A 2NZEA 4C1CA 4RAWA 2UYXA 2BR6A 2OHJA 1Y44A 2BFKA 5IQKA 2GKLA 2I7XA 4H0DA 4HL2A 2FHXB 2WYMC 3IE2A 4RM5A 4DIKA 4NQ4A 2YNVA 4PDXA 5ACUA 2HB9A 3IOGA 3ZQ4A 3WXCA 2YCBA 4ZNBA 3AF6A 4Z5YA 2QDTA 5AJLA 4ZEJA 1E5DA 2P4ZA 2H6AA 4LE6A 4F6ZA 2Y87A 2Y8AA 3SBLA 4C09A 4GYUA 4RBSA 2XF4A 5A23A 2BFZB 4EXSA 1A7TA 4TZFA 4PVTA 4KEPA 5EVBA 2DKFA 5EHTA 4GYQA 4C1FA 2Q0JA 3X2XA 5LLDA 1DXKA 3KNRA 1HLKA 5HH5A 1VGNA 4XUKA 5LMCA 1KO3A 1L9YA 2FM6A 1BVTA 4HL1A 2YNVB 2NXAA 3I15A 4F6HA 4UWPB 3P2UA 5B15A 1JJEA 3I14A 4WD6A 4C1DA 2FHXA 1XTOA 2FU6A 3LVZA 5AXOA 5ACSA 3G1PA 4Z5ZA 4EYFA 5AYAA 5K4KA 1BC2A 3BV6A 3BK1A 5EVDA 2GMNA 4ZO3A 4UWSB 1YCFA 5HIQA 2CBNA 4D02A 4Z60A 2BFZA 2OHHA 3SW3A 5LSCA 2NZFA 3T3OA 2BTNA 3IEMA 1KO2A 3T3NA 3Q6VA 4Z67A 2BMIA 3ZWFA 5ACWA 3RKKA 4TZEA 2OHIA 4ZO2A 4AXHA 4C1GA 3F9OA 3RPCA 5DPXA 1WUPA 5ACQA 2YZ3A 4TYFA 4UA4A 3PY6A 4DILA 2CG2A 3PY5A 3FAIA 3IOFA 3IELA 3S0ZA 2BG8A 4UAMA 2FU8A 1WRAA 2YNUA 1X8HA 5A5ZA 4AV7A 4EXYA 2CFUA 2I7VA 4C1EA 3IEKA 3KNSA 5AIJA 4AX1B 1ZTCA 4RL0A 1XM8A 2QINA 4D1TA 3FCZA 3SFPA 5ACPA 4JO0A 5LS3A 4UWOB 3X2ZA 2NYPA 5FQAA 4KEQA 4AX0B 1QH5A 3QH8A 5B1UA 2ZO4A 3IE0A 3ESHA 1ZNBA 3ZNBA 3BK2A 1JT1A 4Z7RA 4AWZA 3AJ3A 5K4NA 5HIOA 4U4LA 4D1WA 5HH6A 1A8TA 2M5DA 2M5CA 2WYLA 4B87A 2BIBA 5EV8A
chains in the Genus database with same CATH topology
4AWYB 4J5HA 5HISA 2YNWA 2P97A 3I11A 5A0TA 4C1HA 4O98A 5FQBA 2A7MA 5LCAA 5KILA 1BMCA 2FU7A 5HH4A 4UWRB 5KIKA 4EFZA 1VMEA 3H3EA 5EW0A 4HKYA 1X8GA 4PVOA 5ACVA 5K0WA 4RL2A 2GCUA 3DHCA 3MD7A 3VQZA 5LE1A 3I13A 3DHBA 5A0VA 1SMLA 3X2YA 2I7TA 4XWWA 5LCFA 1DDKA 3IE1A 4EYBA 5AXRA 2QJSA 3RKJA 3X30A 2P18A 5AHOA 2XR1A 4FSBA 2BGAA 3I0VA 2Y8BA 3SD9A 2ZZIA 2BC2A 4NQ5A 2GFJA 3ZR9A 4UBQA 1P9EA 2DOOA 4V0HA 4YSBA 3BC2A 5LCHA 2R2DA 4EYLA 4FEKA 3A4YA 1YCGA 2WHGA 5EV6A 1DD6A 2YNTA 2AZ4A 2BG6A 1MQOA 3SRXA 4XWTA 2BG2A 2BG7A 1QH3A 2ZWRA 1ZKPA 5A87A 5ACTA 5HIPA 3PG4A 4J5FA 1KR3A 3T9MA 2VW8A 4EY2A 4CHLA 4YSLA 1JJTA 4GCWA 5LM6A 3ADRA 3TP9A 4NQ2A 3VPEA 3SPUA 4D1UA 2ZNBA 5ACRA 1VJNA 5EH9A 2WYMA 1WUOA 2AIOA 3IDZA 3JXPA 3DHAA 2Q0IA 1YCHA 4BP0A 5AHRA 2E7YA 2YNTB 2Q9UA 2BG8B 4BZ3A 2FU9A 2Q42A 4P62A 4NQ6A 4TZBA 1M2XA 5B3RA 1WW1A 2GFKA 3L6NA 2QDSA 4TZ9A 4TYTA 5EVKA 5EWAA 2BFLA 2WRSA 5AEBA 3R2UA 3DH8A 4AD9A 4RAMA 2FK6A 2QEDA 4D1VA 1K07A 2P1EA 5FQCA 1X8IA 5ACXA 3KL7A 5K4MA 3AF5A 4Z6XA 4YSKA 4FR7A 2NZEA 4C1CA 4RAWA 2UYXA 2BR6A 2OHJA 1Y44A 2BFKA 5IQKA 2GKLA 2I7XA 4H0DA 4HL2A 2FHXB 2WYMC 3IE2A 4RM5A 4DIKA 4NQ4A 2YNVA 5ACUA 2HB9A 3IOGA 3ZQ4A 3WXCA 2YCBA 4ZNBA 3AF6A 4Z5YA 2QDTA 4ZEJA 1E5DA 2P4ZA 2H6AA 4LE6A 4F6ZA 2Y87A 2Y8AA 3SBLA 4C09A 4GYUA 4RBSA 2XF4A 2BFZB 4EXSA 1A7TA 4TZFA 4PVTA 4KEPA 5EVBA 2DKFA 5EHTA 4GYQA 4C1FA 2Q0JA 3X2XA 5LLDA 1DXKA 3KNRA 1HLKA 5HH5A 1VGNA 4XUKA 5LMCA 1KO3A 1L9YA 2FM6A 1BVTA 4HL1A 2YNVB 2NXAA 3I15A 4F6HA 4UWPB 3P2UA 5B15A 1JJEA 3I14A 4WD6A 4C1DA 2FHXA 1XTOA 2FU6A 3LVZA 5AXOA 5ACSA 3G1PA 4Z5ZA 4EYFA 5AYAA 5K4KA 1BC2A 3BV6A 3BK1A 5EVDA 2GMNA 4ZO3A 4UWSB 1YCFA 5HIQA 2CBNA 4D02A 4Z60A 2BFZA 2OHHA 3SW3A 5LSCA 2NZFA 3T3OA 2BTNA 3IEMA 1KO2A 3T3NA 3Q6VA 4Z67A 2BMIA 3ZWFA 5ACWA 3RKKA 4TZEA 2OHIA 4ZO2A 4C1GA 3F9OA 3RPCA 5DPXA 1WUPA 5ACQA 2YZ3A 4TYFA 4UA4A 3PY6A 4DILA 3PY5A 3FAIA 3IOFA 3IELA 3S0ZA 2BG8A 4UAMA 2FU8A 1WRAA 2YNUA 1X8HA 5A5ZA 4EXYA 2I7VA 4C1EA 3IEKA 3KNSA 4AX1B 1ZTCA 4RL0A 1XM8A 2QINA 4D1TA 3FCZA 3SFPA 5ACPA 4JO0A 5LS3A 4UWOB 3X2ZA 2NYPA 5FQAA 4KEQA 4AX0B 1QH5A 3QH8A 5B1UA 2ZO4A 3IE0A 3ESHA 1ZNBA 3ZNBA 3BK2A 1JT1A 4Z7RA 4AWZA 3AJ3A 5K4NA 5HIOA 4U4LA 4D1WA 5HH6A 1A8TA 2M5DA 2M5CA 2WYLA 4B87A 2BIBA 5EV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWY B;  4J5H A;  5HIS A;  2YNW A;  2P97 A;  3I11 A;  5A0T A;  4C1H A;  4O98 A;  5FQB A;  2A7M A;  5LCA A;  5KIL A;  1BMC A;  2FU7 A;  5HH4 A;  4UWR B;  5KIK A;  4EFZ A;  1VME A;  3H3E A;  5EW0 A;  4HKY A;  1X8G A;  4PVO A;  5ACV A;  5K0W A;  4RL2 A;  2GCU A;  3DHC A;  3MD7 A;  3VQZ A;  5LE1 A;  3I13 A;  3DHB A;  5A0V A;  1SML A;  3X2Y A;  2I7T A;  4XWW A;  5LCF A;  1DDK A;  3IE1 A;  4EYB A;  5AXR A;  2QJS A;  3RKJ A;  3X30 A;  2P18 A;  5AHO A;  2XR1 A;  4FSB A;  2BGA A;  3I0V A;  2Y8B A;  3SD9 A;  2ZZI A;  2BC2 A;  4NQ5 A;  2GFJ A;  3ZR9 A;  4UBQ A;  1P9E A;  2DOO A;  4V0H A;  4YSB A;  3BC2 A;  5LCH A;  2R2D A;  4EYL A;  4FEK A;  3A4Y A;  1YCG A;  2WHG A;  5EV6 A;  1DD6 A;  2YNT A;  2AZ4 A;  2BG6 A;  1MQO A;  3SRX A;  4XWT A;  2BG2 A;  2BG7 A;  1QH3 A;  2ZWR A;  1ZKP A;  5A87 A;  5ACT A;  5HIP A;  3PG4 A;  4J5F A;  1KR3 A;  3T9M A;  2VW8 A;  4EY2 A;  4CHL A;  4YSL A;  1JJT A;  4GCW A;  5LM6 A;  3ADR A;  3TP9 A;  4NQ2 A;  3VPE A;  3SPU A;  4D1U A;  2ZNB A;  5ACR A;  1VJN A;  5EH9 A;  2WYM A;  1WUO A;  2AIO A;  3IDZ A;  3JXP A;  3DHA A;  2Q0I A;  1YCH A;  4BP0 A;  5AHR A;  2E7Y A;  2YNT B;  2Q9U A;  2BG8 B;  4BZ3 A;  2FU9 A;  2Q42 A;  4P62 A;  4NQ6 A;  4TZB A;  1M2X A;  5B3R A;  1WW1 A;  2GFK A;  3L6N A;  2QDS A;  4TZ9 A;  4TYT A;  5EVK A;  5EWA A;  2BFL A;  2WRS A;  5AEB A;  3R2U A;  3DH8 A;  4AD9 A;  4RAM A;  2FK6 A;  2QED A;  4D1V A;  1K07 A;  2P1E A;  5FQC A;  1X8I A;  5ACX A;  3KL7 A;  5K4M A;  3AF5 A;  4Z6X A;  4YSK A;  4FR7 A;  2NZE A;  4C1C A;  4RAW A;  2UYX A;  2BR6 A;  2OHJ A;  1Y44 A;  2BFK A;  5IQK A;  2GKL A;  2I7X A;  4H0D A;  4HL2 A;  2FHX B;  2WYM C;  3IE2 A;  4RM5 A;  4DIK A;  4NQ4 A;  2YNV A;  5ACU A;  2HB9 A;  3IOG A;  3ZQ4 A;  3WXC A;  2YCB A;  4ZNB A;  3AF6 A;  4Z5Y A;  2QDT A;  4ZEJ A;  1E5D A;  2P4Z A;  2H6A A;  4LE6 A;  4F6Z A;  2Y87 A;  2Y8A A;  3SBL A;  4C09 A;  4GYU A;  4RBS A;  2XF4 A;  2BFZ B;  4EXS A;  1A7T A;  4TZF A;  4PVT A;  4KEP A;  5EVB A;  2DKF A;  5EHT A;  4GYQ A;  4C1F A;  2Q0J A;  3X2X A;  5LLD A;  1DXK A;  3KNR A;  1HLK A;  5HH5 A;  1VGN A;  4XUK A;  5LMC A;  1KO3 A;  1L9Y A;  2FM6 A;  1BVT A;  4HL1 A;  2YNV B;  2NXA A;  3I15 A;  4F6H A;  4UWP B;  3P2U A;  5B15 A;  1JJE A;  3I14 A;  4WD6 A;  4C1D A;  2FHX A;  1XTO A;  2FU6 A;  3LVZ A;  5AXO A;  5ACS A;  3G1P A;  4Z5Z A;  4EYF A;  5AYA A;  5K4K A;  1BC2 A;  3BV6 A;  3BK1 A;  5EVD A;  2GMN A;  4ZO3 A;  4UWS B;  1YCF A;  5HIQ A;  2CBN A;  4D02 A;  4Z60 A;  2BFZ A;  2OHH A;  3SW3 A;  5LSC A;  2NZF A;  3T3O A;  2BTN A;  3IEM A;  1KO2 A;  3T3N A;  3Q6V A;  4Z67 A;  2BMI A;  3ZWF A;  5ACW A;  3RKK A;  4TZE A;  2OHI A;  4ZO2 A;  4C1G A;  3F9O A;  3RPC A;  5DPX A;  1WUP A;  5ACQ A;  2YZ3 A;  4TYF A;  4UA4 A;  3PY6 A;  4DIL A;  3PY5 A;  3FAI A;  3IOF A;  3IEL A;  3S0Z A;  2BG8 A;  4UAM A;  2FU8 A;  1WRA A;  2YNU A;  1X8H A;  5A5Z A;  4EXY A;  2I7V A;  4C1E A;  3IEK A;  3KNS A;  4AX1 B;  1ZTC A;  4RL0 A;  1XM8 A;  2QIN A;  4D1T A;  3FCZ A;  3SFP A;  5ACP A;  4JO0 A;  5LS3 A;  4UWO B;  3X2Z A;  2NYP A;  5FQA A;  4KEQ A;  4AX0 B;  1QH5 A;  3QH8 A;  5B1U A;  2ZO4 A;  3IE0 A;  3ESH A;  1ZNB A;  3ZNB A;  3BK2 A;  1JT1 A;  4Z7R A;  4AWZ A;  3AJ3 A;  5K4N A;  5HIO A;  4U4L A;  4D1W A;  5HH6 A;  1A8T A;  2M5D A;  2M5C A;  2WYL A;  4B87 A;  2BIB A;  5EV8 A; 
#chains in the Genus database with same CATH topology
 4AWY B;  4J5H A;  5HIS A;  2YNW A;  2P97 A;  3I11 A;  5A0T A;  4C1H A;  4O98 A;  5FQB A;  2A7M A;  5LCA A;  5KIL A;  1BMC A;  2FU7 A;  5HH4 A;  4UWR B;  5KIK A;  4EFZ A;  1VME A;  3H3E A;  5EW0 A;  4HKY A;  1X8G A;  4PVO A;  5ACV A;  5K0W A;  4RL2 A;  2GCU A;  3DHC A;  3MD7 A;  3VQZ A;  5LE1 A;  3I13 A;  3DHB A;  5A0V A;  1SML A;  3X2Y A;  2I7T A;  4XWW A;  5LCF A;  1DDK A;  3IE1 A;  4EYB A;  5AXR A;  2QJS A;  3RKJ A;  3X30 A;  2P18 A;  5AHO A;  2XR1 A;  4FSB A;  2BGA A;  3I0V A;  2Y8B A;  3SD9 A;  2ZZI A;  4NUR A;  2BC2 A;  4NQ5 A;  2GFJ A;  3ZR9 A;  4UBQ A;  1P9E A;  2DOO A;  4V0H A;  4YSB A;  3BC2 A;  5LCH A;  2R2D A;  4EYL A;  4FEK A;  3A4Y A;  1YCG A;  2CG3 A;  2WHG A;  5EV6 A;  1DD6 A;  2YNT A;  2AZ4 A;  2BG6 A;  1MQO A;  3SRX A;  4XWT A;  2BG2 A;  2BG7 A;  1QH3 A;  2CFZ A;  2ZWR A;  1ZKP A;  5A87 A;  5ACT A;  5HIP A;  3PG4 A;  4J5F A;  1KR3 A;  3T9M A;  2VW8 A;  4EY2 A;  4CHL A;  4YSL A;  1JJT A;  4GCW A;  5LM6 A;  3ADR A;  3TP9 A;  4NQ2 A;  3VPE A;  3SPU A;  4D1U A;  2ZNB A;  5ACR A;  1VJN A;  5EH9 A;  2WYM A;  1WUO A;  2AIO A;  3IDZ A;  3JXP A;  3DHA A;  2Q0I A;  1YCH A;  4BP0 A;  5AHR A;  2YHE A;  2E7Y A;  2YNT B;  2Q9U A;  2BG8 B;  4BZ3 A;  2FU9 A;  2Q42 A;  4P62 A;  4NQ6 A;  4TZB A;  1M2X A;  5B3R A;  1WW1 A;  2GFK A;  3L6N A;  2QDS A;  4TZ9 A;  4TYT A;  5EVK A;  5EWA A;  2BFL A;  2WRS A;  5AEB A;  3R2U A;  3DH8 A;  4AD9 A;  4RAM A;  2FK6 A;  2QED A;  4D1V A;  1K07 A;  2P1E A;  5FQC A;  1X8I A;  5ACX A;  3KL7 A;  5K4M A;  3AF5 A;  4Z6X A;  4YSK A;  4FR7 A;  2NZE A;  4C1C A;  4RAW A;  2UYX A;  2BR6 A;  2OHJ A;  1Y44 A;  2BFK A;  5IQK A;  2GKL A;  2I7X A;  4H0D A;  4HL2 A;  2FHX B;  2WYM C;  3IE2 A;  4RM5 A;  4DIK A;  4NQ4 A;  2YNV A;  4PDX A;  5ACU A;  2HB9 A;  3IOG A;  3ZQ4 A;  3WXC A;  2YCB A;  4ZNB A;  3AF6 A;  4Z5Y A;  2QDT A;  5AJL A;  4ZEJ A;  1E5D A;  2P4Z A;  2H6A A;  4LE6 A;  4F6Z A;  2Y87 A;  2Y8A A;  3SBL A;  4C09 A;  4GYU A;  4RBS A;  2XF4 A;  5A23 A;  2BFZ B;  4EXS A;  1A7T A;  4TZF A;  4PVT A;  4KEP A;  5EVB A;  2DKF A;  5EHT A;  4GYQ A;  4C1F A;  2Q0J A;  3X2X A;  5LLD A;  1DXK A;  3KNR A;  1HLK A;  5HH5 A;  1VGN A;  4XUK A;  5LMC A;  1KO3 A;  1L9Y A;  2FM6 A;  1BVT A;  4HL1 A;  2YNV B;  2NXA A;  3I15 A;  4F6H A;  4UWP B;  3P2U A;  5B15 A;  1JJE A;  3I14 A;  4WD6 A;  4C1D A;  2FHX A;  1XTO A;  2FU6 A;  3LVZ A;  5AXO A;  5ACS A;  3G1P A;  4Z5Z A;  4EYF A;  5AYA A;  5K4K A;  1BC2 A;  3BV6 A;  3BK1 A;  5EVD A;  2GMN A;  4ZO3 A;  4UWS B;  1YCF A;  5HIQ A;  2CBN A;  4D02 A;  4Z60 A;  2BFZ A;  2OHH A;  3SW3 A;  5LSC A;  2NZF A;  3T3O A;  2BTN A;  3IEM A;  1KO2 A;  3T3N A;  3Q6V A;  4Z67 A;  2BMI A;  3ZWF A;  5ACW A;  3RKK A;  4TZE A;  2OHI A;  4ZO2 A;  4AXH A;  4C1G A;  3F9O A;  3RPC A;  5DPX A;  1WUP A;  5ACQ A;  2YZ3 A;  4TYF A;  4UA4 A;  3PY6 A;  4DIL A;  2CG2 A;  3PY5 A;  3FAI A;  3IOF A;  3IEL A;  3S0Z A;  2BG8 A;  4UAM A;  2FU8 A;  1WRA A;  2YNU A;  1X8H A;  5A5Z A;  4AV7 A;  4EXY A;  2CFU A;  2I7V A;  4C1E A;  3IEK A;  3KNS A;  5AIJ A;  4AX1 B;  1ZTC A;  4RL0 A;  1XM8 A;  2QIN A;  4D1T A;  3FCZ A;  3SFP A;  5ACP A;  4JO0 A;  5LS3 A;  4UWO B;  3X2Z A;  2NYP A;  5FQA A;  4KEQ A;  4AX0 B;  1QH5 A;  3QH8 A;  5B1U A;  2ZO4 A;  3IE0 A;  3ESH A;  1ZNB A;  3ZNB A;  3BK2 A;  1JT1 A;  4Z7R A;  4AWZ A;  3AJ3 A;  5K4N A;  5HIO A;  4U4L A;  4D1W A;  5HH6 A;  1A8T A;  2M5D A;  2M5C A;  2WYL A;  4B87 A;  2BIB A;  5EV8 A; 
#chains in the Genus database with same CATH homology
 4AWY B;  4J5H A;  5HIS A;  2YNW A;  2P97 A;  3I11 A;  5A0T A;  4C1H A;  4O98 A;  5FQB A;  2A7M A;  5LCA A;  5KIL A;  1BMC A;  2FU7 A;  5HH4 A;  4UWR B;  5KIK A;  4EFZ A;  1VME A;  3H3E A;  5EW0 A;  4HKY A;  1X8G A;  4PVO A;  5ACV A;  5K0W A;  4RL2 A;  2GCU A;  3DHC A;  3MD7 A;  3VQZ A;  5LE1 A;  3I13 A;  3DHB A;  5A0V A;  1SML A;  3X2Y A;  2I7T A;  4XWW A;  5LCF A;  1DDK A;  3IE1 A;  4EYB A;  5AXR A;  2QJS A;  3RKJ A;  3X30 A;  2P18 A;  5AHO A;  2XR1 A;  4FSB A;  2BGA A;  3I0V A;  2Y8B A;  3SD9 A;  2ZZI A;  2BC2 A;  4NQ5 A;  2GFJ A;  3ZR9 A;  4UBQ A;  1P9E A;  2DOO A;  4V0H A;  4YSB A;  3BC2 A;  5LCH A;  2R2D A;  4EYL A;  4FEK A;  3A4Y A;  1YCG A;  2WHG A;  5EV6 A;  1DD6 A;  2YNT A;  2AZ4 A;  2BG6 A;  1MQO A;  3SRX A;  4XWT A;  2BG2 A;  2BG7 A;  1QH3 A;  2ZWR A;  1ZKP A;  5A87 A;  5ACT A;  5HIP A;  3PG4 A;  4J5F A;  1KR3 A;  3T9M A;  2VW8 A;  4EY2 A;  4CHL A;  4YSL A;  1JJT A;  4GCW A;  5LM6 A;  3ADR A;  3TP9 A;  4NQ2 A;  3VPE A;  3SPU A;  4D1U A;  2ZNB A;  5ACR A;  1VJN A;  5EH9 A;  2WYM A;  1WUO A;  2AIO A;  3IDZ A;  3JXP A;  3DHA A;  2Q0I A;  1YCH A;  4BP0 A;  5AHR A;  2E7Y A;  2YNT B;  2Q9U A;  2BG8 B;  4BZ3 A;  2FU9 A;  2Q42 A;  4P62 A;  4NQ6 A;  4TZB A;  1M2X A;  5B3R A;  1WW1 A;  2GFK A;  3L6N A;  2QDS A;  4TZ9 A;  4TYT A;  5EVK A;  5EWA A;  2BFL A;  2WRS A;  5AEB A;  3R2U A;  3DH8 A;  4AD9 A;  4RAM A;  2FK6 A;  2QED A;  4D1V A;  1K07 A;  2P1E A;  5FQC A;  1X8I A;  5ACX A;  3KL7 A;  5K4M A;  3AF5 A;  4Z6X A;  4YSK A;  4FR7 A;  2NZE A;  4C1C A;  4RAW A;  2UYX A;  2BR6 A;  2OHJ A;  1Y44 A;  2BFK A;  5IQK A;  2GKL A;  2I7X A;  4H0D A;  4HL2 A;  2FHX B;  2WYM C;  3IE2 A;  4RM5 A;  4DIK A;  4NQ4 A;  2YNV A;  5ACU A;  2HB9 A;  3IOG A;  3ZQ4 A;  3WXC A;  2YCB A;  4ZNB A;  3AF6 A;  4Z5Y A;  2QDT A;  4ZEJ A;  1E5D A;  2P4Z A;  2H6A A;  4LE6 A;  4F6Z A;  2Y87 A;  2Y8A A;  3SBL A;  4C09 A;  4GYU A;  4RBS A;  2XF4 A;  2BFZ B;  4EXS A;  1A7T A;  4TZF A;  4PVT A;  4KEP A;  5EVB A;  2DKF A;  5EHT A;  4GYQ A;  4C1F A;  2Q0J A;  3X2X A;  5LLD A;  1DXK A;  3KNR A;  1HLK A;  5HH5 A;  1VGN A;  4XUK A;  5LMC A;  1KO3 A;  1L9Y A;  2FM6 A;  1BVT A;  4HL1 A;  2YNV B;  2NXA A;  3I15 A;  4F6H A;  4UWP B;  3P2U A;  5B15 A;  1JJE A;  3I14 A;  4WD6 A;  4C1D A;  2FHX A;  1XTO A;  2FU6 A;  3LVZ A;  5AXO A;  5ACS A;  3G1P A;  4Z5Z A;  4EYF A;  5AYA A;  5K4K A;  1BC2 A;  3BV6 A;  3BK1 A;  5EVD A;  2GMN A;  4ZO3 A;  4UWS B;  1YCF A;  5HIQ A;  2CBN A;  4D02 A;  4Z60 A;  2BFZ A;  2OHH A;  3SW3 A;  5LSC A;  2NZF A;  3T3O A;  2BTN A;  3IEM A;  1KO2 A;  3T3N A;  3Q6V A;  4Z67 A;  2BMI A;  3ZWF A;  5ACW A;  3RKK A;  4TZE A;  2OHI A;  4ZO2 A;  4C1G A;  3F9O A;  3RPC A;  5DPX A;  1WUP A;  5ACQ A;  2YZ3 A;  4TYF A;  4UA4 A;  3PY6 A;  4DIL A;  3PY5 A;  3FAI A;  3IOF A;  3IEL A;  3S0Z A;  2BG8 A;  4UAM A;  2FU8 A;  1WRA A;  2YNU A;  1X8H A;  5A5Z A;  4EXY A;  2I7V A;  4C1E A;  3IEK A;  3KNS A;  4AX1 B;  1ZTC A;  4RL0 A;  1XM8 A;  2QIN A;  4D1T A;  3FCZ A;  3SFP A;  5ACP A;  4JO0 A;  5LS3 A;  4UWO B;  3X2Z A;  2NYP A;  5FQA A;  4KEQ A;  4AX0 B;  1QH5 A;  3QH8 A;  5B1U A;  2ZO4 A;  3IE0 A;  3ESH A;  1ZNB A;  3ZNB A;  3BK2 A;  1JT1 A;  4Z7R A;  4AWZ A;  3AJ3 A;  5K4N A;  5HIO A;  4U4L A;  4D1W A;  5HH6 A;  1A8T A;  2M5D A;  2M5C A;  2WYL A;  4B87 A;  2BIB A;  5EV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...