2P1EA

Crystal structure of the leishmania infantum glyoxalase ii with d-lactate at the active site
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
293
structure length
279
Chain Sequence
MRNYCTKTFGSAFSVTVVPTLKDNFSYLINDHTTHTLAAVDVNADYKPILTYIEEHLTYTFSTILSTHKHWDHSGGNAKLKAELVPVVVVGGANDSIPAVTKPVREGDRVQVGDLSVEVIDAPCHTRGHVLYKVQHPQHPNDGVALFTGDTMFIAGIGAFFEGDEKDMCRAMEKVYHIHKGNDYALDKVTFIFPGHEYTSGFMTFSEKTFPDRASDDLAFIQAQRAKYAAAVKTGDPSVPSSLAEEKRQNLFLRVADPAFVAKMNQGNAHALMMYLYNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glyoxalase II
publication title Catalysis and Structural Properties of Leishmania infantum Glyoxalase II: Trypanothione Specificity and Phylogeny.
pubmed doi rcsb
source organism Leishmania infantum
molecule tags Hydrolase
total genus 100
structure length 279
sequence length 293
ec nomenclature ec 3.1.2.6: Hydroxyacylglutathione hydrolase.
pdb deposition date 2007-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2p1eA00
2P18A 2BC2A 4UWSB 5EVDA 1K07A 4FEKA 5KILA 4Z67A 5AHOA 3PG4A 4B87A 2BMIA 3ZNBA 4GCWA 4C09A 5DPXA 4Z7RA 3PY6A 3Q6VA 2YNTA 4AX1B 2I7XA 1YCFA 4UWRB 2YNUA 3X2YA 4AX0B 1XM8A 2OHIA 5LMCA 2WYLA 5A0TA 1YCHA 3T3OA 3X30A 3X2XA 5LCFA 5HH6A 2YNVA 1XTOA 4P62A 1ZKPA 3KNRA 3IDZA 2CBNA 4D1VA 2H6AA 2XR1A 3L6NA 5K4NA 4J5FA 2BG7A 3IEKA 1A7TA 1A8TA 3RKKA 2WYMA 5ACSA 3ZWFA 4C1EA 3JXPA 4H0DA 4ZEJA 4RBSA 1MQOA 2ZZIA 3KNSA 4UWPB 4AD9A 2FU8A 2FM6A 2FHXB 3DHAA 4J5HA 4NQ2A 1WUOA 1DD6A 4XWWA 3WXCA 4KEPA 3VPEA 3BC2A 2QDTA 2HB9A 4UWOB 3AJ3A 5KIKA 4EFZA 5HH4A 5ACQA 4C1CA 3X2ZA 1BMCA 3A4YA 5K0WA 4AWYB 4Z5YA 3S0ZA 2Y87A 3TP9A 5EH9A 2E7YA 2Y8AA 3I15A 1L9YA 2BIBA 5ACVA 5AXOA 3DH8A 2BGAA 2P1EA 3IELA 3VQZA 2QEDA 4ZNBA 4TZFA 3ZQ4A 2QDSA 3IE1A 4RL0A 3I14A 2AZ4A 4D02A 1VGNA 5ACXA 3AF5A 3ZR9A 4TYFA 2I7TA 1KO3A 5HIOA 2NYPA 4XUKA 1VJNA 4JO0A 4GYQA 4TZ9A 2FHXA 2AIOA 5EVBA 3RKJA 4TZEA 2BFZA 4LE6A 3SBLA 1QH3A 1P9EA 2BFLA 5IQKA 2BG8A 4XWTA 2GFJA 4F6HA 4D1UA 5EWAA 2FU6A 3DHCA 5FQCA 5LS3A 4Z5ZA 2OHJA 4KEQA 5AYAA 3SFPA 2VW8A 4DILA 2BTNA 5LCHA 2R2DA 4D1WA 2FU9A 3H3EA 4TYTA 2YNTB 4ZO3A 1E5DA 4EYBA 4WD6A 3T3NA 2UYXA 1ZNBA 5HIQA 4Z60A 2FU7A 4V0HA 4EXYA 5EV8A 4BZ3A 4BP0A 4PVOA 1KR3A 5LE1A 3MD7A 2DOOA 1HLKA 2P97A 3G1PA 3QH8A 2YNVB 5B1UA 5A0VA 3FCZA 4AWZA 5K4MA 1DXKA 4C1DA 5AHRA 4NQ4A 1M2XA 3IE2A 4RAWA 1Y44A 2XF4A 2GMNA 2WYMC 3SRXA 4YSLA 3SPUA 4D1TA 1QH5A 2YNWA 3KL7A 3R2UA 4CHLA 5ACUA 2QINA 2OHHA 2GCUA 5LLDA 4UA4A 5EW0A 1VMEA 2ZWRA 1SMLA 2ZO4A 3SW3A 2Q0IA 5ACTA 4O98A 3I0VA 1JT1A 5EHTA 3IOFA 2BG6A 5FQAA 3ESHA 3ADRA 3RPCA 2Q0JA 1WUPA 3BV6A 5FQBA 5HH5A 1WRAA 2M5DA 4RM5A 4GYUA 4YSKA 5B15A 3SD9A 4PVTA 1BVTA 2FK6A 2A7MA 2QJSA 5A5ZA 3IE0A 4HKYA 2NZEA 4YSBA 4NQ5A 4U4LA 1X8HA 1X8GA 4EXSA 2Q42A 4Z6XA 2NZFA 4EYLA 2GKLA 5LCAA 1WW1A 3BK2A 1X8IA 5LM6A 4C1GA 4HL1A 2M5CA 5EVKA 3LVZA 2WRSA 2YZ3A 1JJEA 2BFKA 5HISA 4UAMA 5ACWA 4DIKA 4C1HA 4FR7A 4ZO2A 3DHBA 3I11A 5AEBA 3I13A 3PY5A 2WHGA 2I7VA 2BR6A 2Y8BA 1ZTCA 2ZNBA 4RL2A 5AXRA 2BG2A 4HL2A 5A87A 2BFZB 1YCGA 3BK1A 1JJTA 2BG8B 2YCBA 4FSBA 3IOGA 3P2UA 5ACPA 3FAIA 2Q9UA 5B3RA 5EV6A 1KO2A 3AF6A 4EYFA 3T9MA 4UBQA 1BC2A 5K4KA 5LSCA 2DKFA 4TZBA 4NQ6A 5HIPA 2GFKA 5ACRA 4EY2A 2P4ZA 3IEMA 4F6ZA 4C1FA 2NXAA 4RAMA 1DDKA 3F9OA
chains in the Genus database with same CATH superfamily
2P18A 2BC2A 4UWSB 5EVDA 1K07A 4FEKA 5KILA 4Z67A 4AXHA 5AHOA 3PG4A 4B87A 2BMIA 3ZNBA 4GCWA 4C09A 5DPXA 4Z7RA 3PY6A 3Q6VA 2YNTA 4AX1B 2I7XA 1YCFA 4UWRB 2YNUA 3X2YA 4AX0B 1XM8A 2OHIA 5LMCA 2WYLA 5A0TA 1YCHA 3T3OA 3X30A 3X2XA 5A23A 5LCFA 5HH6A 2YNVA 1XTOA 4P62A 1ZKPA 3KNRA 3IDZA 2CBNA 4D1VA 2H6AA 2XR1A 3L6NA 5K4NA 4J5FA 2BG7A 3IEKA 1A7TA 1A8TA 3RKKA 2WYMA 5ACSA 3ZWFA 4C1EA 3JXPA 4H0DA 4ZEJA 4RBSA 1MQOA 2ZZIA 3KNSA 4UWPB 4AD9A 2FU8A 2FM6A 2FHXB 3DHAA 4J5HA 4NQ2A 1WUOA 1DD6A 2CG2A 4XWWA 3WXCA 4KEPA 3VPEA 3BC2A 2QDTA 2HB9A 4UWOB 3AJ3A 5KIKA 4EFZA 5HH4A 5ACQA 4C1CA 3X2ZA 1BMCA 3A4YA 5K0WA 4AWYB 4Z5YA 3S0ZA 2Y87A 3TP9A 5EH9A 2E7YA 2Y8AA 3I15A 1L9YA 2BIBA 5ACVA 5AXOA 3DH8A 2BGAA 2P1EA 3IELA 3VQZA 2QEDA 4ZNBA 4TZFA 3ZQ4A 2QDSA 3IE1A 4RL0A 3I14A 2AZ4A 4D02A 1VGNA 5ACXA 3AF5A 5AIJA 3ZR9A 4TYFA 2I7TA 1KO3A 5HIOA 2NYPA 4XUKA 1VJNA 4JO0A 4GYQA 4TZ9A 2FHXA 2AIOA 5EVBA 3RKJA 4TZEA 2BFZA 4LE6A 3SBLA 1QH3A 1P9EA 2BFLA 5IQKA 2BG8A 4XWTA 2GFJA 4F6HA 4D1UA 5EWAA 2FU6A 3DHCA 5AJLA 5FQCA 5LS3A 4Z5ZA 2OHJA 4NURA 4KEQA 5AYAA 3SFPA 2VW8A 4DILA 2BTNA 5LCHA 2R2DA 4D1WA 2FU9A 3H3EA 4TYTA 2YNTB 2CFUA 4ZO3A 1E5DA 4EYBA 4WD6A 3T3NA 2UYXA 1ZNBA 5HIQA 4Z60A 2FU7A 4V0HA 4EXYA 2YHEA 5EV8A 4BZ3A 4BP0A 4PVOA 1KR3A 5LE1A 3MD7A 2DOOA 1HLKA 2P97A 3G1PA 3QH8A 2YNVB 5B1UA 4PDXA 5A0VA 3FCZA 4AWZA 5K4MA 1DXKA 4C1DA 2CG3A 5AHRA 4NQ4A 1M2XA 3IE2A 4RAWA 1Y44A 2XF4A 2GMNA 2WYMC 3SRXA 4YSLA 2CFZA 3SPUA 4D1TA 1QH5A 2YNWA 3KL7A 3R2UA 4CHLA 5ACUA 2QINA 2OHHA 2GCUA 5LLDA 4UA4A 5EW0A 1VMEA 2ZWRA 1SMLA 2ZO4A 3SW3A 2Q0IA 5ACTA 4O98A 3I0VA 1JT1A 5EHTA 3IOFA 2BG6A 5FQAA 3ESHA 3ADRA 3RPCA 2Q0JA 1WUPA 3BV6A 5FQBA 5HH5A 1WRAA 2M5DA 4RM5A 4GYUA 4YSKA 5B15A 3SD9A 4PVTA 1BVTA 2FK6A 2A7MA 2QJSA 5A5ZA 3IE0A 4HKYA 2NZEA 4YSBA 4NQ5A 4U4LA 1X8HA 1X8GA 4EXSA 2Q42A 4Z6XA 2NZFA 4EYLA 2GKLA 5LCAA 1WW1A 3BK2A 1X8IA 5LM6A 4C1GA 4HL1A 2M5CA 5EVKA 3LVZA 2WRSA 2YZ3A 1JJEA 2BFKA 5HISA 4UAMA 5ACWA 4DIKA 4C1HA 4FR7A 4ZO2A 3DHBA 3I11A 5AEBA 3I13A 3PY5A 2WHGA 2I7VA 2BR6A 2Y8BA 1ZTCA 2ZNBA 4RL2A 4AV7A 5AXRA 2BG2A 4HL2A 5A87A 2BFZB 1YCGA 3BK1A 1JJTA 2BG8B 2YCBA 4FSBA 3IOGA 3P2UA 5ACPA 3FAIA 2Q9UA 5B3RA 5EV6A 1KO2A 3AF6A 3T9MA 4UBQA 4EYFA 1BC2A 5K4KA 5LSCA 2DKFA 4TZBA 4NQ6A 5HIPA 2GFKA 5ACRA 4EY2A 2P4ZA 3IEMA 4F6ZA 4C1FA 2NXAA 4RAMA 1DDKA 3F9OA
chains in the Genus database with same CATH topology
2P18A 2BC2A 4UWSB 5EVDA 1K07A 4FEKA 5KILA 4Z67A 5AHOA 3PG4A 4B87A 2BMIA 3ZNBA 4GCWA 4C09A 5DPXA 4Z7RA 3PY6A 3Q6VA 2YNTA 4AX1B 2I7XA 1YCFA 4UWRB 2YNUA 3X2YA 4AX0B 1XM8A 2OHIA 5LMCA 2WYLA 5A0TA 1YCHA 3T3OA 3X30A 3X2XA 5LCFA 5HH6A 2YNVA 1XTOA 4P62A 1ZKPA 3KNRA 3IDZA 2CBNA 4D1VA 2H6AA 2XR1A 3L6NA 5K4NA 4J5FA 2BG7A 3IEKA 1A7TA 1A8TA 3RKKA 2WYMA 5ACSA 3ZWFA 4C1EA 3JXPA 4H0DA 4ZEJA 4RBSA 1MQOA 2ZZIA 3KNSA 4UWPB 4AD9A 2FU8A 2FM6A 2FHXB 3DHAA 4J5HA 4NQ2A 1WUOA 1DD6A 4XWWA 3WXCA 4KEPA 3VPEA 3BC2A 2QDTA 2HB9A 4UWOB 3AJ3A 5KIKA 4EFZA 5HH4A 5ACQA 4C1CA 3X2ZA 1BMCA 3A4YA 5K0WA 4AWYB 4Z5YA 3S0ZA 2Y87A 3TP9A 5EH9A 2E7YA 2Y8AA 3I15A 1L9YA 2BIBA 5ACVA 5AXOA 3DH8A 2BGAA 2P1EA 3IELA 3VQZA 2QEDA 4ZNBA 4TZFA 3ZQ4A 2QDSA 3IE1A 4RL0A 3I14A 2AZ4A 4D02A 1VGNA 5ACXA 3AF5A 3ZR9A 4TYFA 2I7TA 1KO3A 5HIOA 2NYPA 4XUKA 1VJNA 4JO0A 4GYQA 4TZ9A 2FHXA 2AIOA 5EVBA 3RKJA 4TZEA 2BFZA 4LE6A 3SBLA 1QH3A 1P9EA 2BFLA 5IQKA 2BG8A 4XWTA 2GFJA 4F6HA 4D1UA 5EWAA 2FU6A 3DHCA 5FQCA 5LS3A 4Z5ZA 2OHJA 4KEQA 5AYAA 3SFPA 2VW8A 4DILA 2BTNA 5LCHA 2R2DA 4D1WA 2FU9A 3H3EA 4TYTA 2YNTB 4ZO3A 1E5DA 4EYBA 4WD6A 3T3NA 2UYXA 1ZNBA 5HIQA 4Z60A 2FU7A 4V0HA 4EXYA 5EV8A 4BZ3A 4BP0A 4PVOA 1KR3A 5LE1A 3MD7A 2DOOA 1HLKA 2P97A 3G1PA 3QH8A 2YNVB 5B1UA 5A0VA 3FCZA 4AWZA 5K4MA 1DXKA 4C1DA 5AHRA 4NQ4A 1M2XA 3IE2A 4RAWA 1Y44A 2XF4A 2GMNA 2WYMC 3SRXA 4YSLA 3SPUA 4D1TA 1QH5A 2YNWA 3KL7A 3R2UA 4CHLA 5ACUA 2QINA 2OHHA 2GCUA 5LLDA 4UA4A 5EW0A 1VMEA 2ZWRA 1SMLA 2ZO4A 3SW3A 2Q0IA 5ACTA 4O98A 3I0VA 1JT1A 5EHTA 3IOFA 2BG6A 5FQAA 3ESHA 3ADRA 3RPCA 2Q0JA 1WUPA 3BV6A 5FQBA 5HH5A 1WRAA 2M5DA 4RM5A 4GYUA 4YSKA 5B15A 3SD9A 4PVTA 1BVTA 2FK6A 2A7MA 2QJSA 5A5ZA 3IE0A 4HKYA 2NZEA 4YSBA 4NQ5A 4U4LA 1X8HA 1X8GA 4EXSA 2Q42A 4Z6XA 2NZFA 4EYLA 2GKLA 5LCAA 1WW1A 3BK2A 1X8IA 5LM6A 4C1GA 4HL1A 2M5CA 5EVKA 3LVZA 2WRSA 2YZ3A 1JJEA 2BFKA 5HISA 4UAMA 5ACWA 4DIKA 4C1HA 4FR7A 4ZO2A 3DHBA 3I11A 5AEBA 3I13A 3PY5A 2WHGA 2I7VA 2BR6A 2Y8BA 1ZTCA 2ZNBA 4RL2A 5AXRA 2BG2A 4HL2A 5A87A 2BFZB 1YCGA 3BK1A 1JJTA 2BG8B 2YCBA 4FSBA 3IOGA 3P2UA 5ACPA 3FAIA 2Q9UA 5B3RA 5EV6A 1KO2A 3AF6A 4EYFA 3T9MA 4UBQA 1BC2A 5K4KA 5LSCA 2DKFA 4TZBA 4NQ6A 5HIPA 2GFKA 5ACRA 4EY2A 2P4ZA 3IEMA 4F6ZA 4C1FA 2NXAA 4RAMA 1DDKA 3F9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P18 A;  2BC2 A;  4UWS B;  5EVD A;  1K07 A;  4FEK A;  5KIL A;  4Z67 A;  5AHO A;  3PG4 A;  4B87 A;  2BMI A;  3ZNB A;  4GCW A;  4C09 A;  5DPX A;  4Z7R A;  3PY6 A;  3Q6V A;  2YNT A;  4AX1 B;  2I7X A;  1YCF A;  4UWR B;  2YNU A;  3X2Y A;  4AX0 B;  1XM8 A;  2OHI A;  5LMC A;  2WYL A;  5A0T A;  1YCH A;  3T3O A;  3X30 A;  3X2X A;  5LCF A;  5HH6 A;  2YNV A;  1XTO A;  4P62 A;  1ZKP A;  3KNR A;  3IDZ A;  2CBN A;  4D1V A;  2H6A A;  2XR1 A;  3L6N A;  5K4N A;  4J5F A;  2BG7 A;  3IEK A;  1A7T A;  1A8T A;  3RKK A;  2WYM A;  5ACS A;  3ZWF A;  4C1E A;  3JXP A;  4H0D A;  4ZEJ A;  4RBS A;  1MQO A;  2ZZI A;  3KNS A;  4UWP B;  4AD9 A;  2FU8 A;  2FM6 A;  2FHX B;  3DHA A;  4J5H A;  4NQ2 A;  1WUO A;  1DD6 A;  4XWW A;  3WXC A;  4KEP A;  3VPE A;  3BC2 A;  2QDT A;  2HB9 A;  4UWO B;  3AJ3 A;  5KIK A;  4EFZ A;  5HH4 A;  5ACQ A;  4C1C A;  3X2Z A;  1BMC A;  3A4Y A;  5K0W A;  4AWY B;  4Z5Y A;  3S0Z A;  2Y87 A;  3TP9 A;  5EH9 A;  2E7Y A;  2Y8A A;  3I15 A;  1L9Y A;  2BIB A;  5ACV A;  5AXO A;  3DH8 A;  2BGA A;  2P1E A;  3IEL A;  3VQZ A;  2QED A;  4ZNB A;  4TZF A;  3ZQ4 A;  2QDS A;  3IE1 A;  4RL0 A;  3I14 A;  2AZ4 A;  4D02 A;  1VGN A;  5ACX A;  3AF5 A;  3ZR9 A;  4TYF A;  2I7T A;  1KO3 A;  5HIO A;  2NYP A;  4XUK A;  1VJN A;  4JO0 A;  4GYQ A;  4TZ9 A;  2FHX A;  2AIO A;  5EVB A;  3RKJ A;  4TZE A;  2BFZ A;  4LE6 A;  3SBL A;  1QH3 A;  1P9E A;  2BFL A;  5IQK A;  2BG8 A;  4XWT A;  2GFJ A;  4F6H A;  4D1U A;  5EWA A;  2FU6 A;  3DHC A;  5FQC A;  5LS3 A;  4Z5Z A;  2OHJ A;  4KEQ A;  5AYA A;  3SFP A;  2VW8 A;  4DIL A;  2BTN A;  5LCH A;  2R2D A;  4D1W A;  2FU9 A;  3H3E A;  4TYT A;  2YNT B;  4ZO3 A;  1E5D A;  4EYB A;  4WD6 A;  3T3N A;  2UYX A;  1ZNB A;  5HIQ A;  4Z60 A;  2FU7 A;  4V0H A;  4EXY A;  5EV8 A;  4BZ3 A;  4BP0 A;  4PVO A;  1KR3 A;  5LE1 A;  3MD7 A;  2DOO A;  1HLK A;  2P97 A;  3G1P A;  3QH8 A;  2YNV B;  5B1U A;  5A0V A;  3FCZ A;  4AWZ A;  5K4M A;  1DXK A;  4C1D A;  5AHR A;  4NQ4 A;  1M2X A;  3IE2 A;  4RAW A;  1Y44 A;  2XF4 A;  2GMN A;  2WYM C;  3SRX A;  4YSL A;  3SPU A;  4D1T A;  1QH5 A;  2YNW A;  3KL7 A;  3R2U A;  4CHL A;  5ACU A;  2QIN A;  2OHH A;  2GCU A;  5LLD A;  4UA4 A;  5EW0 A;  1VME A;  2ZWR A;  1SML A;  2ZO4 A;  3SW3 A;  2Q0I A;  5ACT A;  4O98 A;  3I0V A;  1JT1 A;  5EHT A;  3IOF A;  2BG6 A;  5FQA A;  3ESH A;  3ADR A;  3RPC A;  2Q0J A;  1WUP A;  3BV6 A;  5FQB A;  5HH5 A;  1WRA A;  2M5D A;  4RM5 A;  4GYU A;  4YSK A;  5B15 A;  3SD9 A;  4PVT A;  1BVT A;  2FK6 A;  2A7M A;  2QJS A;  5A5Z A;  3IE0 A;  4HKY A;  2NZE A;  4YSB A;  4NQ5 A;  4U4L A;  1X8H A;  1X8G A;  4EXS A;  2Q42 A;  4Z6X A;  2NZF A;  4EYL A;  2GKL A;  5LCA A;  1WW1 A;  3BK2 A;  1X8I A;  5LM6 A;  4C1G A;  4HL1 A;  2M5C A;  5EVK A;  3LVZ A;  2WRS A;  2YZ3 A;  1JJE A;  2BFK A;  5HIS A;  4UAM A;  5ACW A;  4DIK A;  4C1H A;  4FR7 A;  4ZO2 A;  3DHB A;  3I11 A;  5AEB A;  3I13 A;  3PY5 A;  2WHG A;  2I7V A;  2BR6 A;  2Y8B A;  1ZTC A;  2ZNB A;  4RL2 A;  5AXR A;  2BG2 A;  4HL2 A;  5A87 A;  2BFZ B;  1YCG A;  3BK1 A;  1JJT A;  2BG8 B;  2YCB A;  4FSB A;  3IOG A;  3P2U A;  5ACP A;  3FAI A;  2Q9U A;  5B3R A;  5EV6 A;  1KO2 A;  3AF6 A;  4EYF A;  3T9M A;  4UBQ A;  1BC2 A;  5K4K A;  5LSC A;  2DKF A;  4TZB A;  4NQ6 A;  5HIP A;  2GFK A;  5ACR A;  4EY2 A;  2P4Z A;  3IEM A;  4F6Z A;  4C1F A;  2NXA A;  4RAM A;  1DDK A;  3F9O A; 
#chains in the Genus database with same CATH topology
 2P18 A;  2BC2 A;  4UWS B;  5EVD A;  1K07 A;  4FEK A;  5KIL A;  4Z67 A;  4AXH A;  5AHO A;  3PG4 A;  4B87 A;  2BMI A;  3ZNB A;  4GCW A;  4C09 A;  5DPX A;  4Z7R A;  3PY6 A;  3Q6V A;  2YNT A;  4AX1 B;  2I7X A;  1YCF A;  4UWR B;  2YNU A;  3X2Y A;  4AX0 B;  1XM8 A;  2OHI A;  5LMC A;  2WYL A;  5A0T A;  1YCH A;  3T3O A;  3X30 A;  3X2X A;  5A23 A;  5LCF A;  5HH6 A;  2YNV A;  1XTO A;  4P62 A;  1ZKP A;  3KNR A;  3IDZ A;  2CBN A;  4D1V A;  2H6A A;  2XR1 A;  3L6N A;  5K4N A;  4J5F A;  2BG7 A;  3IEK A;  1A7T A;  1A8T A;  3RKK A;  2WYM A;  5ACS A;  3ZWF A;  4C1E A;  3JXP A;  4H0D A;  4ZEJ A;  4RBS A;  1MQO A;  2ZZI A;  3KNS A;  4UWP B;  4AD9 A;  2FU8 A;  2FM6 A;  2FHX B;  3DHA A;  4J5H A;  4NQ2 A;  1WUO A;  1DD6 A;  2CG2 A;  4XWW A;  3WXC A;  4KEP A;  3VPE A;  3BC2 A;  2QDT A;  2HB9 A;  4UWO B;  3AJ3 A;  5KIK A;  4EFZ A;  5HH4 A;  5ACQ A;  4C1C A;  3X2Z A;  1BMC A;  3A4Y A;  5K0W A;  4AWY B;  4Z5Y A;  3S0Z A;  2Y87 A;  3TP9 A;  5EH9 A;  2E7Y A;  2Y8A A;  3I15 A;  1L9Y A;  2BIB A;  5ACV A;  5AXO A;  3DH8 A;  2BGA A;  2P1E A;  3IEL A;  3VQZ A;  2QED A;  4ZNB A;  4TZF A;  3ZQ4 A;  2QDS A;  3IE1 A;  4RL0 A;  3I14 A;  2AZ4 A;  4D02 A;  1VGN A;  5ACX A;  3AF5 A;  5AIJ A;  3ZR9 A;  4TYF A;  2I7T A;  1KO3 A;  5HIO A;  2NYP A;  4XUK A;  1VJN A;  4JO0 A;  4GYQ A;  4TZ9 A;  2FHX A;  2AIO A;  5EVB A;  3RKJ A;  4TZE A;  2BFZ A;  4LE6 A;  3SBL A;  1QH3 A;  1P9E A;  2BFL A;  5IQK A;  2BG8 A;  4XWT A;  2GFJ A;  4F6H A;  4D1U A;  5EWA A;  2FU6 A;  3DHC A;  5AJL A;  5FQC A;  5LS3 A;  4Z5Z A;  2OHJ A;  4NUR A;  4KEQ A;  5AYA A;  3SFP A;  2VW8 A;  4DIL A;  2BTN A;  5LCH A;  2R2D A;  4D1W A;  2FU9 A;  3H3E A;  4TYT A;  2YNT B;  2CFU A;  4ZO3 A;  1E5D A;  4EYB A;  4WD6 A;  3T3N A;  2UYX A;  1ZNB A;  5HIQ A;  4Z60 A;  2FU7 A;  4V0H A;  4EXY A;  2YHE A;  5EV8 A;  4BZ3 A;  4BP0 A;  4PVO A;  1KR3 A;  5LE1 A;  3MD7 A;  2DOO A;  1HLK A;  2P97 A;  3G1P A;  3QH8 A;  2YNV B;  5B1U A;  4PDX A;  5A0V A;  3FCZ A;  4AWZ A;  5K4M A;  1DXK A;  4C1D A;  2CG3 A;  5AHR A;  4NQ4 A;  1M2X A;  3IE2 A;  4RAW A;  1Y44 A;  2XF4 A;  2GMN A;  2WYM C;  3SRX A;  4YSL A;  2CFZ A;  3SPU A;  4D1T A;  1QH5 A;  2YNW A;  3KL7 A;  3R2U A;  4CHL A;  5ACU A;  2QIN A;  2OHH A;  2GCU A;  5LLD A;  4UA4 A;  5EW0 A;  1VME A;  2ZWR A;  1SML A;  2ZO4 A;  3SW3 A;  2Q0I A;  5ACT A;  4O98 A;  3I0V A;  1JT1 A;  5EHT A;  3IOF A;  2BG6 A;  5FQA A;  3ESH A;  3ADR A;  3RPC A;  2Q0J A;  1WUP A;  3BV6 A;  5FQB A;  5HH5 A;  1WRA A;  2M5D A;  4RM5 A;  4GYU A;  4YSK A;  5B15 A;  3SD9 A;  4PVT A;  1BVT A;  2FK6 A;  2A7M A;  2QJS A;  5A5Z A;  3IE0 A;  4HKY A;  2NZE A;  4YSB A;  4NQ5 A;  4U4L A;  1X8H A;  1X8G A;  4EXS A;  2Q42 A;  4Z6X A;  2NZF A;  4EYL A;  2GKL A;  5LCA A;  1WW1 A;  3BK2 A;  1X8I A;  5LM6 A;  4C1G A;  4HL1 A;  2M5C A;  5EVK A;  3LVZ A;  2WRS A;  2YZ3 A;  1JJE A;  2BFK A;  5HIS A;  4UAM A;  5ACW A;  4DIK A;  4C1H A;  4FR7 A;  4ZO2 A;  3DHB A;  3I11 A;  5AEB A;  3I13 A;  3PY5 A;  2WHG A;  2I7V A;  2BR6 A;  2Y8B A;  1ZTC A;  2ZNB A;  4RL2 A;  4AV7 A;  5AXR A;  2BG2 A;  4HL2 A;  5A87 A;  2BFZ B;  1YCG A;  3BK1 A;  1JJT A;  2BG8 B;  2YCB A;  4FSB A;  3IOG A;  3P2U A;  5ACP A;  3FAI A;  2Q9U A;  5B3R A;  5EV6 A;  1KO2 A;  3AF6 A;  3T9M A;  4UBQ A;  4EYF A;  1BC2 A;  5K4K A;  5LSC A;  2DKF A;  4TZB A;  4NQ6 A;  5HIP A;  2GFK A;  5ACR A;  4EY2 A;  2P4Z A;  3IEM A;  4F6Z A;  4C1F A;  2NXA A;  4RAM A;  1DDK A;  3F9O A; 
#chains in the Genus database with same CATH homology
 2P18 A;  2BC2 A;  4UWS B;  5EVD A;  1K07 A;  4FEK A;  5KIL A;  4Z67 A;  5AHO A;  3PG4 A;  4B87 A;  2BMI A;  3ZNB A;  4GCW A;  4C09 A;  5DPX A;  4Z7R A;  3PY6 A;  3Q6V A;  2YNT A;  4AX1 B;  2I7X A;  1YCF A;  4UWR B;  2YNU A;  3X2Y A;  4AX0 B;  1XM8 A;  2OHI A;  5LMC A;  2WYL A;  5A0T A;  1YCH A;  3T3O A;  3X30 A;  3X2X A;  5LCF A;  5HH6 A;  2YNV A;  1XTO A;  4P62 A;  1ZKP A;  3KNR A;  3IDZ A;  2CBN A;  4D1V A;  2H6A A;  2XR1 A;  3L6N A;  5K4N A;  4J5F A;  2BG7 A;  3IEK A;  1A7T A;  1A8T A;  3RKK A;  2WYM A;  5ACS A;  3ZWF A;  4C1E A;  3JXP A;  4H0D A;  4ZEJ A;  4RBS A;  1MQO A;  2ZZI A;  3KNS A;  4UWP B;  4AD9 A;  2FU8 A;  2FM6 A;  2FHX B;  3DHA A;  4J5H A;  4NQ2 A;  1WUO A;  1DD6 A;  4XWW A;  3WXC A;  4KEP A;  3VPE A;  3BC2 A;  2QDT A;  2HB9 A;  4UWO B;  3AJ3 A;  5KIK A;  4EFZ A;  5HH4 A;  5ACQ A;  4C1C A;  3X2Z A;  1BMC A;  3A4Y A;  5K0W A;  4AWY B;  4Z5Y A;  3S0Z A;  2Y87 A;  3TP9 A;  5EH9 A;  2E7Y A;  2Y8A A;  3I15 A;  1L9Y A;  2BIB A;  5ACV A;  5AXO A;  3DH8 A;  2BGA A;  2P1E A;  3IEL A;  3VQZ A;  2QED A;  4ZNB A;  4TZF A;  3ZQ4 A;  2QDS A;  3IE1 A;  4RL0 A;  3I14 A;  2AZ4 A;  4D02 A;  1VGN A;  5ACX A;  3AF5 A;  3ZR9 A;  4TYF A;  2I7T A;  1KO3 A;  5HIO A;  2NYP A;  4XUK A;  1VJN A;  4JO0 A;  4GYQ A;  4TZ9 A;  2FHX A;  2AIO A;  5EVB A;  3RKJ A;  4TZE A;  2BFZ A;  4LE6 A;  3SBL A;  1QH3 A;  1P9E A;  2BFL A;  5IQK A;  2BG8 A;  4XWT A;  2GFJ A;  4F6H A;  4D1U A;  5EWA A;  2FU6 A;  3DHC A;  5FQC A;  5LS3 A;  4Z5Z A;  2OHJ A;  4KEQ A;  5AYA A;  3SFP A;  2VW8 A;  4DIL A;  2BTN A;  5LCH A;  2R2D A;  4D1W A;  2FU9 A;  3H3E A;  4TYT A;  2YNT B;  4ZO3 A;  1E5D A;  4EYB A;  4WD6 A;  3T3N A;  2UYX A;  1ZNB A;  5HIQ A;  4Z60 A;  2FU7 A;  4V0H A;  4EXY A;  5EV8 A;  4BZ3 A;  4BP0 A;  4PVO A;  1KR3 A;  5LE1 A;  3MD7 A;  2DOO A;  1HLK A;  2P97 A;  3G1P A;  3QH8 A;  2YNV B;  5B1U A;  5A0V A;  3FCZ A;  4AWZ A;  5K4M A;  1DXK A;  4C1D A;  5AHR A;  4NQ4 A;  1M2X A;  3IE2 A;  4RAW A;  1Y44 A;  2XF4 A;  2GMN A;  2WYM C;  3SRX A;  4YSL A;  3SPU A;  4D1T A;  1QH5 A;  2YNW A;  3KL7 A;  3R2U A;  4CHL A;  5ACU A;  2QIN A;  2OHH A;  2GCU A;  5LLD A;  4UA4 A;  5EW0 A;  1VME A;  2ZWR A;  1SML A;  2ZO4 A;  3SW3 A;  2Q0I A;  5ACT A;  4O98 A;  3I0V A;  1JT1 A;  5EHT A;  3IOF A;  2BG6 A;  5FQA A;  3ESH A;  3ADR A;  3RPC A;  2Q0J A;  1WUP A;  3BV6 A;  5FQB A;  5HH5 A;  1WRA A;  2M5D A;  4RM5 A;  4GYU A;  4YSK A;  5B15 A;  3SD9 A;  4PVT A;  1BVT A;  2FK6 A;  2A7M A;  2QJS A;  5A5Z A;  3IE0 A;  4HKY A;  2NZE A;  4YSB A;  4NQ5 A;  4U4L A;  1X8H A;  1X8G A;  4EXS A;  2Q42 A;  4Z6X A;  2NZF A;  4EYL A;  2GKL A;  5LCA A;  1WW1 A;  3BK2 A;  1X8I A;  5LM6 A;  4C1G A;  4HL1 A;  2M5C A;  5EVK A;  3LVZ A;  2WRS A;  2YZ3 A;  1JJE A;  2BFK A;  5HIS A;  4UAM A;  5ACW A;  4DIK A;  4C1H A;  4FR7 A;  4ZO2 A;  3DHB A;  3I11 A;  5AEB A;  3I13 A;  3PY5 A;  2WHG A;  2I7V A;  2BR6 A;  2Y8B A;  1ZTC A;  2ZNB A;  4RL2 A;  5AXR A;  2BG2 A;  4HL2 A;  5A87 A;  2BFZ B;  1YCG A;  3BK1 A;  1JJT A;  2BG8 B;  2YCB A;  4FSB A;  3IOG A;  3P2U A;  5ACP A;  3FAI A;  2Q9U A;  5B3R A;  5EV6 A;  1KO2 A;  3AF6 A;  4EYF A;  3T9M A;  4UBQ A;  1BC2 A;  5K4K A;  5LSC A;  2DKF A;  4TZB A;  4NQ6 A;  5HIP A;  2GFK A;  5ACR A;  4EY2 A;  2P4Z A;  3IEM A;  4F6Z A;  4C1F A;  2NXA A;  4RAM A;  1DDK A;  3F9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...