4KEPA

Crystal structure of 4-pyridoxolactonase, wild-type
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
molecule tags Hydrolase
molecule keywords 4-pyridoxolactonase
total genus 93
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4kepA00
2WYLA 4AWYB 1DXKA 3KL7A 4Z67A 4V0HA 3KNSA 1YCFA 5EV6A 4TYFA 3ZNBA 4C1GA 4U4LA 4H0DA 3AF6A 5AEBA 2DKFA 4JO0A 5K4KA 2FU7A 4RM5A 4BZ3A 4AX0B 4D1TA 3IELA 2GFJA 5AHOA 5ACTA 5LCHA 5LM6A 2YNTB 4XWWA 1YCHA 2Q0JA 2WRSA 5A5ZA 1Y44A 4KEQA 3WXCA 3F9OA 2BFLA 4F6HA 3PY5A 3LVZA 5EVKA 2HB9A 2ZNBA 4ZO3A 1JJTA 3BC2A 5ACWA 2NYPA 3I14A 5A87A 2YCBA 4FR7A 4LE6A 4NQ6A 4J5FA 4UWRB 4EYFA 1ZTCA 1JT1A 4RAWA 4GCWA 2P4ZA 4TZEA 4GYQA 4C1CA 4AD9A 3I0VA 4EY2A 2BTNA 5DPXA 2P18A 2I7XA 5AYAA 1A8TA 2NZFA 4RAMA 1KO3A 4UAMA 3AJ3A 5LS3A 2BMIA 5HIOA 4UBQA 4XUKA 3SD9A 5EVDA 3KNRA 3ZR9A 5HH5A 4B87A 2BG2A 4RL0A 2FU9A 4UWSB 3VQZA 3VPEA 1A7TA 2I7VA 2QDSA 2YNVA 1QH3A 2GCUA 1M2XA 2GKLA 3T9MA 5EVBA 5LSCA 3RPCA 5K0WA 2NZEA 5HH6A 4CHLA 3TP9A 5FQBA 2AZ4A 5LMCA 3P2UA 4ZNBA 2VW8A 4J5HA 2YNUA 2ZZIA 2Q9UA 2OHJA 2QJSA 4C1DA 3I11A 2FU6A 2NXAA 3IOGA 4PVTA 5EW0A 2Y8BA 2BG6A 2BIBA 4EYBA 5HIPA 4DIKA 2FHXA 2Y8AA 1ZNBA 3X30A 2Q42A 3I13A 5AHRA 3JXPA 3BK2A 4C1HA 4EFZA 2GMNA 3H3EA 1WUOA 3IEKA 3T3NA 4UWOB 2XF4A 2FK6A 4TZFA 5ACRA 3DHBA 3ZQ4A 3IOFA 3A4YA 1BVTA 3RKKA 5AXRA 4Z5YA 3PY6A 4C1EA 4C09A 2BC2A 2BFZA 2R2DA 4HKYA 3G1PA 4PVOA 2WYMA 5EH9A 3BV6A 2M5CA 2CBNA 2AIOA 4D02A 5LCAA 4D1UA 4ZO2A 5EHTA 4FEKA 3IEMA 1X8HA 5FQCA 5LE1A 4D1VA 2GFKA 3IDZA 5B3RA 3FAIA 2FHXB 3R2UA 4O98A 4YSBA 4ZEJA 4KEPA 2I7TA 5A0VA 2Y87A 4UA4A 1VMEA 5ACSA 2OHHA 1WRAA 2YNWA 2DOOA 5EV8A 5ACXA 5ACQA 2BFZB 5EWAA 4BP0A 3IE2A 1DDKA 2ZWRA 4AWZA 4HL1A 2QEDA 2ZO4A 4D1WA 4WD6A 4EYLA 1BMCA 4TYTA 4AX1B 1QH5A 1X8IA 5LLDA 5LCFA 2P97A 3MD7A 1VGNA 3L6NA 1X8GA 3DH8A 5B15A 1BC2A 2BG8B 2YNTA 5A0TA 1JJEA 5B1UA 2YZ3A 4GYUA 4FSBA 3DHCA 5KIKA 2QINA 2BG8A 2BR6A 3DHAA 3SBLA 2BGAA 1WUPA 1XM8A 3IE1A 2E7YA 5KILA 1WW1A 3AF5A 3BK1A 2FU8A 3SW3A 1XTOA 5HIQA 2BFKA 3S0ZA 4F6ZA 4C1FA 4YSKA 2QDTA 3T3OA 3I15A 2FM6A 3RKJA 1P9EA 2A7MA 4NQ4A 4TZ9A 4YSLA 2WHGA 3SRXA 5IQKA 5FQAA 1MQOA 4NQ5A 2WYMC 3QH8A 1VJNA 5K4MA 1L9YA 2M5DA 5ACVA 1HLKA 1KR3A 4EXSA 2UYXA 4P62A 1KO2A 3ADRA 4RBSA 1SMLA 4NQ2A 3ZWFA 4Z6XA 3X2YA 1ZKPA 3FCZA 4HL2A 2P1EA 3IE0A 2YNVB 1YCGA 5HISA 5ACUA 3PG4A 4UWPB 2BG7A 2H6AA 5AXOA 4RL2A 4XWTA 3Q6VA 3SFPA 4EXYA 1E5DA 3X2XA 3X2ZA 4DILA 5HH4A 2OHIA 1K07A 3ESHA 4Z60A 4Z5ZA 4Z7RA 5K4NA 2Q0IA 4TZBA 3SPUA 5ACPA 1DD6A 2XR1A
chains in the Genus database with same CATH superfamily
2WYLA 4AWYB 1DXKA 3KL7A 4Z67A 4V0HA 3KNSA 1YCFA 4AXHA 5EV6A 4TYFA 3ZNBA 4C1GA 4U4LA 4H0DA 3AF6A 5AEBA 2DKFA 4JO0A 5K4KA 2FU7A 4RM5A 4BZ3A 4AX0B 4D1TA 3IELA 2GFJA 5AHOA 5ACTA 5LCHA 5LM6A 5AJLA 2YNTB 4XWWA 1YCHA 2Q0JA 2WRSA 5A5ZA 1Y44A 4KEQA 3WXCA 3F9OA 2BFLA 4F6HA 3PY5A 3LVZA 5EVKA 2HB9A 2ZNBA 4ZO3A 1JJTA 3BC2A 5ACWA 2NYPA 3I14A 5A87A 2YCBA 4FR7A 4LE6A 4NQ6A 4J5FA 4UWRB 4EYFA 1ZTCA 1JT1A 4RAWA 4GCWA 2P4ZA 4TZEA 4GYQA 4C1CA 4AD9A 3I0VA 4EY2A 2BTNA 5DPXA 2P18A 2I7XA 5AYAA 1A8TA 2NZFA 4RAMA 1KO3A 4UAMA 3AJ3A 5LS3A 2BMIA 5HIOA 4NURA 4UBQA 4XUKA 3SD9A 5EVDA 3KNRA 3ZR9A 5HH5A 4B87A 2BG2A 4RL0A 2FU9A 4UWSB 3VQZA 3VPEA 1A7TA 2I7VA 2QDSA 2YNVA 1QH3A 2GCUA 2CG2A 1M2XA 2GKLA 3T9MA 2CG3A 5EVBA 5LSCA 3RPCA 5K0WA 2NZEA 5HH6A 4CHLA 3TP9A 5FQBA 2AZ4A 5LMCA 3P2UA 4ZNBA 2VW8A 4J5HA 2YNUA 2ZZIA 2Q9UA 2OHJA 2QJSA 4C1DA 3I11A 2FU6A 2NXAA 3IOGA 4PVTA 5EW0A 2Y8BA 4PDXA 2BG6A 2BIBA 4EYBA 5HIPA 4DIKA 2FHXA 2Y8AA 1ZNBA 3X30A 2Q42A 3I13A 5AHRA 3JXPA 3BK2A 2CFUA 4C1HA 4EFZA 2GMNA 3H3EA 1WUOA 3IEKA 3T3NA 4UWOB 2XF4A 2FK6A 4TZFA 5ACRA 3DHBA 3ZQ4A 3IOFA 3A4YA 1BVTA 3RKKA 5AXRA 4Z5YA 3PY6A 4C1EA 4C09A 2BC2A 2BFZA 2CFZA 2R2DA 4HKYA 3G1PA 4PVOA 2WYMA 5EH9A 3BV6A 2M5CA 2CBNA 2AIOA 4D02A 5LCAA 4D1UA 4ZO2A 5EHTA 4FEKA 3IEMA 1X8HA 5FQCA 5A23A 4AV7A 5LE1A 4D1VA 2GFKA 3IDZA 5B3RA 3FAIA 2FHXB 3R2UA 4O98A 4YSBA 4ZEJA 4KEPA 2I7TA 5A0VA 2Y87A 4UA4A 1VMEA 5ACSA 2OHHA 1WRAA 2YNWA 2DOOA 5EV8A 5ACXA 5ACQA 2BFZB 5EWAA 4BP0A 3IE2A 1DDKA 2ZWRA 4AWZA 4HL1A 2QEDA 2ZO4A 4D1WA 4WD6A 4EYLA 1BMCA 4TYTA 4AX1B 1QH5A 1X8IA 5LLDA 5LCFA 2P97A 3MD7A 1VGNA 3L6NA 1X8GA 3DH8A 5B15A 1BC2A 2BG8B 2YNTA 5A0TA 1JJEA 5B1UA 2YZ3A 4GYUA 4FSBA 3DHCA 5KIKA 2QINA 2BG8A 2BR6A 3DHAA 3SBLA 2BGAA 1WUPA 1XM8A 3IE1A 2E7YA 5KILA 1WW1A 3AF5A 3BK1A 2FU8A 5AIJA 3SW3A 1XTOA 5HIQA 2BFKA 3S0ZA 4F6ZA 4C1FA 4YSKA 2QDTA 3T3OA 3I15A 2FM6A 3RKJA 1P9EA 2YHEA 2A7MA 4NQ4A 4TZ9A 4YSLA 2WHGA 3SRXA 5IQKA 5FQAA 1MQOA 4NQ5A 2WYMC 3QH8A 1VJNA 5K4MA 1L9YA 2M5DA 5ACVA 1HLKA 1KR3A 4EXSA 2UYXA 4P62A 1KO2A 3ADRA 4RBSA 1SMLA 4NQ2A 3ZWFA 4Z6XA 3X2YA 1ZKPA 3FCZA 4HL2A 2P1EA 3IE0A 2YNVB 1YCGA 5HISA 5ACUA 3PG4A 4UWPB 2BG7A 2H6AA 5AXOA 4RL2A 4XWTA 3Q6VA 3SFPA 4EXYA 1E5DA 3X2XA 3X2ZA 4DILA 5HH4A 2OHIA 1K07A 3ESHA 4Z60A 4Z5ZA 4Z7RA 5K4NA 2Q0IA 4TZBA 3SPUA 5ACPA 1DD6A 2XR1A
chains in the Genus database with same CATH topology
2WYLA 4AWYB 1DXKA 3KL7A 4Z67A 4V0HA 3KNSA 1YCFA 5EV6A 4TYFA 3ZNBA 4C1GA 4U4LA 4H0DA 3AF6A 5AEBA 2DKFA 4JO0A 5K4KA 2FU7A 4RM5A 4BZ3A 4AX0B 4D1TA 3IELA 2GFJA 5AHOA 5ACTA 5LCHA 5LM6A 2YNTB 4XWWA 1YCHA 2Q0JA 2WRSA 5A5ZA 1Y44A 4KEQA 3WXCA 3F9OA 2BFLA 4F6HA 3PY5A 3LVZA 5EVKA 2HB9A 2ZNBA 4ZO3A 1JJTA 3BC2A 5ACWA 2NYPA 3I14A 5A87A 2YCBA 4FR7A 4LE6A 4NQ6A 4J5FA 4UWRB 4EYFA 1ZTCA 1JT1A 4RAWA 4GCWA 2P4ZA 4TZEA 4GYQA 4C1CA 4AD9A 3I0VA 4EY2A 2BTNA 5DPXA 2P18A 2I7XA 5AYAA 1A8TA 2NZFA 4RAMA 1KO3A 4UAMA 3AJ3A 5LS3A 2BMIA 5HIOA 4UBQA 4XUKA 3SD9A 5EVDA 3KNRA 3ZR9A 5HH5A 4B87A 2BG2A 4RL0A 2FU9A 4UWSB 3VQZA 3VPEA 1A7TA 2I7VA 2QDSA 2YNVA 1QH3A 2GCUA 1M2XA 2GKLA 3T9MA 5EVBA 5LSCA 3RPCA 5K0WA 2NZEA 5HH6A 4CHLA 3TP9A 5FQBA 2AZ4A 5LMCA 3P2UA 4ZNBA 2VW8A 4J5HA 2YNUA 2ZZIA 2Q9UA 2OHJA 2QJSA 4C1DA 3I11A 2FU6A 2NXAA 3IOGA 4PVTA 5EW0A 2Y8BA 2BG6A 2BIBA 4EYBA 5HIPA 4DIKA 2FHXA 2Y8AA 1ZNBA 3X30A 2Q42A 3I13A 5AHRA 3JXPA 3BK2A 4C1HA 4EFZA 2GMNA 3H3EA 1WUOA 3IEKA 3T3NA 4UWOB 2XF4A 2FK6A 4TZFA 5ACRA 3DHBA 3ZQ4A 3IOFA 3A4YA 1BVTA 3RKKA 5AXRA 4Z5YA 3PY6A 4C1EA 4C09A 2BC2A 2BFZA 2R2DA 4HKYA 3G1PA 4PVOA 2WYMA 5EH9A 3BV6A 2M5CA 2CBNA 2AIOA 4D02A 5LCAA 4D1UA 4ZO2A 5EHTA 4FEKA 3IEMA 1X8HA 5FQCA 5LE1A 4D1VA 2GFKA 3IDZA 5B3RA 3FAIA 2FHXB 3R2UA 4O98A 4YSBA 4ZEJA 4KEPA 2I7TA 5A0VA 2Y87A 4UA4A 1VMEA 5ACSA 2OHHA 1WRAA 2YNWA 2DOOA 5EV8A 5ACXA 5ACQA 2BFZB 5EWAA 4BP0A 3IE2A 1DDKA 2ZWRA 4AWZA 4HL1A 2QEDA 2ZO4A 4D1WA 4WD6A 4EYLA 1BMCA 4TYTA 4AX1B 1QH5A 1X8IA 5LLDA 5LCFA 2P97A 3MD7A 1VGNA 3L6NA 1X8GA 3DH8A 5B15A 1BC2A 2BG8B 2YNTA 5A0TA 1JJEA 5B1UA 2YZ3A 4GYUA 4FSBA 3DHCA 5KIKA 2QINA 2BG8A 2BR6A 3DHAA 3SBLA 2BGAA 1WUPA 1XM8A 3IE1A 2E7YA 5KILA 1WW1A 3AF5A 3BK1A 2FU8A 3SW3A 1XTOA 5HIQA 2BFKA 3S0ZA 4F6ZA 4C1FA 4YSKA 2QDTA 3T3OA 3I15A 2FM6A 3RKJA 1P9EA 2A7MA 4NQ4A 4TZ9A 4YSLA 2WHGA 3SRXA 5IQKA 5FQAA 1MQOA 4NQ5A 2WYMC 3QH8A 1VJNA 5K4MA 1L9YA 2M5DA 5ACVA 1HLKA 1KR3A 4EXSA 2UYXA 4P62A 1KO2A 3ADRA 4RBSA 1SMLA 4NQ2A 3ZWFA 4Z6XA 3X2YA 1ZKPA 3FCZA 4HL2A 2P1EA 3IE0A 2YNVB 1YCGA 5HISA 5ACUA 3PG4A 4UWPB 2BG7A 2H6AA 5AXOA 4RL2A 4XWTA 3Q6VA 3SFPA 4EXYA 1E5DA 3X2XA 3X2ZA 4DILA 5HH4A 2OHIA 1K07A 3ESHA 4Z60A 4Z5ZA 4Z7RA 5K4NA 2Q0IA 4TZBA 3SPUA 5ACPA 1DD6A 2XR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WYL A;  4AWY B;  1DXK A;  3KL7 A;  4Z67 A;  4V0H A;  3KNS A;  1YCF A;  5EV6 A;  4TYF A;  3ZNB A;  4C1G A;  4U4L A;  4H0D A;  3AF6 A;  5AEB A;  2DKF A;  4JO0 A;  5K4K A;  2FU7 A;  4RM5 A;  4BZ3 A;  4AX0 B;  4D1T A;  3IEL A;  2GFJ A;  5AHO A;  5ACT A;  5LCH A;  5LM6 A;  2YNT B;  4XWW A;  1YCH A;  2Q0J A;  2WRS A;  5A5Z A;  1Y44 A;  4KEQ A;  3WXC A;  3F9O A;  2BFL A;  4F6H A;  3PY5 A;  3LVZ A;  5EVK A;  2HB9 A;  2ZNB A;  4ZO3 A;  1JJT A;  3BC2 A;  5ACW A;  2NYP A;  3I14 A;  5A87 A;  2YCB A;  4FR7 A;  4LE6 A;  4NQ6 A;  4J5F A;  4UWR B;  4EYF A;  1ZTC A;  1JT1 A;  4RAW A;  4GCW A;  2P4Z A;  4TZE A;  4GYQ A;  4C1C A;  4AD9 A;  3I0V A;  4EY2 A;  2BTN A;  5DPX A;  2P18 A;  2I7X A;  5AYA A;  1A8T A;  2NZF A;  4RAM A;  1KO3 A;  4UAM A;  3AJ3 A;  5LS3 A;  2BMI A;  5HIO A;  4UBQ A;  4XUK A;  3SD9 A;  5EVD A;  3KNR A;  3ZR9 A;  5HH5 A;  4B87 A;  2BG2 A;  4RL0 A;  2FU9 A;  4UWS B;  3VQZ A;  3VPE A;  1A7T A;  2I7V A;  2QDS A;  2YNV A;  1QH3 A;  2GCU A;  1M2X A;  2GKL A;  3T9M A;  5EVB A;  5LSC A;  3RPC A;  5K0W A;  2NZE A;  5HH6 A;  4CHL A;  3TP9 A;  5FQB A;  2AZ4 A;  5LMC A;  3P2U A;  4ZNB A;  2VW8 A;  4J5H A;  2YNU A;  2ZZI A;  2Q9U A;  2OHJ A;  2QJS A;  4C1D A;  3I11 A;  2FU6 A;  2NXA A;  3IOG A;  4PVT A;  5EW0 A;  2Y8B A;  2BG6 A;  2BIB A;  4EYB A;  5HIP A;  4DIK A;  2FHX A;  2Y8A A;  1ZNB A;  3X30 A;  2Q42 A;  3I13 A;  5AHR A;  3JXP A;  3BK2 A;  4C1H A;  4EFZ A;  2GMN A;  3H3E A;  1WUO A;  3IEK A;  3T3N A;  4UWO B;  2XF4 A;  2FK6 A;  4TZF A;  5ACR A;  3DHB A;  3ZQ4 A;  3IOF A;  3A4Y A;  1BVT A;  3RKK A;  5AXR A;  4Z5Y A;  3PY6 A;  4C1E A;  4C09 A;  2BC2 A;  2BFZ A;  2R2D A;  4HKY A;  3G1P A;  4PVO A;  2WYM A;  5EH9 A;  3BV6 A;  2M5C A;  2CBN A;  2AIO A;  4D02 A;  5LCA A;  4D1U A;  4ZO2 A;  5EHT A;  4FEK A;  3IEM A;  1X8H A;  5FQC A;  5LE1 A;  4D1V A;  2GFK A;  3IDZ A;  5B3R A;  3FAI A;  2FHX B;  3R2U A;  4O98 A;  4YSB A;  4ZEJ A;  4KEP A;  2I7T A;  5A0V A;  2Y87 A;  4UA4 A;  1VME A;  5ACS A;  2OHH A;  1WRA A;  2YNW A;  2DOO A;  5EV8 A;  5ACX A;  5ACQ A;  2BFZ B;  5EWA A;  4BP0 A;  3IE2 A;  1DDK A;  2ZWR A;  4AWZ A;  4HL1 A;  2QED A;  2ZO4 A;  4D1W A;  4WD6 A;  4EYL A;  1BMC A;  4TYT A;  4AX1 B;  1QH5 A;  1X8I A;  5LLD A;  5LCF A;  2P97 A;  3MD7 A;  1VGN A;  3L6N A;  1X8G A;  3DH8 A;  5B15 A;  1BC2 A;  2BG8 B;  2YNT A;  5A0T A;  1JJE A;  5B1U A;  2YZ3 A;  4GYU A;  4FSB A;  3DHC A;  5KIK A;  2QIN A;  2BG8 A;  2BR6 A;  3DHA A;  3SBL A;  2BGA A;  1WUP A;  1XM8 A;  3IE1 A;  2E7Y A;  5KIL A;  1WW1 A;  3AF5 A;  3BK1 A;  2FU8 A;  3SW3 A;  1XTO A;  5HIQ A;  2BFK A;  3S0Z A;  4F6Z A;  4C1F A;  4YSK A;  2QDT A;  3T3O A;  3I15 A;  2FM6 A;  3RKJ A;  1P9E A;  2A7M A;  4NQ4 A;  4TZ9 A;  4YSL A;  2WHG A;  3SRX A;  5IQK A;  5FQA A;  1MQO A;  4NQ5 A;  2WYM C;  3QH8 A;  1VJN A;  5K4M A;  1L9Y A;  2M5D A;  5ACV A;  1HLK A;  1KR3 A;  4EXS A;  2UYX A;  4P62 A;  1KO2 A;  3ADR A;  4RBS A;  1SML A;  4NQ2 A;  3ZWF A;  4Z6X A;  3X2Y A;  1ZKP A;  3FCZ A;  4HL2 A;  2P1E A;  3IE0 A;  2YNV B;  1YCG A;  5HIS A;  5ACU A;  3PG4 A;  4UWP B;  2BG7 A;  2H6A A;  5AXO A;  4RL2 A;  4XWT A;  3Q6V A;  3SFP A;  4EXY A;  1E5D A;  3X2X A;  3X2Z A;  4DIL A;  5HH4 A;  2OHI A;  1K07 A;  3ESH A;  4Z60 A;  4Z5Z A;  4Z7R A;  5K4N A;  2Q0I A;  4TZB A;  3SPU A;  5ACP A;  1DD6 A;  2XR1 A; 
#chains in the Genus database with same CATH topology
 2WYL A;  4AWY B;  1DXK A;  3KL7 A;  4Z67 A;  4V0H A;  3KNS A;  1YCF A;  4AXH A;  5EV6 A;  4TYF A;  3ZNB A;  4C1G A;  4U4L A;  4H0D A;  3AF6 A;  5AEB A;  2DKF A;  4JO0 A;  5K4K A;  2FU7 A;  4RM5 A;  4BZ3 A;  4AX0 B;  4D1T A;  3IEL A;  2GFJ A;  5AHO A;  5ACT A;  5LCH A;  5LM6 A;  5AJL A;  2YNT B;  4XWW A;  1YCH A;  2Q0J A;  2WRS A;  5A5Z A;  1Y44 A;  4KEQ A;  3WXC A;  3F9O A;  2BFL A;  4F6H A;  3PY5 A;  3LVZ A;  5EVK A;  2HB9 A;  2ZNB A;  4ZO3 A;  1JJT A;  3BC2 A;  5ACW A;  2NYP A;  3I14 A;  5A87 A;  2YCB A;  4FR7 A;  4LE6 A;  4NQ6 A;  4J5F A;  4UWR B;  4EYF A;  1ZTC A;  1JT1 A;  4RAW A;  4GCW A;  2P4Z A;  4TZE A;  4GYQ A;  4C1C A;  4AD9 A;  3I0V A;  4EY2 A;  2BTN A;  5DPX A;  2P18 A;  2I7X A;  5AYA A;  1A8T A;  2NZF A;  4RAM A;  1KO3 A;  4UAM A;  3AJ3 A;  5LS3 A;  2BMI A;  5HIO A;  4NUR A;  4UBQ A;  4XUK A;  3SD9 A;  5EVD A;  3KNR A;  3ZR9 A;  5HH5 A;  4B87 A;  2BG2 A;  4RL0 A;  2FU9 A;  4UWS B;  3VQZ A;  3VPE A;  1A7T A;  2I7V A;  2QDS A;  2YNV A;  1QH3 A;  2GCU A;  2CG2 A;  1M2X A;  2GKL A;  3T9M A;  2CG3 A;  5EVB A;  5LSC A;  3RPC A;  5K0W A;  2NZE A;  5HH6 A;  4CHL A;  3TP9 A;  5FQB A;  2AZ4 A;  5LMC A;  3P2U A;  4ZNB A;  2VW8 A;  4J5H A;  2YNU A;  2ZZI A;  2Q9U A;  2OHJ A;  2QJS A;  4C1D A;  3I11 A;  2FU6 A;  2NXA A;  3IOG A;  4PVT A;  5EW0 A;  2Y8B A;  4PDX A;  2BG6 A;  2BIB A;  4EYB A;  5HIP A;  4DIK A;  2FHX A;  2Y8A A;  1ZNB A;  3X30 A;  2Q42 A;  3I13 A;  5AHR A;  3JXP A;  3BK2 A;  2CFU A;  4C1H A;  4EFZ A;  2GMN A;  3H3E A;  1WUO A;  3IEK A;  3T3N A;  4UWO B;  2XF4 A;  2FK6 A;  4TZF A;  5ACR A;  3DHB A;  3ZQ4 A;  3IOF A;  3A4Y A;  1BVT A;  3RKK A;  5AXR A;  4Z5Y A;  3PY6 A;  4C1E A;  4C09 A;  2BC2 A;  2BFZ A;  2CFZ A;  2R2D A;  4HKY A;  3G1P A;  4PVO A;  2WYM A;  5EH9 A;  3BV6 A;  2M5C A;  2CBN A;  2AIO A;  4D02 A;  5LCA A;  4D1U A;  4ZO2 A;  5EHT A;  4FEK A;  3IEM A;  1X8H A;  5FQC A;  5A23 A;  4AV7 A;  5LE1 A;  4D1V A;  2GFK A;  3IDZ A;  5B3R A;  3FAI A;  2FHX B;  3R2U A;  4O98 A;  4YSB A;  4ZEJ A;  4KEP A;  2I7T A;  5A0V A;  2Y87 A;  4UA4 A;  1VME A;  5ACS A;  2OHH A;  1WRA A;  2YNW A;  2DOO A;  5EV8 A;  5ACX A;  5ACQ A;  2BFZ B;  5EWA A;  4BP0 A;  3IE2 A;  1DDK A;  2ZWR A;  4AWZ A;  4HL1 A;  2QED A;  2ZO4 A;  4D1W A;  4WD6 A;  4EYL A;  1BMC A;  4TYT A;  4AX1 B;  1QH5 A;  1X8I A;  5LLD A;  5LCF A;  2P97 A;  3MD7 A;  1VGN A;  3L6N A;  1X8G A;  3DH8 A;  5B15 A;  1BC2 A;  2BG8 B;  2YNT A;  5A0T A;  1JJE A;  5B1U A;  2YZ3 A;  4GYU A;  4FSB A;  3DHC A;  5KIK A;  2QIN A;  2BG8 A;  2BR6 A;  3DHA A;  3SBL A;  2BGA A;  1WUP A;  1XM8 A;  3IE1 A;  2E7Y A;  5KIL A;  1WW1 A;  3AF5 A;  3BK1 A;  2FU8 A;  5AIJ A;  3SW3 A;  1XTO A;  5HIQ A;  2BFK A;  3S0Z A;  4F6Z A;  4C1F A;  4YSK A;  2QDT A;  3T3O A;  3I15 A;  2FM6 A;  3RKJ A;  1P9E A;  2YHE A;  2A7M A;  4NQ4 A;  4TZ9 A;  4YSL A;  2WHG A;  3SRX A;  5IQK A;  5FQA A;  1MQO A;  4NQ5 A;  2WYM C;  3QH8 A;  1VJN A;  5K4M A;  1L9Y A;  2M5D A;  5ACV A;  1HLK A;  1KR3 A;  4EXS A;  2UYX A;  4P62 A;  1KO2 A;  3ADR A;  4RBS A;  1SML A;  4NQ2 A;  3ZWF A;  4Z6X A;  3X2Y A;  1ZKP A;  3FCZ A;  4HL2 A;  2P1E A;  3IE0 A;  2YNV B;  1YCG A;  5HIS A;  5ACU A;  3PG4 A;  4UWP B;  2BG7 A;  2H6A A;  5AXO A;  4RL2 A;  4XWT A;  3Q6V A;  3SFP A;  4EXY A;  1E5D A;  3X2X A;  3X2Z A;  4DIL A;  5HH4 A;  2OHI A;  1K07 A;  3ESH A;  4Z60 A;  4Z5Z A;  4Z7R A;  5K4N A;  2Q0I A;  4TZB A;  3SPU A;  5ACP A;  1DD6 A;  2XR1 A; 
#chains in the Genus database with same CATH homology
 2WYL A;  4AWY B;  1DXK A;  3KL7 A;  4Z67 A;  4V0H A;  3KNS A;  1YCF A;  5EV6 A;  4TYF A;  3ZNB A;  4C1G A;  4U4L A;  4H0D A;  3AF6 A;  5AEB A;  2DKF A;  4JO0 A;  5K4K A;  2FU7 A;  4RM5 A;  4BZ3 A;  4AX0 B;  4D1T A;  3IEL A;  2GFJ A;  5AHO A;  5ACT A;  5LCH A;  5LM6 A;  2YNT B;  4XWW A;  1YCH A;  2Q0J A;  2WRS A;  5A5Z A;  1Y44 A;  4KEQ A;  3WXC A;  3F9O A;  2BFL A;  4F6H A;  3PY5 A;  3LVZ A;  5EVK A;  2HB9 A;  2ZNB A;  4ZO3 A;  1JJT A;  3BC2 A;  5ACW A;  2NYP A;  3I14 A;  5A87 A;  2YCB A;  4FR7 A;  4LE6 A;  4NQ6 A;  4J5F A;  4UWR B;  4EYF A;  1ZTC A;  1JT1 A;  4RAW A;  4GCW A;  2P4Z A;  4TZE A;  4GYQ A;  4C1C A;  4AD9 A;  3I0V A;  4EY2 A;  2BTN A;  5DPX A;  2P18 A;  2I7X A;  5AYA A;  1A8T A;  2NZF A;  4RAM A;  1KO3 A;  4UAM A;  3AJ3 A;  5LS3 A;  2BMI A;  5HIO A;  4UBQ A;  4XUK A;  3SD9 A;  5EVD A;  3KNR A;  3ZR9 A;  5HH5 A;  4B87 A;  2BG2 A;  4RL0 A;  2FU9 A;  4UWS B;  3VQZ A;  3VPE A;  1A7T A;  2I7V A;  2QDS A;  2YNV A;  1QH3 A;  2GCU A;  1M2X A;  2GKL A;  3T9M A;  5EVB A;  5LSC A;  3RPC A;  5K0W A;  2NZE A;  5HH6 A;  4CHL A;  3TP9 A;  5FQB A;  2AZ4 A;  5LMC A;  3P2U A;  4ZNB A;  2VW8 A;  4J5H A;  2YNU A;  2ZZI A;  2Q9U A;  2OHJ A;  2QJS A;  4C1D A;  3I11 A;  2FU6 A;  2NXA A;  3IOG A;  4PVT A;  5EW0 A;  2Y8B A;  2BG6 A;  2BIB A;  4EYB A;  5HIP A;  4DIK A;  2FHX A;  2Y8A A;  1ZNB A;  3X30 A;  2Q42 A;  3I13 A;  5AHR A;  3JXP A;  3BK2 A;  4C1H A;  4EFZ A;  2GMN A;  3H3E A;  1WUO A;  3IEK A;  3T3N A;  4UWO B;  2XF4 A;  2FK6 A;  4TZF A;  5ACR A;  3DHB A;  3ZQ4 A;  3IOF A;  3A4Y A;  1BVT A;  3RKK A;  5AXR A;  4Z5Y A;  3PY6 A;  4C1E A;  4C09 A;  2BC2 A;  2BFZ A;  2R2D A;  4HKY A;  3G1P A;  4PVO A;  2WYM A;  5EH9 A;  3BV6 A;  2M5C A;  2CBN A;  2AIO A;  4D02 A;  5LCA A;  4D1U A;  4ZO2 A;  5EHT A;  4FEK A;  3IEM A;  1X8H A;  5FQC A;  5LE1 A;  4D1V A;  2GFK A;  3IDZ A;  5B3R A;  3FAI A;  2FHX B;  3R2U A;  4O98 A;  4YSB A;  4ZEJ A;  4KEP A;  2I7T A;  5A0V A;  2Y87 A;  4UA4 A;  1VME A;  5ACS A;  2OHH A;  1WRA A;  2YNW A;  2DOO A;  5EV8 A;  5ACX A;  5ACQ A;  2BFZ B;  5EWA A;  4BP0 A;  3IE2 A;  1DDK A;  2ZWR A;  4AWZ A;  4HL1 A;  2QED A;  2ZO4 A;  4D1W A;  4WD6 A;  4EYL A;  1BMC A;  4TYT A;  4AX1 B;  1QH5 A;  1X8I A;  5LLD A;  5LCF A;  2P97 A;  3MD7 A;  1VGN A;  3L6N A;  1X8G A;  3DH8 A;  5B15 A;  1BC2 A;  2BG8 B;  2YNT A;  5A0T A;  1JJE A;  5B1U A;  2YZ3 A;  4GYU A;  4FSB A;  3DHC A;  5KIK A;  2QIN A;  2BG8 A;  2BR6 A;  3DHA A;  3SBL A;  2BGA A;  1WUP A;  1XM8 A;  3IE1 A;  2E7Y A;  5KIL A;  1WW1 A;  3AF5 A;  3BK1 A;  2FU8 A;  3SW3 A;  1XTO A;  5HIQ A;  2BFK A;  3S0Z A;  4F6Z A;  4C1F A;  4YSK A;  2QDT A;  3T3O A;  3I15 A;  2FM6 A;  3RKJ A;  1P9E A;  2A7M A;  4NQ4 A;  4TZ9 A;  4YSL A;  2WHG A;  3SRX A;  5IQK A;  5FQA A;  1MQO A;  4NQ5 A;  2WYM C;  3QH8 A;  1VJN A;  5K4M A;  1L9Y A;  2M5D A;  5ACV A;  1HLK A;  1KR3 A;  4EXS A;  2UYX A;  4P62 A;  1KO2 A;  3ADR A;  4RBS A;  1SML A;  4NQ2 A;  3ZWF A;  4Z6X A;  3X2Y A;  1ZKP A;  3FCZ A;  4HL2 A;  2P1E A;  3IE0 A;  2YNV B;  1YCG A;  5HIS A;  5ACU A;  3PG4 A;  4UWP B;  2BG7 A;  2H6A A;  5AXO A;  4RL2 A;  4XWT A;  3Q6V A;  3SFP A;  4EXY A;  1E5D A;  3X2X A;  3X2Z A;  4DIL A;  5HH4 A;  2OHI A;  1K07 A;  3ESH A;  4Z60 A;  4Z5Z A;  4Z7R A;  5K4N A;  2Q0I A;  4TZB A;  3SPU A;  5ACP A;  1DD6 A;  2XR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...