2P1EA

Crystal structure of the leishmania infantum glyoxalase ii with d-lactate at the active site
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
279
Chain Sequence
MRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLTYTFSTILSTHKHWDHSGGNAKLKAELVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glyoxalase II
publication title Catalysis and Structural Properties of Leishmania infantum Glyoxalase II: Trypanothione Specificity and Phylogeny.
pubmed doi rcsb
source organism Leishmania infantum
total genus 100
structure length 279
sequence length 293
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2p1eA00
3R2UA 4DILA 2YZ3A 1X8HA 1KR3A 4ZNBA 2GFKA 2FU8A 1KO2A 1VGNA 5ACPA 1JJTA 3RKKA 2BG8A 5AHRA 3X2XA 4YSBA 4Z6XA 5ACVA 1X8IA 1JJEA 1DXKA 4CHLA 2E7YA 3DH8A 5KILA 3BK2A 5EWAA 4J5HA 5HIQA 3BV6A 5DPXA 4FEKA 2Y87A 3KNRA 5FQCA 5HIOA 3IOGA 2ZO4A 2BG6A 5AEBA 3F9OA 1ZTCA 2ZWRA 2BFKA 1YCGA 4V0HA 2NYPA 4RL2A 5EV8A 4KEQA 3X2YA 1A7TA 3IOFA 4Z5YA 4EFZA 4TYTA 3T9MA 2NXAA 3L6NA 3VPEA 2OHJA 2YNUA 2BFZB 5LCHA 4AX1B 2CBNA 5LM6A 2UYXA 4UWSB 5A5ZA 2QDSA 3IE1A 2BFLA 1K07A 4C1EA 2BG7A 2FHXB 2I7VA 3SRXA 4D1UA 3ZQ4A 4DIKA 3ADRA 4J5FA 3AF5A 4PVTA 3IE0A 5EVBA 1DD6A 2I7TA 4AD9A 5K0WA 3I14A 1XTOA 2GFJA 2QEDA 3JXPA 3I11A 5K4KA 3WXCA 1WRAA 3SPUA 4WD6A 4EXYA 1X8GA 4GCWA 3ZWFA 3LVZA 4U4LA 4D1WA 4RL0A 2A7MA 5FQBA 5FQAA 4AWYB 2YNWA 5HISA 3A4YA 2BTNA 3H3EA 4LE6A 1YCFA 5LSCA 4UA4A 2Y8AA 1QH5A 1A8TA 2AIOA 3PY6A 3S0ZA 2Q0IA 3IELA 3X30A 4C1GA 3ZNBA 5EH9A 4YSLA 5A0TA 2BMIA 5EVKA 1ZNBA 3KNSA 5EW0A 4AWZA 4NQ5A 4HL2A 1XM8A 1BC2A 5IQKA 2BC2A 3MD7A 4RAWA 4HKYA 4ZO3A 3QH8A 5LLDA 5LCFA 5ACRA 3SD9A 2P1EA 4NQ2A 3IEMA 1ZKPA 4EYLA 3T3OA 5EHTA 5LE1A 5HH5A 2FHXA 2NZEA 4FSBA 2M5DA 4NQ6A 2YNTB 4C1FA 3PY5A 5A87A 1BVTA 3AJ3A 2R2DA 2Q0JA 3P2UA 1JT1A 3ESHA 4UAMA 2QDTA 2WRSA 2XF4A 4AX0B 4HL1A 2YNVB 4GYUA 4FR7A 4P62A 4UWRB 3SFPA 1HLKA 5EVDA 4NQ4A 2VW8A 2DOOA 2ZNBA 3IE2A 4UWOB 2GCUA 1BMCA 1YCHA 4Z67A 2BR6A 1M2XA 4GYQA 2AZ4A 3FCZA 3DHAA 1MQOA 5LCAA 2OHHA 3I13A 3ZR9A 5ACWA 1KO3A 3I15A 4O98A 2H6AA 4BZ3A 3IEKA 2GMNA 3BK1A 4XWWA 3IDZA 2FU6A 4Z7RA 3KL7A 2FK6A 2I7XA 2P4ZA 4TYFA 2M5CA 5AYAA 4D02A 4JO0A 4D1TA 3RKJA 4XWTA 4EXSA 5LMCA 2YCBA 4Z60A 3RPCA 4UWPB 4F6HA 5AHOA 4RBSA 1SMLA 5ACSA 4C1CA 5ACUA 3FAIA 5ACQA 4ZO2A 3SW3A 2NZFA 1QH3A 4C1HA 3I0VA 2P18A 2WHGA 5B1UA 2QJSA 2BG8B 3G1PA 3SBLA 2P97A 2YNTA 3AF6A 2BFZA 2FU7A 2XR1A 4F6ZA 5K4MA 2QINA 1P9EA 4B87A 1VJNA 2Y8BA 2BG2A 4EYFA 2YNVA 5EV6A 3DHBA 5A0VA 2Q42A 4KEPA 2Q9UA 4ZEJA 2WYLA 5HH4A 3T3NA 1E5DA 5ACTA 4PVOA 3Q6VA 4TZ9A 5ACXA 4BP0A 4EY2A 1DDKA 1WUOA 3PG4A 4H0DA 4C1DA 4XUKA 4D1VA 5HIPA 1WW1A 5AXRA 4TZEA 2DKFA 5KIKA 2FU9A 2OHIA 2FM6A 2WYMA 4C09A 1L9YA 4RM5A 4EYBA 2HB9A 2GKLA 2BIBA 5LS3A 3VQZA 3DHCA 4UBQA 5K4NA 5B15A 1WUPA 2BGAA 5HH6A 1VMEA 3X2ZA 1Y44A 2ZZIA 2WYMC 3TP9A 3BC2A 4YSKA 5B3RA 4TZFA 4TZBA 4Z5ZA 5AXOA 4RAMA
chains in the Genus database with same CATH superfamily
3R2UA 4DILA 2YZ3A 1X8HA 1KR3A 4ZNBA 2GFKA 2FU8A 1KO2A 1VGNA 5ACPA 1JJTA 5AJLA 3RKKA 2BG8A 5AHRA 3X2XA 4YSBA 4Z6XA 5ACVA 1X8IA 1JJEA 1DXKA 4CHLA 2E7YA 3DH8A 5KILA 3BK2A 5EWAA 4J5HA 5HIQA 3BV6A 5DPXA 4FEKA 2Y87A 3KNRA 5FQCA 5HIOA 3IOGA 2ZO4A 2BG6A 5AEBA 3F9OA 1ZTCA 2ZWRA 2BFKA 1YCGA 4V0HA 2NYPA 4RL2A 5EV8A 4KEQA 3X2YA 1A7TA 4NURA 3IOFA 4Z5YA 4EFZA 4TYTA 3T9MA 2NXAA 3L6NA 3VPEA 2OHJA 2YNUA 2BFZB 5LCHA 4AX1B 2CBNA 5LM6A 2UYXA 4UWSB 5A5ZA 2QDSA 3IE1A 2BFLA 1K07A 4C1EA 2BG7A 2FHXB 2I7VA 3SRXA 4D1UA 3ZQ4A 4DIKA 3ADRA 4J5FA 3AF5A 4PVTA 3IE0A 5EVBA 1DD6A 2I7TA 4AD9A 5K0WA 3I14A 1XTOA 2GFJA 2QEDA 3JXPA 3I11A 5K4KA 3WXCA 1WRAA 3SPUA 4WD6A 4EXYA 1X8GA 4GCWA 4PDXA 3ZWFA 3LVZA 4U4LA 4D1WA 4RL0A 2A7MA 5FQBA 5FQAA 4AWYB 2YNWA 5HISA 3A4YA 2BTNA 3H3EA 4LE6A 1YCFA 5LSCA 4UA4A 2Y8AA 1QH5A 1A8TA 2AIOA 3PY6A 3S0ZA 2Q0IA 3IELA 3X30A 4C1GA 3ZNBA 5EH9A 4YSLA 5A0TA 2BMIA 5EVKA 1ZNBA 3KNSA 5EW0A 4AWZA 4NQ5A 4HL2A 2CFZA 1XM8A 1BC2A 5IQKA 2BC2A 2YHEA 3MD7A 4RAWA 4AXHA 4HKYA 4ZO3A 3QH8A 5LLDA 5LCFA 5ACRA 3SD9A 2P1EA 4NQ2A 3IEMA 1ZKPA 4EYLA 3T3OA 5EHTA 5LE1A 5HH5A 5A23A 2FHXA 2NZEA 4FSBA 2M5DA 4NQ6A 2YNTB 4C1FA 3PY5A 5A87A 1BVTA 3AJ3A 2R2DA 2Q0JA 3P2UA 1JT1A 3ESHA 4UAMA 2QDTA 2WRSA 2XF4A 4AX0B 4HL1A 2YNVB 4GYUA 4FR7A 4P62A 4UWRB 3SFPA 1HLKA 5EVDA 4NQ4A 2VW8A 2DOOA 2ZNBA 3IE2A 4UWOB 2GCUA 1BMCA 1YCHA 4Z67A 2BR6A 1M2XA 4GYQA 2AZ4A 4AV7A 3FCZA 3DHAA 1MQOA 5LCAA 2OHHA 3I13A 3ZR9A 5ACWA 1KO3A 3I15A 4O98A 2H6AA 4BZ3A 3IEKA 2GMNA 3BK1A 4XWWA 3IDZA 2FU6A 4Z7RA 3KL7A 2FK6A 2I7XA 2P4ZA 4TYFA 2M5CA 5AYAA 4D02A 4JO0A 4D1TA 3RKJA 4XWTA 4EXSA 5LMCA 2YCBA 4Z60A 3RPCA 4UWPB 4F6HA 5AHOA 4RBSA 1SMLA 5ACSA 4C1CA 5ACUA 3FAIA 5ACQA 4ZO2A 3SW3A 2NZFA 1QH3A 4C1HA 3I0VA 2P18A 2WHGA 5B1UA 2QJSA 2BG8B 3G1PA 3SBLA 2CFUA 2P97A 2YNTA 3AF6A 2BFZA 2FU7A 2XR1A 4F6ZA 2CG2A 5K4MA 2QINA 1P9EA 4B87A 1VJNA 2Y8BA 2BG2A 4EYFA 2YNVA 5EV6A 3DHBA 5A0VA 2Q42A 4KEPA 2Q9UA 4ZEJA 2WYLA 5HH4A 3T3NA 1E5DA 5ACTA 4PVOA 3Q6VA 4TZ9A 5ACXA 4BP0A 4EY2A 1DDKA 1WUOA 3PG4A 4H0DA 4C1DA 4XUKA 4D1VA 5HIPA 1WW1A 5AXRA 4TZEA 2DKFA 5KIKA 2FU9A 2OHIA 2FM6A 2WYMA 4C09A 1L9YA 4RM5A 4EYBA 2HB9A 2GKLA 2BIBA 5LS3A 3VQZA 3DHCA 4UBQA 5K4NA 5B15A 1WUPA 2BGAA 5HH6A 1VMEA 3X2ZA 1Y44A 5AIJA 2ZZIA 2WYMC 3TP9A 3BC2A 4YSKA 5B3RA 4TZFA 4TZBA 4Z5ZA 5AXOA 2CG3A 4RAMA
chains in the Genus database with same CATH topology
3R2UA 4DILA 2YZ3A 1X8HA 1KR3A 4ZNBA 2GFKA 2FU8A 1KO2A 1VGNA 5ACPA 1JJTA 3RKKA 2BG8A 5AHRA 3X2XA 4YSBA 4Z6XA 5ACVA 1X8IA 1JJEA 1DXKA 4CHLA 2E7YA 3DH8A 5KILA 3BK2A 5EWAA 4J5HA 5HIQA 3BV6A 5DPXA 4FEKA 2Y87A 3KNRA 5FQCA 5HIOA 3IOGA 2ZO4A 2BG6A 5AEBA 3F9OA 1ZTCA 2ZWRA 2BFKA 1YCGA 4V0HA 2NYPA 4RL2A 5EV8A 4KEQA 3X2YA 1A7TA 3IOFA 4Z5YA 4EFZA 4TYTA 3T9MA 2NXAA 3L6NA 3VPEA 2OHJA 2YNUA 2BFZB 5LCHA 4AX1B 2CBNA 5LM6A 2UYXA 4UWSB 5A5ZA 2QDSA 3IE1A 2BFLA 1K07A 4C1EA 2BG7A 2FHXB 2I7VA 3SRXA 4D1UA 3ZQ4A 4DIKA 3ADRA 4J5FA 3AF5A 4PVTA 3IE0A 5EVBA 1DD6A 2I7TA 4AD9A 5K0WA 3I14A 1XTOA 2GFJA 2QEDA 3JXPA 3I11A 5K4KA 3WXCA 1WRAA 3SPUA 4WD6A 4EXYA 1X8GA 4GCWA 3ZWFA 3LVZA 4U4LA 4D1WA 4RL0A 2A7MA 5FQBA 5FQAA 4AWYB 2YNWA 5HISA 3A4YA 2BTNA 3H3EA 4LE6A 1YCFA 5LSCA 4UA4A 2Y8AA 1QH5A 1A8TA 2AIOA 3PY6A 3S0ZA 2Q0IA 3IELA 3X30A 4C1GA 3ZNBA 5EH9A 4YSLA 5A0TA 2BMIA 5EVKA 1ZNBA 3KNSA 5EW0A 4AWZA 4NQ5A 4HL2A 1XM8A 1BC2A 5IQKA 2BC2A 3MD7A 4RAWA 4HKYA 4ZO3A 3QH8A 5LLDA 5LCFA 5ACRA 3SD9A 2P1EA 4NQ2A 3IEMA 1ZKPA 4EYLA 3T3OA 5EHTA 5LE1A 5HH5A 2FHXA 2NZEA 4FSBA 2M5DA 4NQ6A 2YNTB 4C1FA 3PY5A 5A87A 1BVTA 3AJ3A 2R2DA 2Q0JA 3P2UA 1JT1A 3ESHA 4UAMA 2QDTA 2WRSA 2XF4A 4AX0B 4HL1A 2YNVB 4GYUA 4FR7A 4P62A 4UWRB 3SFPA 1HLKA 5EVDA 4NQ4A 2VW8A 2DOOA 2ZNBA 3IE2A 4UWOB 2GCUA 1BMCA 1YCHA 4Z67A 2BR6A 1M2XA 4GYQA 2AZ4A 3FCZA 3DHAA 1MQOA 5LCAA 2OHHA 3I13A 3ZR9A 5ACWA 1KO3A 3I15A 4O98A 2H6AA 4BZ3A 3IEKA 2GMNA 3BK1A 4XWWA 3IDZA 2FU6A 4Z7RA 3KL7A 2FK6A 2I7XA 2P4ZA 4TYFA 2M5CA 5AYAA 4D02A 4JO0A 4D1TA 3RKJA 4XWTA 4EXSA 5LMCA 2YCBA 4Z60A 3RPCA 4UWPB 4F6HA 5AHOA 4RBSA 1SMLA 5ACSA 4C1CA 5ACUA 3FAIA 5ACQA 4ZO2A 3SW3A 2NZFA 1QH3A 4C1HA 3I0VA 2P18A 2WHGA 5B1UA 2QJSA 2BG8B 3G1PA 3SBLA 2P97A 2YNTA 3AF6A 2BFZA 2FU7A 2XR1A 4F6ZA 5K4MA 2QINA 1P9EA 4B87A 1VJNA 2Y8BA 2BG2A 4EYFA 2YNVA 5EV6A 3DHBA 5A0VA 2Q42A 4KEPA 2Q9UA 4ZEJA 2WYLA 5HH4A 3T3NA 1E5DA 5ACTA 4PVOA 3Q6VA 4TZ9A 5ACXA 4BP0A 4EY2A 1DDKA 1WUOA 3PG4A 4H0DA 4C1DA 4XUKA 4D1VA 5HIPA 1WW1A 5AXRA 4TZEA 2DKFA 5KIKA 2FU9A 2OHIA 2FM6A 2WYMA 4C09A 1L9YA 4RM5A 4EYBA 2HB9A 2GKLA 2BIBA 5LS3A 3VQZA 3DHCA 4UBQA 5K4NA 5B15A 1WUPA 2BGAA 5HH6A 1VMEA 3X2ZA 1Y44A 2ZZIA 2WYMC 3TP9A 3BC2A 4YSKA 5B3RA 4TZFA 4TZBA 4Z5ZA 5AXOA 4RAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R2U A;  4DIL A;  2YZ3 A;  1X8H A;  1KR3 A;  4ZNB A;  2GFK A;  2FU8 A;  1KO2 A;  1VGN A;  5ACP A;  1JJT A;  3RKK A;  2BG8 A;  5AHR A;  3X2X A;  4YSB A;  4Z6X A;  5ACV A;  1X8I A;  1JJE A;  1DXK A;  4CHL A;  2E7Y A;  3DH8 A;  5KIL A;  3BK2 A;  5EWA A;  4J5H A;  5HIQ A;  3BV6 A;  5DPX A;  4FEK A;  2Y87 A;  3KNR A;  5FQC A;  5HIO A;  3IOG A;  2ZO4 A;  2BG6 A;  5AEB A;  3F9O A;  1ZTC A;  2ZWR A;  2BFK A;  1YCG A;  4V0H A;  2NYP A;  4RL2 A;  5EV8 A;  4KEQ A;  3X2Y A;  1A7T A;  3IOF A;  4Z5Y A;  4EFZ A;  4TYT A;  3T9M A;  2NXA A;  3L6N A;  3VPE A;  2OHJ A;  2YNU A;  2BFZ B;  5LCH A;  4AX1 B;  2CBN A;  5LM6 A;  2UYX A;  4UWS B;  5A5Z A;  2QDS A;  3IE1 A;  2BFL A;  1K07 A;  4C1E A;  2BG7 A;  2FHX B;  2I7V A;  3SRX A;  4D1U A;  3ZQ4 A;  4DIK A;  3ADR A;  4J5F A;  3AF5 A;  4PVT A;  3IE0 A;  5EVB A;  1DD6 A;  2I7T A;  4AD9 A;  5K0W A;  3I14 A;  1XTO A;  2GFJ A;  2QED A;  3JXP A;  3I11 A;  5K4K A;  3WXC A;  1WRA A;  3SPU A;  4WD6 A;  4EXY A;  1X8G A;  4GCW A;  3ZWF A;  3LVZ A;  4U4L A;  4D1W A;  4RL0 A;  2A7M A;  5FQB A;  5FQA A;  4AWY B;  2YNW A;  5HIS A;  3A4Y A;  2BTN A;  3H3E A;  4LE6 A;  1YCF A;  5LSC A;  4UA4 A;  2Y8A A;  1QH5 A;  1A8T A;  2AIO A;  3PY6 A;  3S0Z A;  2Q0I A;  3IEL A;  3X30 A;  4C1G A;  3ZNB A;  5EH9 A;  4YSL A;  5A0T A;  2BMI A;  5EVK A;  1ZNB A;  3KNS A;  5EW0 A;  4AWZ A;  4NQ5 A;  4HL2 A;  1XM8 A;  1BC2 A;  5IQK A;  2BC2 A;  3MD7 A;  4RAW A;  4HKY A;  4ZO3 A;  3QH8 A;  5LLD A;  5LCF A;  5ACR A;  3SD9 A;  2P1E A;  4NQ2 A;  3IEM A;  1ZKP A;  4EYL A;  3T3O A;  5EHT A;  5LE1 A;  5HH5 A;  2FHX A;  2NZE A;  4FSB A;  2M5D A;  4NQ6 A;  2YNT B;  4C1F A;  3PY5 A;  5A87 A;  1BVT A;  3AJ3 A;  2R2D A;  2Q0J A;  3P2U A;  1JT1 A;  3ESH A;  4UAM A;  2QDT A;  2WRS A;  2XF4 A;  4AX0 B;  4HL1 A;  2YNV B;  4GYU A;  4FR7 A;  4P62 A;  4UWR B;  3SFP A;  1HLK A;  5EVD A;  4NQ4 A;  2VW8 A;  2DOO A;  2ZNB A;  3IE2 A;  4UWO B;  2GCU A;  1BMC A;  1YCH A;  4Z67 A;  2BR6 A;  1M2X A;  4GYQ A;  2AZ4 A;  3FCZ A;  3DHA A;  1MQO A;  5LCA A;  2OHH A;  3I13 A;  3ZR9 A;  5ACW A;  1KO3 A;  3I15 A;  4O98 A;  2H6A A;  4BZ3 A;  3IEK A;  2GMN A;  3BK1 A;  4XWW A;  3IDZ A;  2FU6 A;  4Z7R A;  3KL7 A;  2FK6 A;  2I7X A;  2P4Z A;  4TYF A;  2M5C A;  5AYA A;  4D02 A;  4JO0 A;  4D1T A;  3RKJ A;  4XWT A;  4EXS A;  5LMC A;  2YCB A;  4Z60 A;  3RPC A;  4UWP B;  4F6H A;  5AHO A;  4RBS A;  1SML A;  5ACS A;  4C1C A;  5ACU A;  3FAI A;  5ACQ A;  4ZO2 A;  3SW3 A;  2NZF A;  1QH3 A;  4C1H A;  3I0V A;  2P18 A;  2WHG A;  5B1U A;  2QJS A;  2BG8 B;  3G1P A;  3SBL A;  2P97 A;  2YNT A;  3AF6 A;  2BFZ A;  2FU7 A;  2XR1 A;  4F6Z A;  5K4M A;  2QIN A;  1P9E A;  4B87 A;  1VJN A;  2Y8B A;  2BG2 A;  4EYF A;  2YNV A;  5EV6 A;  3DHB A;  5A0V A;  2Q42 A;  4KEP A;  2Q9U A;  4ZEJ A;  2WYL A;  5HH4 A;  3T3N A;  1E5D A;  5ACT A;  4PVO A;  3Q6V A;  4TZ9 A;  5ACX A;  4BP0 A;  4EY2 A;  1DDK A;  1WUO A;  3PG4 A;  4H0D A;  4C1D A;  4XUK A;  4D1V A;  5HIP A;  1WW1 A;  5AXR A;  4TZE A;  2DKF A;  5KIK A;  2FU9 A;  2OHI A;  2FM6 A;  2WYM A;  4C09 A;  1L9Y A;  4RM5 A;  4EYB A;  2HB9 A;  2GKL A;  2BIB A;  5LS3 A;  3VQZ A;  3DHC A;  4UBQ A;  5K4N A;  5B15 A;  1WUP A;  2BGA A;  5HH6 A;  1VME A;  3X2Z A;  1Y44 A;  2ZZI A;  2WYM C;  3TP9 A;  3BC2 A;  4YSK A;  5B3R A;  4TZF A;  4TZB A;  4Z5Z A;  5AXO A;  4RAM A; 
#chains in the Genus database with same CATH topology
 3R2U A;  4DIL A;  2YZ3 A;  1X8H A;  1KR3 A;  4ZNB A;  2GFK A;  2FU8 A;  1KO2 A;  1VGN A;  5ACP A;  1JJT A;  5AJL A;  3RKK A;  2BG8 A;  5AHR A;  3X2X A;  4YSB A;  4Z6X A;  5ACV A;  1X8I A;  1JJE A;  1DXK A;  4CHL A;  2E7Y A;  3DH8 A;  5KIL A;  3BK2 A;  5EWA A;  4J5H A;  5HIQ A;  3BV6 A;  5DPX A;  4FEK A;  2Y87 A;  3KNR A;  5FQC A;  5HIO A;  3IOG A;  2ZO4 A;  2BG6 A;  5AEB A;  3F9O A;  1ZTC A;  2ZWR A;  2BFK A;  1YCG A;  4V0H A;  2NYP A;  4RL2 A;  5EV8 A;  4KEQ A;  3X2Y A;  1A7T A;  4NUR A;  3IOF A;  4Z5Y A;  4EFZ A;  4TYT A;  3T9M A;  2NXA A;  3L6N A;  3VPE A;  2OHJ A;  2YNU A;  2BFZ B;  5LCH A;  4AX1 B;  2CBN A;  5LM6 A;  2UYX A;  4UWS B;  5A5Z A;  2QDS A;  3IE1 A;  2BFL A;  1K07 A;  4C1E A;  2BG7 A;  2FHX B;  2I7V A;  3SRX A;  4D1U A;  3ZQ4 A;  4DIK A;  3ADR A;  4J5F A;  3AF5 A;  4PVT A;  3IE0 A;  5EVB A;  1DD6 A;  2I7T A;  4AD9 A;  5K0W A;  3I14 A;  1XTO A;  2GFJ A;  2QED A;  3JXP A;  3I11 A;  5K4K A;  3WXC A;  1WRA A;  3SPU A;  4WD6 A;  4EXY A;  1X8G A;  4GCW A;  4PDX A;  3ZWF A;  3LVZ A;  4U4L A;  4D1W A;  4RL0 A;  2A7M A;  5FQB A;  5FQA A;  4AWY B;  2YNW A;  5HIS A;  3A4Y A;  2BTN A;  3H3E A;  4LE6 A;  1YCF A;  5LSC A;  4UA4 A;  2Y8A A;  1QH5 A;  1A8T A;  2AIO A;  3PY6 A;  3S0Z A;  2Q0I A;  3IEL A;  3X30 A;  4C1G A;  3ZNB A;  5EH9 A;  4YSL A;  5A0T A;  2BMI A;  5EVK A;  1ZNB A;  3KNS A;  5EW0 A;  4AWZ A;  4NQ5 A;  4HL2 A;  2CFZ A;  1XM8 A;  1BC2 A;  5IQK A;  2BC2 A;  2YHE A;  3MD7 A;  4RAW A;  4AXH A;  4HKY A;  4ZO3 A;  3QH8 A;  5LLD A;  5LCF A;  5ACR A;  3SD9 A;  2P1E A;  4NQ2 A;  3IEM A;  1ZKP A;  4EYL A;  3T3O A;  5EHT A;  5LE1 A;  5HH5 A;  5A23 A;  2FHX A;  2NZE A;  4FSB A;  2M5D A;  4NQ6 A;  2YNT B;  4C1F A;  3PY5 A;  5A87 A;  1BVT A;  3AJ3 A;  2R2D A;  2Q0J A;  3P2U A;  1JT1 A;  3ESH A;  4UAM A;  2QDT A;  2WRS A;  2XF4 A;  4AX0 B;  4HL1 A;  2YNV B;  4GYU A;  4FR7 A;  4P62 A;  4UWR B;  3SFP A;  1HLK A;  5EVD A;  4NQ4 A;  2VW8 A;  2DOO A;  2ZNB A;  3IE2 A;  4UWO B;  2GCU A;  1BMC A;  1YCH A;  4Z67 A;  2BR6 A;  1M2X A;  4GYQ A;  2AZ4 A;  4AV7 A;  3FCZ A;  3DHA A;  1MQO A;  5LCA A;  2OHH A;  3I13 A;  3ZR9 A;  5ACW A;  1KO3 A;  3I15 A;  4O98 A;  2H6A A;  4BZ3 A;  3IEK A;  2GMN A;  3BK1 A;  4XWW A;  3IDZ A;  2FU6 A;  4Z7R A;  3KL7 A;  2FK6 A;  2I7X A;  2P4Z A;  4TYF A;  2M5C A;  5AYA A;  4D02 A;  4JO0 A;  4D1T A;  3RKJ A;  4XWT A;  4EXS A;  5LMC A;  2YCB A;  4Z60 A;  3RPC A;  4UWP B;  4F6H A;  5AHO A;  4RBS A;  1SML A;  5ACS A;  4C1C A;  5ACU A;  3FAI A;  5ACQ A;  4ZO2 A;  3SW3 A;  2NZF A;  1QH3 A;  4C1H A;  3I0V A;  2P18 A;  2WHG A;  5B1U A;  2QJS A;  2BG8 B;  3G1P A;  3SBL A;  2CFU A;  2P97 A;  2YNT A;  3AF6 A;  2BFZ A;  2FU7 A;  2XR1 A;  4F6Z A;  2CG2 A;  5K4M A;  2QIN A;  1P9E A;  4B87 A;  1VJN A;  2Y8B A;  2BG2 A;  4EYF A;  2YNV A;  5EV6 A;  3DHB A;  5A0V A;  2Q42 A;  4KEP A;  2Q9U A;  4ZEJ A;  2WYL A;  5HH4 A;  3T3N A;  1E5D A;  5ACT A;  4PVO A;  3Q6V A;  4TZ9 A;  5ACX A;  4BP0 A;  4EY2 A;  1DDK A;  1WUO A;  3PG4 A;  4H0D A;  4C1D A;  4XUK A;  4D1V A;  5HIP A;  1WW1 A;  5AXR A;  4TZE A;  2DKF A;  5KIK A;  2FU9 A;  2OHI A;  2FM6 A;  2WYM A;  4C09 A;  1L9Y A;  4RM5 A;  4EYB A;  2HB9 A;  2GKL A;  2BIB A;  5LS3 A;  3VQZ A;  3DHC A;  4UBQ A;  5K4N A;  5B15 A;  1WUP A;  2BGA A;  5HH6 A;  1VME A;  3X2Z A;  1Y44 A;  5AIJ A;  2ZZI A;  2WYM C;  3TP9 A;  3BC2 A;  4YSK A;  5B3R A;  4TZF A;  4TZB A;  4Z5Z A;  5AXO A;  2CG3 A;  4RAM A; 
#chains in the Genus database with same CATH homology
 3R2U A;  4DIL A;  2YZ3 A;  1X8H A;  1KR3 A;  4ZNB A;  2GFK A;  2FU8 A;  1KO2 A;  1VGN A;  5ACP A;  1JJT A;  3RKK A;  2BG8 A;  5AHR A;  3X2X A;  4YSB A;  4Z6X A;  5ACV A;  1X8I A;  1JJE A;  1DXK A;  4CHL A;  2E7Y A;  3DH8 A;  5KIL A;  3BK2 A;  5EWA A;  4J5H A;  5HIQ A;  3BV6 A;  5DPX A;  4FEK A;  2Y87 A;  3KNR A;  5FQC A;  5HIO A;  3IOG A;  2ZO4 A;  2BG6 A;  5AEB A;  3F9O A;  1ZTC A;  2ZWR A;  2BFK A;  1YCG A;  4V0H A;  2NYP A;  4RL2 A;  5EV8 A;  4KEQ A;  3X2Y A;  1A7T A;  3IOF A;  4Z5Y A;  4EFZ A;  4TYT A;  3T9M A;  2NXA A;  3L6N A;  3VPE A;  2OHJ A;  2YNU A;  2BFZ B;  5LCH A;  4AX1 B;  2CBN A;  5LM6 A;  2UYX A;  4UWS B;  5A5Z A;  2QDS A;  3IE1 A;  2BFL A;  1K07 A;  4C1E A;  2BG7 A;  2FHX B;  2I7V A;  3SRX A;  4D1U A;  3ZQ4 A;  4DIK A;  3ADR A;  4J5F A;  3AF5 A;  4PVT A;  3IE0 A;  5EVB A;  1DD6 A;  2I7T A;  4AD9 A;  5K0W A;  3I14 A;  1XTO A;  2GFJ A;  2QED A;  3JXP A;  3I11 A;  5K4K A;  3WXC A;  1WRA A;  3SPU A;  4WD6 A;  4EXY A;  1X8G A;  4GCW A;  3ZWF A;  3LVZ A;  4U4L A;  4D1W A;  4RL0 A;  2A7M A;  5FQB A;  5FQA A;  4AWY B;  2YNW A;  5HIS A;  3A4Y A;  2BTN A;  3H3E A;  4LE6 A;  1YCF A;  5LSC A;  4UA4 A;  2Y8A A;  1QH5 A;  1A8T A;  2AIO A;  3PY6 A;  3S0Z A;  2Q0I A;  3IEL A;  3X30 A;  4C1G A;  3ZNB A;  5EH9 A;  4YSL A;  5A0T A;  2BMI A;  5EVK A;  1ZNB A;  3KNS A;  5EW0 A;  4AWZ A;  4NQ5 A;  4HL2 A;  1XM8 A;  1BC2 A;  5IQK A;  2BC2 A;  3MD7 A;  4RAW A;  4HKY A;  4ZO3 A;  3QH8 A;  5LLD A;  5LCF A;  5ACR A;  3SD9 A;  2P1E A;  4NQ2 A;  3IEM A;  1ZKP A;  4EYL A;  3T3O A;  5EHT A;  5LE1 A;  5HH5 A;  2FHX A;  2NZE A;  4FSB A;  2M5D A;  4NQ6 A;  2YNT B;  4C1F A;  3PY5 A;  5A87 A;  1BVT A;  3AJ3 A;  2R2D A;  2Q0J A;  3P2U A;  1JT1 A;  3ESH A;  4UAM A;  2QDT A;  2WRS A;  2XF4 A;  4AX0 B;  4HL1 A;  2YNV B;  4GYU A;  4FR7 A;  4P62 A;  4UWR B;  3SFP A;  1HLK A;  5EVD A;  4NQ4 A;  2VW8 A;  2DOO A;  2ZNB A;  3IE2 A;  4UWO B;  2GCU A;  1BMC A;  1YCH A;  4Z67 A;  2BR6 A;  1M2X A;  4GYQ A;  2AZ4 A;  3FCZ A;  3DHA A;  1MQO A;  5LCA A;  2OHH A;  3I13 A;  3ZR9 A;  5ACW A;  1KO3 A;  3I15 A;  4O98 A;  2H6A A;  4BZ3 A;  3IEK A;  2GMN A;  3BK1 A;  4XWW A;  3IDZ A;  2FU6 A;  4Z7R A;  3KL7 A;  2FK6 A;  2I7X A;  2P4Z A;  4TYF A;  2M5C A;  5AYA A;  4D02 A;  4JO0 A;  4D1T A;  3RKJ A;  4XWT A;  4EXS A;  5LMC A;  2YCB A;  4Z60 A;  3RPC A;  4UWP B;  4F6H A;  5AHO A;  4RBS A;  1SML A;  5ACS A;  4C1C A;  5ACU A;  3FAI A;  5ACQ A;  4ZO2 A;  3SW3 A;  2NZF A;  1QH3 A;  4C1H A;  3I0V A;  2P18 A;  2WHG A;  5B1U A;  2QJS A;  2BG8 B;  3G1P A;  3SBL A;  2P97 A;  2YNT A;  3AF6 A;  2BFZ A;  2FU7 A;  2XR1 A;  4F6Z A;  5K4M A;  2QIN A;  1P9E A;  4B87 A;  1VJN A;  2Y8B A;  2BG2 A;  4EYF A;  2YNV A;  5EV6 A;  3DHB A;  5A0V A;  2Q42 A;  4KEP A;  2Q9U A;  4ZEJ A;  2WYL A;  5HH4 A;  3T3N A;  1E5D A;  5ACT A;  4PVO A;  3Q6V A;  4TZ9 A;  5ACX A;  4BP0 A;  4EY2 A;  1DDK A;  1WUO A;  3PG4 A;  4H0D A;  4C1D A;  4XUK A;  4D1V A;  5HIP A;  1WW1 A;  5AXR A;  4TZE A;  2DKF A;  5KIK A;  2FU9 A;  2OHI A;  2FM6 A;  2WYM A;  4C09 A;  1L9Y A;  4RM5 A;  4EYB A;  2HB9 A;  2GKL A;  2BIB A;  5LS3 A;  3VQZ A;  3DHC A;  4UBQ A;  5K4N A;  5B15 A;  1WUP A;  2BGA A;  5HH6 A;  1VME A;  3X2Z A;  1Y44 A;  2ZZI A;  2WYM C;  3TP9 A;  3BC2 A;  4YSK A;  5B3R A;  4TZF A;  4TZB A;  4Z5Z A;  5AXO A;  4RAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...