5EWAA

Crystal structure of the metallo-beta-lactamase imp-1 in complex with the bisthiazolidine inhibitor l-vc26
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
219
structure length
219
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase IMP-1
publication title Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
pubmed doi rcsb
source organism Serratia marcescens
total genus 66
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5ewaA00
2BG2A 2Y8AA 5B15A 3AF5A 4UAMA 2CBNA 2WYLA 2BFZB 4NQ4A 4LE6A 3AJ3A 2YNVB 2XF4A 4FEKA 3I14A 2QJSA 2I7TA 3I0VA 4D02A 5DPXA 5HIPA 2Q9UA 3T3OA 4YSLA 3X2XA 1DXKA 2YCBA 4FSBA 3L6NA 4Z5YA 3R2UA 3BC2A 2BTNA 3VQZA 3IE1A 3SRXA 2BR6A 2P97A 4UWPB 3RKKA 4TZFA 1VGNA 4C1DA 4CHLA 2P18A 2NYPA 4FR7A 2Q0IA 3X2YA 3ZNBA 4ZO2A 3SFPA 2ZZIA 4GYQA 4TYTA 2FU7A 2A7MA 5EHTA 4BZ3A 3S0ZA 2ZWRA 2FHXA 1DDKA 4EXYA 3DHAA 3ZR9A 1VMEA 1MQOA 1XM8A 5ACSA 4XUKA 3FAIA 4PVOA 2OHJA 4Z6XA 4Z5ZA 5B3RA 1E5DA 5A0TA 5FQAA 3Q6VA 2M5CA 4RL0A 3WXCA 5EV8A 2FU8A 2WYMC 1BVTA 4C1EA 4HL2A 3SW3A 3ADRA 3IDZA 4GYUA 4D1UA 5HH5A 5ACVA 5LCAA 2BIBA 4AWYB 4TYFA 2FU9A 3F9OA 3BV6A 5KILA 2YNTA 1JJEA 3I11A 4EY2A 4J5HA 4UWRB 4NQ6A 5AXRA 1YCHA 1SMLA 3ESHA 3RPCA 2QINA 5HISA 2Q42A 3I15A 2Y8BA 3G1PA 3IOGA 3ZWFA 4ZNBA 2BG8A 3LVZA 1ZNBA 4C09A 2WRSA 4C1GA 2WHGA 4PVTA 1KR3A 2FHXB 2GKLA 1M2XA 5LCHA 3AF6A 1X8GA 2DKFA 1YCGA 4O98A 3I13A 4V0HA 4KEPA 1KO3A 3KNRA 5AYAA 5A87A 5ACRA 2M5DA 4J5FA 4XWWA 1WRAA 4F6ZA 4NQ2A 1BMCA 4U4LA 5HIQA 5EVDA 5K0WA 4D1TA 2BG7A 2VW8A 4C1HA 1X8IA 3IE2A 2YNWA 2FM6A 3KNSA 2BFKA 1WW1A 2H6AA 2Y87A 2YNTB 3ZQ4A 3X30A 2R2DA 2YNUA 4UA4A 1QH5A 4EYBA 4EYLA 1A8TA 5LSCA 4RAMA 1P9EA 5K4NA 4RBSA 2BGAA 2QDTA 1ZKPA 4C1CA 2BG8B 1YCFA 5EV6A 2ZO4A 5LCFA 3MD7A 1A7TA 4ZO3A 3TP9A 5AXOA 3FCZA 2P4ZA 3BK2A 3IOFA 4P62A 4RAWA 2I7XA 1WUOA 5ACTA 5LE1A 2P1EA 5LS3A 4ZEJA 4UWOB 2QEDA 4AD9A 5EW0A 4TZ9A 5ACPA 4Z7RA 2E7YA 5FQBA 5ACXA 2FK6A 1ZTCA 2NZFA 4DILA 4RL2A 3DHBA 3QH8A 4Z67A 4D1VA 2OHIA 2GFJA 4D1WA 3JXPA 2BG6A 1HLKA 1JJTA 4AX0B 2ZNBA 2XR1A 3DH8A 4EYFA 1Y44A 2NXAA 2AIOA 4KEQA 1X8HA 2FU6A 3A4YA 5KIKA 5ACWA 5HH6A 5HH4A 5EWAA 3IEMA 2QDSA 2YZ3A 5EVBA 2AZ4A 5IQKA 1K07A 1VJNA 2UYXA 3H3EA 5K4KA 1DD6A 2I7VA 2Q0JA 5EVKA 4TZEA 5LMCA 3KL7A 5HIOA 3SD9A 4C1FA 2BFZA 3IE0A 3IELA 4TZBA 2YNVA 4XWTA 1KO2A 1L9YA 3T3NA 5LLDA 3P2UA 2GMNA 3PY6A 2BFLA 1WUPA 3IEKA 3BK1A 5K4MA 5A0VA 5EH9A 4BP0A 5ACQA 5A5ZA 1JT1A 4UWSB 2BMIA 4F6HA 3T9MA 2BC2A 4YSBA 4EXSA 4WD6A 3VPEA 5FQCA 4NQ5A 5AHOA 4Z60A 3PY5A 4EFZA 3DHCA 5LM6A 2GFKA 4RM5A 4YSKA 1XTOA 2DOOA 2NZEA 4H0DA 3SPUA 5B1UA 4AX1B 4GCWA 1QH3A 1BC2A 2GCUA 3X2ZA 4B87A 5AEBA 3PG4A 4HL1A 4DIKA 4HKYA 3SBLA 5ACUA 4AWZA 3RKJA 4UBQA 2OHHA 4JO0A 2HB9A 2WYMA 5AHRA
chains in the Genus database with same CATH superfamily
2BG2A 2Y8AA 5B15A 3AF5A 4UAMA 2CBNA 2WYLA 2BFZB 4NQ4A 4LE6A 3AJ3A 2YNVB 2XF4A 4FEKA 3I14A 2QJSA 2I7TA 3I0VA 4D02A 5DPXA 5HIPA 2Q9UA 3T3OA 4YSLA 3X2XA 1DXKA 2YCBA 4FSBA 3L6NA 4Z5YA 3R2UA 3BC2A 2BTNA 3VQZA 3IE1A 3SRXA 2BR6A 2P97A 4UWPB 3RKKA 4TZFA 1VGNA 4C1DA 4CHLA 2P18A 2NYPA 4NURA 4FR7A 2Q0IA 4PDXA 3X2YA 3ZNBA 4ZO2A 3SFPA 2ZZIA 4GYQA 4TYTA 2FU7A 2A7MA 5EHTA 4BZ3A 3S0ZA 2ZWRA 2FHXA 1DDKA 4EXYA 3DHAA 3ZR9A 1VMEA 1MQOA 1XM8A 5ACSA 4XUKA 3FAIA 4PVOA 2OHJA 4Z6XA 4Z5ZA 5B3RA 1E5DA 5A0TA 5FQAA 3Q6VA 2M5CA 4RL0A 3WXCA 5EV8A 2FU8A 2WYMC 1BVTA 4C1EA 4HL2A 3SW3A 3ADRA 3IDZA 4GYUA 4D1UA 5HH5A 5ACVA 5LCAA 2BIBA 4AWYB 4TYFA 2FU9A 3F9OA 3BV6A 5KILA 2YNTA 1JJEA 3I11A 4EY2A 4J5HA 4UWRB 4NQ6A 5AXRA 1YCHA 1SMLA 3ESHA 3RPCA 2QINA 5HISA 2Q42A 3I15A 2Y8BA 3G1PA 3IOGA 3ZWFA 4ZNBA 2BG8A 3LVZA 1ZNBA 4C09A 2WRSA 4C1GA 2WHGA 4PVTA 1KR3A 2FHXB 2GKLA 1M2XA 5LCHA 3AF6A 1X8GA 2DKFA 2CFZA 1YCGA 4O98A 3I13A 4V0HA 4KEPA 1KO3A 3KNRA 5AYAA 5A87A 5ACRA 2M5DA 2CG2A 4J5FA 2YHEA 4XWWA 1WRAA 4F6ZA 4NQ2A 1BMCA 4U4LA 5HIQA 5EVDA 5K0WA 4D1TA 2BG7A 2VW8A 4C1HA 1X8IA 3IE2A 2YNWA 5AJLA 2FM6A 3KNSA 2BFKA 1WW1A 2H6AA 2Y87A 2YNTB 3ZQ4A 3X30A 2R2DA 2YNUA 4UA4A 1QH5A 4EYBA 4EYLA 1A8TA 5LSCA 4RAMA 1P9EA 5K4NA 4RBSA 2BGAA 2QDTA 1ZKPA 4C1CA 2BG8B 1YCFA 5EV6A 2ZO4A 5LCFA 3MD7A 1A7TA 4ZO3A 3TP9A 5AXOA 3FCZA 2P4ZA 3BK2A 3IOFA 4P62A 4RAWA 2I7XA 1WUOA 5ACTA 5LE1A 2P1EA 5LS3A 4ZEJA 4UWOB 2QEDA 4AD9A 5EW0A 4TZ9A 5ACPA 4Z7RA 2E7YA 2CG3A 5FQBA 5ACXA 2FK6A 1ZTCA 2NZFA 4DILA 4RL2A 3DHBA 3QH8A 4Z67A 4D1VA 4AV7A 2OHIA 2GFJA 4D1WA 3JXPA 2BG6A 1HLKA 1JJTA 4AX0B 2ZNBA 2XR1A 3DH8A 4EYFA 5AIJA 1Y44A 2NXAA 2AIOA 4KEQA 1X8HA 2FU6A 3A4YA 5KIKA 5ACWA 5HH6A 5HH4A 5EWAA 3IEMA 2QDSA 2YZ3A 5EVBA 2AZ4A 5IQKA 1K07A 1VJNA 2UYXA 3H3EA 5K4KA 1DD6A 2I7VA 2Q0JA 5EVKA 4TZEA 5LMCA 3KL7A 5HIOA 3SD9A 4C1FA 2BFZA 3IE0A 3IELA 4TZBA 2YNVA 4XWTA 1KO2A 1L9YA 3T3NA 5LLDA 4AXHA 3P2UA 2GMNA 3PY6A 2BFLA 1WUPA 3IEKA 5A23A 3BK1A 5K4MA 5A0VA 5EH9A 4BP0A 5ACQA 5A5ZA 1JT1A 4UWSB 2BMIA 2CFUA 4F6HA 3T9MA 2BC2A 4YSBA 4EXSA 4WD6A 3VPEA 5FQCA 4NQ5A 5AHOA 4Z60A 3PY5A 3DHCA 4EFZA 5LM6A 2GFKA 4RM5A 4YSKA 1XTOA 2DOOA 2NZEA 4H0DA 3SPUA 5B1UA 4AX1B 4GCWA 1QH3A 1BC2A 2GCUA 3X2ZA 4B87A 5AEBA 3PG4A 4HL1A 4DIKA 4HKYA 3SBLA 5ACUA 4AWZA 3RKJA 4UBQA 2OHHA 4JO0A 2HB9A 2WYMA 5AHRA
chains in the Genus database with same CATH topology
2BG2A 2Y8AA 5B15A 3AF5A 4UAMA 2CBNA 2WYLA 2BFZB 4NQ4A 4LE6A 3AJ3A 2YNVB 2XF4A 4FEKA 3I14A 2QJSA 2I7TA 3I0VA 4D02A 5DPXA 5HIPA 2Q9UA 3T3OA 4YSLA 3X2XA 1DXKA 2YCBA 4FSBA 3L6NA 4Z5YA 3R2UA 3BC2A 2BTNA 3VQZA 3IE1A 3SRXA 2BR6A 2P97A 4UWPB 3RKKA 4TZFA 1VGNA 4C1DA 4CHLA 2P18A 2NYPA 4FR7A 2Q0IA 3X2YA 3ZNBA 4ZO2A 3SFPA 2ZZIA 4GYQA 4TYTA 2FU7A 2A7MA 5EHTA 4BZ3A 3S0ZA 2ZWRA 2FHXA 1DDKA 4EXYA 3DHAA 3ZR9A 1VMEA 1MQOA 1XM8A 5ACSA 4XUKA 3FAIA 4PVOA 2OHJA 4Z6XA 4Z5ZA 5B3RA 1E5DA 5A0TA 5FQAA 3Q6VA 2M5CA 4RL0A 3WXCA 5EV8A 2FU8A 2WYMC 1BVTA 4C1EA 4HL2A 3SW3A 3ADRA 3IDZA 4GYUA 4D1UA 5HH5A 5ACVA 5LCAA 2BIBA 4AWYB 4TYFA 2FU9A 3F9OA 3BV6A 5KILA 2YNTA 1JJEA 3I11A 4EY2A 4J5HA 4UWRB 4NQ6A 5AXRA 1YCHA 1SMLA 3ESHA 3RPCA 2QINA 5HISA 2Q42A 3I15A 2Y8BA 3G1PA 3IOGA 3ZWFA 4ZNBA 2BG8A 3LVZA 1ZNBA 4C09A 2WRSA 4C1GA 2WHGA 4PVTA 1KR3A 2FHXB 2GKLA 1M2XA 5LCHA 3AF6A 1X8GA 2DKFA 1YCGA 4O98A 3I13A 4V0HA 4KEPA 1KO3A 3KNRA 5AYAA 5A87A 5ACRA 2M5DA 4J5FA 4XWWA 1WRAA 4F6ZA 4NQ2A 1BMCA 4U4LA 5HIQA 5EVDA 5K0WA 4D1TA 2BG7A 2VW8A 4C1HA 1X8IA 3IE2A 2YNWA 2FM6A 3KNSA 2BFKA 1WW1A 2H6AA 2Y87A 2YNTB 3ZQ4A 3X30A 2R2DA 2YNUA 4UA4A 1QH5A 4EYBA 4EYLA 1A8TA 5LSCA 4RAMA 1P9EA 5K4NA 4RBSA 2BGAA 2QDTA 1ZKPA 4C1CA 2BG8B 1YCFA 5EV6A 2ZO4A 5LCFA 3MD7A 1A7TA 4ZO3A 3TP9A 5AXOA 3FCZA 2P4ZA 3BK2A 3IOFA 4P62A 4RAWA 2I7XA 1WUOA 5ACTA 5LE1A 2P1EA 5LS3A 4ZEJA 4UWOB 2QEDA 4AD9A 5EW0A 4TZ9A 5ACPA 4Z7RA 2E7YA 5FQBA 5ACXA 2FK6A 1ZTCA 2NZFA 4DILA 4RL2A 3DHBA 3QH8A 4Z67A 4D1VA 2OHIA 2GFJA 4D1WA 3JXPA 2BG6A 1HLKA 1JJTA 4AX0B 2ZNBA 2XR1A 3DH8A 4EYFA 1Y44A 2NXAA 2AIOA 4KEQA 1X8HA 2FU6A 3A4YA 5KIKA 5ACWA 5HH6A 5HH4A 5EWAA 3IEMA 2QDSA 2YZ3A 5EVBA 2AZ4A 5IQKA 1K07A 1VJNA 2UYXA 3H3EA 5K4KA 1DD6A 2I7VA 2Q0JA 5EVKA 4TZEA 5LMCA 3KL7A 5HIOA 3SD9A 4C1FA 2BFZA 3IE0A 3IELA 4TZBA 2YNVA 4XWTA 1KO2A 1L9YA 3T3NA 5LLDA 3P2UA 2GMNA 3PY6A 2BFLA 1WUPA 3IEKA 3BK1A 5K4MA 5A0VA 5EH9A 4BP0A 5ACQA 5A5ZA 1JT1A 4UWSB 2BMIA 4F6HA 3T9MA 2BC2A 4YSBA 4EXSA 4WD6A 3VPEA 5FQCA 4NQ5A 5AHOA 4Z60A 3PY5A 4EFZA 3DHCA 5LM6A 2GFKA 4RM5A 4YSKA 1XTOA 2DOOA 2NZEA 4H0DA 3SPUA 5B1UA 4AX1B 4GCWA 1QH3A 1BC2A 2GCUA 3X2ZA 4B87A 5AEBA 3PG4A 4HL1A 4DIKA 4HKYA 3SBLA 5ACUA 4AWZA 3RKJA 4UBQA 2OHHA 4JO0A 2HB9A 2WYMA 5AHRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BG2 A;  2Y8A A;  5B15 A;  3AF5 A;  4UAM A;  2CBN A;  2WYL A;  2BFZ B;  4NQ4 A;  4LE6 A;  3AJ3 A;  2YNV B;  2XF4 A;  4FEK A;  3I14 A;  2QJS A;  2I7T A;  3I0V A;  4D02 A;  5DPX A;  5HIP A;  2Q9U A;  3T3O A;  4YSL A;  3X2X A;  1DXK A;  2YCB A;  4FSB A;  3L6N A;  4Z5Y A;  3R2U A;  3BC2 A;  2BTN A;  3VQZ A;  3IE1 A;  3SRX A;  2BR6 A;  2P97 A;  4UWP B;  3RKK A;  4TZF A;  1VGN A;  4C1D A;  4CHL A;  2P18 A;  2NYP A;  4FR7 A;  2Q0I A;  3X2Y A;  3ZNB A;  4ZO2 A;  3SFP A;  2ZZI A;  4GYQ A;  4TYT A;  2FU7 A;  2A7M A;  5EHT A;  4BZ3 A;  3S0Z A;  2ZWR A;  2FHX A;  1DDK A;  4EXY A;  3DHA A;  3ZR9 A;  1VME A;  1MQO A;  1XM8 A;  5ACS A;  4XUK A;  3FAI A;  4PVO A;  2OHJ A;  4Z6X A;  4Z5Z A;  5B3R A;  1E5D A;  5A0T A;  5FQA A;  3Q6V A;  2M5C A;  4RL0 A;  3WXC A;  5EV8 A;  2FU8 A;  2WYM C;  1BVT A;  4C1E A;  4HL2 A;  3SW3 A;  3ADR A;  3IDZ A;  4GYU A;  4D1U A;  5HH5 A;  5ACV A;  5LCA A;  2BIB A;  4AWY B;  4TYF A;  2FU9 A;  3F9O A;  3BV6 A;  5KIL A;  2YNT A;  1JJE A;  3I11 A;  4EY2 A;  4J5H A;  4UWR B;  4NQ6 A;  5AXR A;  1YCH A;  1SML A;  3ESH A;  3RPC A;  2QIN A;  5HIS A;  2Q42 A;  3I15 A;  2Y8B A;  3G1P A;  3IOG A;  3ZWF A;  4ZNB A;  2BG8 A;  3LVZ A;  1ZNB A;  4C09 A;  2WRS A;  4C1G A;  2WHG A;  4PVT A;  1KR3 A;  2FHX B;  2GKL A;  1M2X A;  5LCH A;  3AF6 A;  1X8G A;  2DKF A;  1YCG A;  4O98 A;  3I13 A;  4V0H A;  4KEP A;  1KO3 A;  3KNR A;  5AYA A;  5A87 A;  5ACR A;  2M5D A;  4J5F A;  4XWW A;  1WRA A;  4F6Z A;  4NQ2 A;  1BMC A;  4U4L A;  5HIQ A;  5EVD A;  5K0W A;  4D1T A;  2BG7 A;  2VW8 A;  4C1H A;  1X8I A;  3IE2 A;  2YNW A;  2FM6 A;  3KNS A;  2BFK A;  1WW1 A;  2H6A A;  2Y87 A;  2YNT B;  3ZQ4 A;  3X30 A;  2R2D A;  2YNU A;  4UA4 A;  1QH5 A;  4EYB A;  4EYL A;  1A8T A;  5LSC A;  4RAM A;  1P9E A;  5K4N A;  4RBS A;  2BGA A;  2QDT A;  1ZKP A;  4C1C A;  2BG8 B;  1YCF A;  5EV6 A;  2ZO4 A;  5LCF A;  3MD7 A;  1A7T A;  4ZO3 A;  3TP9 A;  5AXO A;  3FCZ A;  2P4Z A;  3BK2 A;  3IOF A;  4P62 A;  4RAW A;  2I7X A;  1WUO A;  5ACT A;  5LE1 A;  2P1E A;  5LS3 A;  4ZEJ A;  4UWO B;  2QED A;  4AD9 A;  5EW0 A;  4TZ9 A;  5ACP A;  4Z7R A;  2E7Y A;  5FQB A;  5ACX A;  2FK6 A;  1ZTC A;  2NZF A;  4DIL A;  4RL2 A;  3DHB A;  3QH8 A;  4Z67 A;  4D1V A;  2OHI A;  2GFJ A;  4D1W A;  3JXP A;  2BG6 A;  1HLK A;  1JJT A;  4AX0 B;  2ZNB A;  2XR1 A;  3DH8 A;  4EYF A;  1Y44 A;  2NXA A;  2AIO A;  4KEQ A;  1X8H A;  2FU6 A;  3A4Y A;  5KIK A;  5ACW A;  5HH6 A;  5HH4 A;  5EWA A;  3IEM A;  2QDS A;  2YZ3 A;  5EVB A;  2AZ4 A;  5IQK A;  1K07 A;  1VJN A;  2UYX A;  3H3E A;  5K4K A;  1DD6 A;  2I7V A;  2Q0J A;  5EVK A;  4TZE A;  5LMC A;  3KL7 A;  5HIO A;  3SD9 A;  4C1F A;  2BFZ A;  3IE0 A;  3IEL A;  4TZB A;  2YNV A;  4XWT A;  1KO2 A;  1L9Y A;  3T3N A;  5LLD A;  3P2U A;  2GMN A;  3PY6 A;  2BFL A;  1WUP A;  3IEK A;  3BK1 A;  5K4M A;  5A0V A;  5EH9 A;  4BP0 A;  5ACQ A;  5A5Z A;  1JT1 A;  4UWS B;  2BMI A;  4F6H A;  3T9M A;  2BC2 A;  4YSB A;  4EXS A;  4WD6 A;  3VPE A;  5FQC A;  4NQ5 A;  5AHO A;  4Z60 A;  3PY5 A;  4EFZ A;  3DHC A;  5LM6 A;  2GFK A;  4RM5 A;  4YSK A;  1XTO A;  2DOO A;  2NZE A;  4H0D A;  3SPU A;  5B1U A;  4AX1 B;  4GCW A;  1QH3 A;  1BC2 A;  2GCU A;  3X2Z A;  4B87 A;  5AEB A;  3PG4 A;  4HL1 A;  4DIK A;  4HKY A;  3SBL A;  5ACU A;  4AWZ A;  3RKJ A;  4UBQ A;  2OHH A;  4JO0 A;  2HB9 A;  2WYM A;  5AHR A; 
#chains in the Genus database with same CATH topology
 2BG2 A;  2Y8A A;  5B15 A;  3AF5 A;  4UAM A;  2CBN A;  2WYL A;  2BFZ B;  4NQ4 A;  4LE6 A;  3AJ3 A;  2YNV B;  2XF4 A;  4FEK A;  3I14 A;  2QJS A;  2I7T A;  3I0V A;  4D02 A;  5DPX A;  5HIP A;  2Q9U A;  3T3O A;  4YSL A;  3X2X A;  1DXK A;  2YCB A;  4FSB A;  3L6N A;  4Z5Y A;  3R2U A;  3BC2 A;  2BTN A;  3VQZ A;  3IE1 A;  3SRX A;  2BR6 A;  2P97 A;  4UWP B;  3RKK A;  4TZF A;  1VGN A;  4C1D A;  4CHL A;  2P18 A;  2NYP A;  4NUR A;  4FR7 A;  2Q0I A;  4PDX A;  3X2Y A;  3ZNB A;  4ZO2 A;  3SFP A;  2ZZI A;  4GYQ A;  4TYT A;  2FU7 A;  2A7M A;  5EHT A;  4BZ3 A;  3S0Z A;  2ZWR A;  2FHX A;  1DDK A;  4EXY A;  3DHA A;  3ZR9 A;  1VME A;  1MQO A;  1XM8 A;  5ACS A;  4XUK A;  3FAI A;  4PVO A;  2OHJ A;  4Z6X A;  4Z5Z A;  5B3R A;  1E5D A;  5A0T A;  5FQA A;  3Q6V A;  2M5C A;  4RL0 A;  3WXC A;  5EV8 A;  2FU8 A;  2WYM C;  1BVT A;  4C1E A;  4HL2 A;  3SW3 A;  3ADR A;  3IDZ A;  4GYU A;  4D1U A;  5HH5 A;  5ACV A;  5LCA A;  2BIB A;  4AWY B;  4TYF A;  2FU9 A;  3F9O A;  3BV6 A;  5KIL A;  2YNT A;  1JJE A;  3I11 A;  4EY2 A;  4J5H A;  4UWR B;  4NQ6 A;  5AXR A;  1YCH A;  1SML A;  3ESH A;  3RPC A;  2QIN A;  5HIS A;  2Q42 A;  3I15 A;  2Y8B A;  3G1P A;  3IOG A;  3ZWF A;  4ZNB A;  2BG8 A;  3LVZ A;  1ZNB A;  4C09 A;  2WRS A;  4C1G A;  2WHG A;  4PVT A;  1KR3 A;  2FHX B;  2GKL A;  1M2X A;  5LCH A;  3AF6 A;  1X8G A;  2DKF A;  2CFZ A;  1YCG A;  4O98 A;  3I13 A;  4V0H A;  4KEP A;  1KO3 A;  3KNR A;  5AYA A;  5A87 A;  5ACR A;  2M5D A;  2CG2 A;  4J5F A;  2YHE A;  4XWW A;  1WRA A;  4F6Z A;  4NQ2 A;  1BMC A;  4U4L A;  5HIQ A;  5EVD A;  5K0W A;  4D1T A;  2BG7 A;  2VW8 A;  4C1H A;  1X8I A;  3IE2 A;  2YNW A;  5AJL A;  2FM6 A;  3KNS A;  2BFK A;  1WW1 A;  2H6A A;  2Y87 A;  2YNT B;  3ZQ4 A;  3X30 A;  2R2D A;  2YNU A;  4UA4 A;  1QH5 A;  4EYB A;  4EYL A;  1A8T A;  5LSC A;  4RAM A;  1P9E A;  5K4N A;  4RBS A;  2BGA A;  2QDT A;  1ZKP A;  4C1C A;  2BG8 B;  1YCF A;  5EV6 A;  2ZO4 A;  5LCF A;  3MD7 A;  1A7T A;  4ZO3 A;  3TP9 A;  5AXO A;  3FCZ A;  2P4Z A;  3BK2 A;  3IOF A;  4P62 A;  4RAW A;  2I7X A;  1WUO A;  5ACT A;  5LE1 A;  2P1E A;  5LS3 A;  4ZEJ A;  4UWO B;  2QED A;  4AD9 A;  5EW0 A;  4TZ9 A;  5ACP A;  4Z7R A;  2E7Y A;  2CG3 A;  5FQB A;  5ACX A;  2FK6 A;  1ZTC A;  2NZF A;  4DIL A;  4RL2 A;  3DHB A;  3QH8 A;  4Z67 A;  4D1V A;  4AV7 A;  2OHI A;  2GFJ A;  4D1W A;  3JXP A;  2BG6 A;  1HLK A;  1JJT A;  4AX0 B;  2ZNB A;  2XR1 A;  3DH8 A;  4EYF A;  5AIJ A;  1Y44 A;  2NXA A;  2AIO A;  4KEQ A;  1X8H A;  2FU6 A;  3A4Y A;  5KIK A;  5ACW A;  5HH6 A;  5HH4 A;  5EWA A;  3IEM A;  2QDS A;  2YZ3 A;  5EVB A;  2AZ4 A;  5IQK A;  1K07 A;  1VJN A;  2UYX A;  3H3E A;  5K4K A;  1DD6 A;  2I7V A;  2Q0J A;  5EVK A;  4TZE A;  5LMC A;  3KL7 A;  5HIO A;  3SD9 A;  4C1F A;  2BFZ A;  3IE0 A;  3IEL A;  4TZB A;  2YNV A;  4XWT A;  1KO2 A;  1L9Y A;  3T3N A;  5LLD A;  4AXH A;  3P2U A;  2GMN A;  3PY6 A;  2BFL A;  1WUP A;  3IEK A;  5A23 A;  3BK1 A;  5K4M A;  5A0V A;  5EH9 A;  4BP0 A;  5ACQ A;  5A5Z A;  1JT1 A;  4UWS B;  2BMI A;  2CFU A;  4F6H A;  3T9M A;  2BC2 A;  4YSB A;  4EXS A;  4WD6 A;  3VPE A;  5FQC A;  4NQ5 A;  5AHO A;  4Z60 A;  3PY5 A;  3DHC A;  4EFZ A;  5LM6 A;  2GFK A;  4RM5 A;  4YSK A;  1XTO A;  2DOO A;  2NZE A;  4H0D A;  3SPU A;  5B1U A;  4AX1 B;  4GCW A;  1QH3 A;  1BC2 A;  2GCU A;  3X2Z A;  4B87 A;  5AEB A;  3PG4 A;  4HL1 A;  4DIK A;  4HKY A;  3SBL A;  5ACU A;  4AWZ A;  3RKJ A;  4UBQ A;  2OHH A;  4JO0 A;  2HB9 A;  2WYM A;  5AHR A; 
#chains in the Genus database with same CATH homology
 2BG2 A;  2Y8A A;  5B15 A;  3AF5 A;  4UAM A;  2CBN A;  2WYL A;  2BFZ B;  4NQ4 A;  4LE6 A;  3AJ3 A;  2YNV B;  2XF4 A;  4FEK A;  3I14 A;  2QJS A;  2I7T A;  3I0V A;  4D02 A;  5DPX A;  5HIP A;  2Q9U A;  3T3O A;  4YSL A;  3X2X A;  1DXK A;  2YCB A;  4FSB A;  3L6N A;  4Z5Y A;  3R2U A;  3BC2 A;  2BTN A;  3VQZ A;  3IE1 A;  3SRX A;  2BR6 A;  2P97 A;  4UWP B;  3RKK A;  4TZF A;  1VGN A;  4C1D A;  4CHL A;  2P18 A;  2NYP A;  4FR7 A;  2Q0I A;  3X2Y A;  3ZNB A;  4ZO2 A;  3SFP A;  2ZZI A;  4GYQ A;  4TYT A;  2FU7 A;  2A7M A;  5EHT A;  4BZ3 A;  3S0Z A;  2ZWR A;  2FHX A;  1DDK A;  4EXY A;  3DHA A;  3ZR9 A;  1VME A;  1MQO A;  1XM8 A;  5ACS A;  4XUK A;  3FAI A;  4PVO A;  2OHJ A;  4Z6X A;  4Z5Z A;  5B3R A;  1E5D A;  5A0T A;  5FQA A;  3Q6V A;  2M5C A;  4RL0 A;  3WXC A;  5EV8 A;  2FU8 A;  2WYM C;  1BVT A;  4C1E A;  4HL2 A;  3SW3 A;  3ADR A;  3IDZ A;  4GYU A;  4D1U A;  5HH5 A;  5ACV A;  5LCA A;  2BIB A;  4AWY B;  4TYF A;  2FU9 A;  3F9O A;  3BV6 A;  5KIL A;  2YNT A;  1JJE A;  3I11 A;  4EY2 A;  4J5H A;  4UWR B;  4NQ6 A;  5AXR A;  1YCH A;  1SML A;  3ESH A;  3RPC A;  2QIN A;  5HIS A;  2Q42 A;  3I15 A;  2Y8B A;  3G1P A;  3IOG A;  3ZWF A;  4ZNB A;  2BG8 A;  3LVZ A;  1ZNB A;  4C09 A;  2WRS A;  4C1G A;  2WHG A;  4PVT A;  1KR3 A;  2FHX B;  2GKL A;  1M2X A;  5LCH A;  3AF6 A;  1X8G A;  2DKF A;  1YCG A;  4O98 A;  3I13 A;  4V0H A;  4KEP A;  1KO3 A;  3KNR A;  5AYA A;  5A87 A;  5ACR A;  2M5D A;  4J5F A;  4XWW A;  1WRA A;  4F6Z A;  4NQ2 A;  1BMC A;  4U4L A;  5HIQ A;  5EVD A;  5K0W A;  4D1T A;  2BG7 A;  2VW8 A;  4C1H A;  1X8I A;  3IE2 A;  2YNW A;  2FM6 A;  3KNS A;  2BFK A;  1WW1 A;  2H6A A;  2Y87 A;  2YNT B;  3ZQ4 A;  3X30 A;  2R2D A;  2YNU A;  4UA4 A;  1QH5 A;  4EYB A;  4EYL A;  1A8T A;  5LSC A;  4RAM A;  1P9E A;  5K4N A;  4RBS A;  2BGA A;  2QDT A;  1ZKP A;  4C1C A;  2BG8 B;  1YCF A;  5EV6 A;  2ZO4 A;  5LCF A;  3MD7 A;  1A7T A;  4ZO3 A;  3TP9 A;  5AXO A;  3FCZ A;  2P4Z A;  3BK2 A;  3IOF A;  4P62 A;  4RAW A;  2I7X A;  1WUO A;  5ACT A;  5LE1 A;  2P1E A;  5LS3 A;  4ZEJ A;  4UWO B;  2QED A;  4AD9 A;  5EW0 A;  4TZ9 A;  5ACP A;  4Z7R A;  2E7Y A;  5FQB A;  5ACX A;  2FK6 A;  1ZTC A;  2NZF A;  4DIL A;  4RL2 A;  3DHB A;  3QH8 A;  4Z67 A;  4D1V A;  2OHI A;  2GFJ A;  4D1W A;  3JXP A;  2BG6 A;  1HLK A;  1JJT A;  4AX0 B;  2ZNB A;  2XR1 A;  3DH8 A;  4EYF A;  1Y44 A;  2NXA A;  2AIO A;  4KEQ A;  1X8H A;  2FU6 A;  3A4Y A;  5KIK A;  5ACW A;  5HH6 A;  5HH4 A;  5EWA A;  3IEM A;  2QDS A;  2YZ3 A;  5EVB A;  2AZ4 A;  5IQK A;  1K07 A;  1VJN A;  2UYX A;  3H3E A;  5K4K A;  1DD6 A;  2I7V A;  2Q0J A;  5EVK A;  4TZE A;  5LMC A;  3KL7 A;  5HIO A;  3SD9 A;  4C1F A;  2BFZ A;  3IE0 A;  3IEL A;  4TZB A;  2YNV A;  4XWT A;  1KO2 A;  1L9Y A;  3T3N A;  5LLD A;  3P2U A;  2GMN A;  3PY6 A;  2BFL A;  1WUP A;  3IEK A;  3BK1 A;  5K4M A;  5A0V A;  5EH9 A;  4BP0 A;  5ACQ A;  5A5Z A;  1JT1 A;  4UWS B;  2BMI A;  4F6H A;  3T9M A;  2BC2 A;  4YSB A;  4EXS A;  4WD6 A;  3VPE A;  5FQC A;  4NQ5 A;  5AHO A;  4Z60 A;  3PY5 A;  4EFZ A;  3DHC A;  5LM6 A;  2GFK A;  4RM5 A;  4YSK A;  1XTO A;  2DOO A;  2NZE A;  4H0D A;  3SPU A;  5B1U A;  4AX1 B;  4GCW A;  1QH3 A;  1BC2 A;  2GCU A;  3X2Z A;  4B87 A;  5AEB A;  3PG4 A;  4HL1 A;  4DIK A;  4HKY A;  3SBL A;  5ACU A;  4AWZ A;  3RKJ A;  4UBQ A;  2OHH A;  4JO0 A;  2HB9 A;  2WYM A;  5AHR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...