4KEPA

Crystal structure of 4-pyridoxolactonase, wild-type
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
molecule tags Hydrolase
molecule keywords 4-pyridoxolactonase
total genus 93
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4kepA00
4Z60A 5ACPA 2BTNA 1WRAA 3SFPA 1JT1A 2XR1A 2QJSA 4KEPA 4XWWA 3H3EA 4DILA 1QH3A 2BG2A 5FQCA 2H6AA 2Q0IA 2GCUA 4F6ZA 4HL1A 5LLDA 2DOOA 5EVBA 2FK6A 2YNVA 2I7TA 3IOFA 4YSBA 5ACWA 4UWOB 3P2UA 5ACQA 5AHOA 4TYTA 5HISA 4C09A 4EYLA 5EV6A 5A0TA 1KR3A 3TP9A 2YNTB 2M5CA 3RKJA 3PY5A 2DKFA 3KNSA 1ZNBA 4P62A 2NXAA 1XTOA 3IOGA 4TZ9A 3AJ3A 4B87A 3T3OA 2P4ZA 2FU6A 4DIKA 3ZQ4A 2BFKA 3S0ZA 2E7YA 3AF6A 4JO0A 2GFKA 4F6HA 4NQ4A 5LCHA 4TZFA 3X2XA 4HL2A 4EXYA 5FQBA 1VGNA 3SD9A 4GCWA 4TYFA 1SMLA 4D1UA 2YZ3A 5KIKA 4NQ6A 3T9MA 1M2XA 1XM8A 2P97A 2YNTA 4RL0A 4GYUA 4AD9A 5EVDA 3I0VA 4WD6A 5HH4A 4NQ2A 1BVTA 2OHJA 5B3RA 4FEKA 3X2ZA 5LCAA 1YCGA 3DH8A 4Z5YA 1X8HA 4AX1B 4D1WA 5KILA 3Q6VA 4ZO3A 5EVKA 1E5DA 3IE0A 5B15A 2BC2A 1VMEA 4AWYB 2WYMA 4UWRB 4YSLA 5LMCA 2I7VA 4PVTA 3X30A 2UYXA 4EXSA 4XWTA 2ZZIA 2NYPA 2Y8AA 1P9EA 3R2UA 5EV8A 5A87A 4BZ3A 3LVZA 1KO3A 4GYQA 2QINA 2YNUA 5IQKA 4UWPB 4Z6XA 1VJNA 2BIBA 2YNWA 2AIOA 4C1EA 1BMCA 4J5HA 4PVOA 3IEKA 5HH5A 2FU7A 4C1GA 3ADRA 3PY6A 3IE1A 2XF4A 3QH8A 4Z7RA 3I14A 4EY2A 2BFZA 2HB9A 4Z67A 3FCZA 4FSBA 4C1FA 2BFLA 5HIPA 3BK1A 2P1EA 3PG4A 4RBSA 4D1VA 2WYLA 5ACTA 5A5ZA 4TZEA 5A0VA 4UWSB 1JJEA 4NQ5A 1WW1A 4RAWA 3RPCA 1JJTA 5AYAA 4EFZA 3RKKA 4ZO2A 5ACVA 5LS3A 5HH6A 2VW8A 3IEMA 1QH5A 5LCFA 3ESHA 2FHXB 2GMNA 4D02A 1X8IA 2BG7A 2R2DA 3SBLA 3ZWFA 5ACSA 3KNRA 4HKYA 4Z5ZA 1WUOA 2BG6A 4U4LA 1KO2A 2BG8A 2Q42A 5AHRA 4AWZA 2WYMC 5EW0A 5EH9A 2QEDA 2BFZB 2FU8A 1L9YA 3KL7A 5AXOA 5B1UA 3G1PA 3BV6A 4UA4A 3L6NA 4RM5A 2QDSA 1A8TA 5K4NA 1MQOA 4D1TA 5FQAA 4UBQA 5ACUA 4C1CA 2WHGA 3DHCA 1YCFA 4C1HA 1Y44A 2P18A 4C1DA 2ZWRA 4EYBA 2FM6A 2FU9A 3IE2A 4XUKA 3FAIA 4CHLA 4FR7A 4EYFA 4RL2A 4ZEJA 5LE1A 3F9OA 2BMIA 3I15A 2BGAA 5ACRA 4BP0A 3A4YA 3X2YA 2BG8B 2Q0JA 3DHAA 3IELA 3ZR9A 5LSCA 2OHIA 5AEBA 4H0DA 5HIQA 3AF5A 5EWAA 5DPXA 1HLKA 3JXPA 2Y8BA 2NZEA 5ACXA 3MD7A 3T3NA 5EHTA 3I13A 3BK2A 4AX0B 5HIOA 2FHXA 2AZ4A 2M5DA 1DXKA 1YCHA 5AXRA 2CBNA 4ZNBA 2OHHA 2QDTA 1K07A 1BC2A 4LE6A 3VQZA 3I11A 2Y87A 2A7MA 2GFJA 2Q9UA 4J5FA 4KEQA 2GKLA 3SW3A 5K4KA 2YCBA 2NZFA 1A7TA 3ZNBA 1ZKPA 1DD6A 4O98A 4YSKA 1X8GA 3WXCA 4TZBA 2YNVB 5LM6A 3IDZA 2ZNBA 4RAMA 5K0WA 5K4MA 2WRSA 3BC2A 2ZO4A 1ZTCA 4UAMA 3DHBA 2BR6A 3VPEA 3SPUA 4V0HA 1WUPA 3SRXA 2I7XA 1DDKA
chains in the Genus database with same CATH superfamily
4Z60A 5ACPA 2BTNA 1WRAA 3SFPA 1JT1A 2XR1A 2QJSA 4KEPA 4XWWA 3H3EA 4DILA 1QH3A 5AJLA 2BG2A 5FQCA 2H6AA 2Q0IA 2GCUA 4F6ZA 4HL1A 5LLDA 2DOOA 5EVBA 2FK6A 2YNVA 2I7TA 3IOFA 4YSBA 5ACWA 4UWOB 3P2UA 5ACQA 5AHOA 4TYTA 5HISA 4C09A 4EYLA 5EV6A 5A0TA 1KR3A 3TP9A 2YNTB 2M5CA 3RKJA 3PY5A 2DKFA 3KNSA 1ZNBA 4P62A 2NXAA 1XTOA 3IOGA 4TZ9A 4PDXA 3AJ3A 4B87A 3T3OA 2P4ZA 2FU6A 4DIKA 3ZQ4A 2BFKA 3S0ZA 2E7YA 3AF6A 4JO0A 2GFKA 4F6HA 4NQ4A 5LCHA 4TZFA 3X2XA 4HL2A 4EXYA 2YHEA 5FQBA 1VGNA 3SD9A 4GCWA 4TYFA 1SMLA 4D1UA 2YZ3A 5KIKA 4NQ6A 3T9MA 1M2XA 2CFZA 1XM8A 2P97A 4AV7A 2YNTA 4RL0A 4GYUA 4AD9A 5EVDA 3I0VA 2CG3A 4WD6A 5HH4A 4NQ2A 1BVTA 2OHJA 5B3RA 4FEKA 3X2ZA 5AIJA 5LCAA 1YCGA 3DH8A 4Z5YA 1X8HA 4AX1B 4D1WA 5KILA 3Q6VA 4ZO3A 5EVKA 1E5DA 3IE0A 5B15A 2BC2A 1VMEA 4AWYB 2WYMA 4UWRB 4YSLA 5LMCA 2I7VA 4PVTA 3X30A 2UYXA 4EXSA 4XWTA 2ZZIA 2NYPA 2Y8AA 1P9EA 3R2UA 5EV8A 5A87A 4BZ3A 3LVZA 1KO3A 4GYQA 2QINA 2YNUA 5IQKA 4UWPB 4Z6XA 1VJNA 2BIBA 2YNWA 2AIOA 4C1EA 1BMCA 4J5HA 4PVOA 3IEKA 5HH5A 2FU7A 4C1GA 3ADRA 3PY6A 3IE1A 2XF4A 3QH8A 4Z7RA 3I14A 4EY2A 2BFZA 2HB9A 4Z67A 3FCZA 4FSBA 4C1FA 2BFLA 5HIPA 3BK1A 2P1EA 3PG4A 4RBSA 4D1VA 2WYLA 5ACTA 5A5ZA 4TZEA 5A0VA 4UWSB 1JJEA 4NQ5A 1WW1A 4RAWA 3RPCA 1JJTA 5AYAA 4EFZA 3RKKA 4ZO2A 5ACVA 5LS3A 5HH6A 2VW8A 3IEMA 1QH5A 5LCFA 3ESHA 2FHXB 2GMNA 4D02A 1X8IA 2BG7A 2R2DA 3SBLA 3ZWFA 5ACSA 3KNRA 4HKYA 4Z5ZA 1WUOA 2BG6A 4U4LA 1KO2A 2BG8A 2Q42A 5AHRA 4AWZA 2WYMC 5EW0A 5EH9A 2QEDA 2BFZB 2FU8A 1L9YA 3KL7A 5AXOA 5B1UA 2CG2A 3G1PA 3BV6A 4UA4A 3L6NA 4RM5A 2QDSA 1A8TA 5K4NA 1MQOA 4D1TA 5FQAA 4UBQA 5ACUA 4C1CA 2WHGA 3DHCA 1YCFA 4C1HA 1Y44A 2P18A 4C1DA 2ZWRA 4EYBA 2FM6A 5A23A 2FU9A 3IE2A 4XUKA 3FAIA 4CHLA 4FR7A 4EYFA 4RL2A 4ZEJA 5LE1A 3F9OA 2BMIA 3I15A 2BGAA 4NURA 5ACRA 4BP0A 3A4YA 3X2YA 2BG8B 2Q0JA 3DHAA 3IELA 3ZR9A 5LSCA 2OHIA 5AEBA 4H0DA 5HIQA 3AF5A 5EWAA 5DPXA 1HLKA 3JXPA 4AXHA 2Y8BA 2NZEA 5ACXA 3MD7A 3T3NA 5EHTA 3I13A 3BK2A 4AX0B 5HIOA 2FHXA 2AZ4A 2M5DA 1DXKA 1YCHA 5AXRA 2CBNA 4ZNBA 2OHHA 2QDTA 1K07A 1BC2A 4LE6A 3VQZA 3I11A 2Y87A 2A7MA 2GFJA 2Q9UA 4J5FA 4KEQA 2GKLA 3SW3A 2CFUA 5K4KA 2YCBA 2NZFA 1A7TA 3ZNBA 1ZKPA 1DD6A 4O98A 4YSKA 1X8GA 3WXCA 4TZBA 2YNVB 5LM6A 3IDZA 2ZNBA 4RAMA 5K0WA 5K4MA 2WRSA 3BC2A 2ZO4A 1ZTCA 4UAMA 3DHBA 2BR6A 3VPEA 3SPUA 4V0HA 1WUPA 3SRXA 2I7XA 1DDKA
chains in the Genus database with same CATH topology
4Z60A 5ACPA 2BTNA 1WRAA 3SFPA 1JT1A 2XR1A 2QJSA 4KEPA 4XWWA 3H3EA 4DILA 1QH3A 2BG2A 5FQCA 2H6AA 2Q0IA 2GCUA 4F6ZA 4HL1A 5LLDA 2DOOA 5EVBA 2FK6A 2YNVA 2I7TA 3IOFA 4YSBA 5ACWA 4UWOB 3P2UA 5ACQA 5AHOA 4TYTA 5HISA 4C09A 4EYLA 5EV6A 5A0TA 1KR3A 3TP9A 2YNTB 2M5CA 3RKJA 3PY5A 2DKFA 3KNSA 1ZNBA 4P62A 2NXAA 1XTOA 3IOGA 4TZ9A 3AJ3A 4B87A 3T3OA 2P4ZA 2FU6A 4DIKA 3ZQ4A 2BFKA 3S0ZA 2E7YA 3AF6A 4JO0A 2GFKA 4F6HA 4NQ4A 5LCHA 4TZFA 3X2XA 4HL2A 4EXYA 5FQBA 1VGNA 3SD9A 4GCWA 4TYFA 1SMLA 4D1UA 2YZ3A 5KIKA 4NQ6A 3T9MA 1M2XA 1XM8A 2P97A 2YNTA 4RL0A 4GYUA 4AD9A 5EVDA 3I0VA 4WD6A 5HH4A 4NQ2A 1BVTA 2OHJA 5B3RA 4FEKA 3X2ZA 5LCAA 1YCGA 3DH8A 4Z5YA 1X8HA 4AX1B 4D1WA 5KILA 3Q6VA 4ZO3A 5EVKA 1E5DA 3IE0A 5B15A 2BC2A 1VMEA 4AWYB 2WYMA 4UWRB 4YSLA 5LMCA 2I7VA 4PVTA 3X30A 2UYXA 4EXSA 4XWTA 2ZZIA 2NYPA 2Y8AA 1P9EA 3R2UA 5EV8A 5A87A 4BZ3A 3LVZA 1KO3A 4GYQA 2QINA 2YNUA 5IQKA 4UWPB 4Z6XA 1VJNA 2BIBA 2YNWA 2AIOA 4C1EA 1BMCA 4J5HA 4PVOA 3IEKA 5HH5A 2FU7A 4C1GA 3ADRA 3PY6A 3IE1A 2XF4A 3QH8A 4Z7RA 3I14A 4EY2A 2BFZA 2HB9A 4Z67A 3FCZA 4FSBA 4C1FA 2BFLA 5HIPA 3BK1A 2P1EA 3PG4A 4RBSA 4D1VA 2WYLA 5ACTA 5A5ZA 4TZEA 5A0VA 4UWSB 1JJEA 4NQ5A 1WW1A 4RAWA 3RPCA 1JJTA 5AYAA 4EFZA 3RKKA 4ZO2A 5ACVA 5LS3A 5HH6A 2VW8A 3IEMA 1QH5A 5LCFA 3ESHA 2FHXB 2GMNA 4D02A 1X8IA 2BG7A 2R2DA 3SBLA 3ZWFA 5ACSA 3KNRA 4HKYA 4Z5ZA 1WUOA 2BG6A 4U4LA 1KO2A 2BG8A 2Q42A 5AHRA 4AWZA 2WYMC 5EW0A 5EH9A 2QEDA 2BFZB 2FU8A 1L9YA 3KL7A 5AXOA 5B1UA 3G1PA 3BV6A 4UA4A 3L6NA 4RM5A 2QDSA 1A8TA 5K4NA 1MQOA 4D1TA 5FQAA 4UBQA 5ACUA 4C1CA 2WHGA 3DHCA 1YCFA 4C1HA 1Y44A 2P18A 4C1DA 2ZWRA 4EYBA 2FM6A 2FU9A 3IE2A 4XUKA 3FAIA 4CHLA 4FR7A 4EYFA 4RL2A 4ZEJA 5LE1A 3F9OA 2BMIA 3I15A 2BGAA 5ACRA 4BP0A 3A4YA 3X2YA 2BG8B 2Q0JA 3DHAA 3IELA 3ZR9A 5LSCA 2OHIA 5AEBA 4H0DA 5HIQA 3AF5A 5EWAA 5DPXA 1HLKA 3JXPA 2Y8BA 2NZEA 5ACXA 3MD7A 3T3NA 5EHTA 3I13A 3BK2A 4AX0B 5HIOA 2FHXA 2AZ4A 2M5DA 1DXKA 1YCHA 5AXRA 2CBNA 4ZNBA 2OHHA 2QDTA 1K07A 1BC2A 4LE6A 3VQZA 3I11A 2Y87A 2A7MA 2GFJA 2Q9UA 4J5FA 4KEQA 2GKLA 3SW3A 5K4KA 2YCBA 2NZFA 1A7TA 3ZNBA 1ZKPA 1DD6A 4O98A 4YSKA 1X8GA 3WXCA 4TZBA 2YNVB 5LM6A 3IDZA 2ZNBA 4RAMA 5K0WA 5K4MA 2WRSA 3BC2A 2ZO4A 1ZTCA 4UAMA 3DHBA 2BR6A 3VPEA 3SPUA 4V0HA 1WUPA 3SRXA 2I7XA 1DDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z60 A;  5ACP A;  2BTN A;  1WRA A;  3SFP A;  1JT1 A;  2XR1 A;  2QJS A;  4KEP A;  4XWW A;  3H3E A;  4DIL A;  1QH3 A;  2BG2 A;  5FQC A;  2H6A A;  2Q0I A;  2GCU A;  4F6Z A;  4HL1 A;  5LLD A;  2DOO A;  5EVB A;  2FK6 A;  2YNV A;  2I7T A;  3IOF A;  4YSB A;  5ACW A;  4UWO B;  3P2U A;  5ACQ A;  5AHO A;  4TYT A;  5HIS A;  4C09 A;  4EYL A;  5EV6 A;  5A0T A;  1KR3 A;  3TP9 A;  2YNT B;  2M5C A;  3RKJ A;  3PY5 A;  2DKF A;  3KNS A;  1ZNB A;  4P62 A;  2NXA A;  1XTO A;  3IOG A;  4TZ9 A;  3AJ3 A;  4B87 A;  3T3O A;  2P4Z A;  2FU6 A;  4DIK A;  3ZQ4 A;  2BFK A;  3S0Z A;  2E7Y A;  3AF6 A;  4JO0 A;  2GFK A;  4F6H A;  4NQ4 A;  5LCH A;  4TZF A;  3X2X A;  4HL2 A;  4EXY A;  5FQB A;  1VGN A;  3SD9 A;  4GCW A;  4TYF A;  1SML A;  4D1U A;  2YZ3 A;  5KIK A;  4NQ6 A;  3T9M A;  1M2X A;  1XM8 A;  2P97 A;  2YNT A;  4RL0 A;  4GYU A;  4AD9 A;  5EVD A;  3I0V A;  4WD6 A;  5HH4 A;  4NQ2 A;  1BVT A;  2OHJ A;  5B3R A;  4FEK A;  3X2Z A;  5LCA A;  1YCG A;  3DH8 A;  4Z5Y A;  1X8H A;  4AX1 B;  4D1W A;  5KIL A;  3Q6V A;  4ZO3 A;  5EVK A;  1E5D A;  3IE0 A;  5B15 A;  2BC2 A;  1VME A;  4AWY B;  2WYM A;  4UWR B;  4YSL A;  5LMC A;  2I7V A;  4PVT A;  3X30 A;  2UYX A;  4EXS A;  4XWT A;  2ZZI A;  2NYP A;  2Y8A A;  1P9E A;  3R2U A;  5EV8 A;  5A87 A;  4BZ3 A;  3LVZ A;  1KO3 A;  4GYQ A;  2QIN A;  2YNU A;  5IQK A;  4UWP B;  4Z6X A;  1VJN A;  2BIB A;  2YNW A;  2AIO A;  4C1E A;  1BMC A;  4J5H A;  4PVO A;  3IEK A;  5HH5 A;  2FU7 A;  4C1G A;  3ADR A;  3PY6 A;  3IE1 A;  2XF4 A;  3QH8 A;  4Z7R A;  3I14 A;  4EY2 A;  2BFZ A;  2HB9 A;  4Z67 A;  3FCZ A;  4FSB A;  4C1F A;  2BFL A;  5HIP A;  3BK1 A;  2P1E A;  3PG4 A;  4RBS A;  4D1V A;  2WYL A;  5ACT A;  5A5Z A;  4TZE A;  5A0V A;  4UWS B;  1JJE A;  4NQ5 A;  1WW1 A;  4RAW A;  3RPC A;  1JJT A;  5AYA A;  4EFZ A;  3RKK A;  4ZO2 A;  5ACV A;  5LS3 A;  5HH6 A;  2VW8 A;  3IEM A;  1QH5 A;  5LCF A;  3ESH A;  2FHX B;  2GMN A;  4D02 A;  1X8I A;  2BG7 A;  2R2D A;  3SBL A;  3ZWF A;  5ACS A;  3KNR A;  4HKY A;  4Z5Z A;  1WUO A;  2BG6 A;  4U4L A;  1KO2 A;  2BG8 A;  2Q42 A;  5AHR A;  4AWZ A;  2WYM C;  5EW0 A;  5EH9 A;  2QED A;  2BFZ B;  2FU8 A;  1L9Y A;  3KL7 A;  5AXO A;  5B1U A;  3G1P A;  3BV6 A;  4UA4 A;  3L6N A;  4RM5 A;  2QDS A;  1A8T A;  5K4N A;  1MQO A;  4D1T A;  5FQA A;  4UBQ A;  5ACU A;  4C1C A;  2WHG A;  3DHC A;  1YCF A;  4C1H A;  1Y44 A;  2P18 A;  4C1D A;  2ZWR A;  4EYB A;  2FM6 A;  2FU9 A;  3IE2 A;  4XUK A;  3FAI A;  4CHL A;  4FR7 A;  4EYF A;  4RL2 A;  4ZEJ A;  5LE1 A;  3F9O A;  2BMI A;  3I15 A;  2BGA A;  5ACR A;  4BP0 A;  3A4Y A;  3X2Y A;  2BG8 B;  2Q0J A;  3DHA A;  3IEL A;  3ZR9 A;  5LSC A;  2OHI A;  5AEB A;  4H0D A;  5HIQ A;  3AF5 A;  5EWA A;  5DPX A;  1HLK A;  3JXP A;  2Y8B A;  2NZE A;  5ACX A;  3MD7 A;  3T3N A;  5EHT A;  3I13 A;  3BK2 A;  4AX0 B;  5HIO A;  2FHX A;  2AZ4 A;  2M5D A;  1DXK A;  1YCH A;  5AXR A;  2CBN A;  4ZNB A;  2OHH A;  2QDT A;  1K07 A;  1BC2 A;  4LE6 A;  3VQZ A;  3I11 A;  2Y87 A;  2A7M A;  2GFJ A;  2Q9U A;  4J5F A;  4KEQ A;  2GKL A;  3SW3 A;  5K4K A;  2YCB A;  2NZF A;  1A7T A;  3ZNB A;  1ZKP A;  1DD6 A;  4O98 A;  4YSK A;  1X8G A;  3WXC A;  4TZB A;  2YNV B;  5LM6 A;  3IDZ A;  2ZNB A;  4RAM A;  5K0W A;  5K4M A;  2WRS A;  3BC2 A;  2ZO4 A;  1ZTC A;  4UAM A;  3DHB A;  2BR6 A;  3VPE A;  3SPU A;  4V0H A;  1WUP A;  3SRX A;  2I7X A;  1DDK A; 
#chains in the Genus database with same CATH topology
 4Z60 A;  5ACP A;  2BTN A;  1WRA A;  3SFP A;  1JT1 A;  2XR1 A;  2QJS A;  4KEP A;  4XWW A;  3H3E A;  4DIL A;  1QH3 A;  5AJL A;  2BG2 A;  5FQC A;  2H6A A;  2Q0I A;  2GCU A;  4F6Z A;  4HL1 A;  5LLD A;  2DOO A;  5EVB A;  2FK6 A;  2YNV A;  2I7T A;  3IOF A;  4YSB A;  5ACW A;  4UWO B;  3P2U A;  5ACQ A;  5AHO A;  4TYT A;  5HIS A;  4C09 A;  4EYL A;  5EV6 A;  5A0T A;  1KR3 A;  3TP9 A;  2YNT B;  2M5C A;  3RKJ A;  3PY5 A;  2DKF A;  3KNS A;  1ZNB A;  4P62 A;  2NXA A;  1XTO A;  3IOG A;  4TZ9 A;  4PDX A;  3AJ3 A;  4B87 A;  3T3O A;  2P4Z A;  2FU6 A;  4DIK A;  3ZQ4 A;  2BFK A;  3S0Z A;  2E7Y A;  3AF6 A;  4JO0 A;  2GFK A;  4F6H A;  4NQ4 A;  5LCH A;  4TZF A;  3X2X A;  4HL2 A;  4EXY A;  2YHE A;  5FQB A;  1VGN A;  3SD9 A;  4GCW A;  4TYF A;  1SML A;  4D1U A;  2YZ3 A;  5KIK A;  4NQ6 A;  3T9M A;  1M2X A;  2CFZ A;  1XM8 A;  2P97 A;  4AV7 A;  2YNT A;  4RL0 A;  4GYU A;  4AD9 A;  5EVD A;  3I0V A;  2CG3 A;  4WD6 A;  5HH4 A;  4NQ2 A;  1BVT A;  2OHJ A;  5B3R A;  4FEK A;  3X2Z A;  5AIJ A;  5LCA A;  1YCG A;  3DH8 A;  4Z5Y A;  1X8H A;  4AX1 B;  4D1W A;  5KIL A;  3Q6V A;  4ZO3 A;  5EVK A;  1E5D A;  3IE0 A;  5B15 A;  2BC2 A;  1VME A;  4AWY B;  2WYM A;  4UWR B;  4YSL A;  5LMC A;  2I7V A;  4PVT A;  3X30 A;  2UYX A;  4EXS A;  4XWT A;  2ZZI A;  2NYP A;  2Y8A A;  1P9E A;  3R2U A;  5EV8 A;  5A87 A;  4BZ3 A;  3LVZ A;  1KO3 A;  4GYQ A;  2QIN A;  2YNU A;  5IQK A;  4UWP B;  4Z6X A;  1VJN A;  2BIB A;  2YNW A;  2AIO A;  4C1E A;  1BMC A;  4J5H A;  4PVO A;  3IEK A;  5HH5 A;  2FU7 A;  4C1G A;  3ADR A;  3PY6 A;  3IE1 A;  2XF4 A;  3QH8 A;  4Z7R A;  3I14 A;  4EY2 A;  2BFZ A;  2HB9 A;  4Z67 A;  3FCZ A;  4FSB A;  4C1F A;  2BFL A;  5HIP A;  3BK1 A;  2P1E A;  3PG4 A;  4RBS A;  4D1V A;  2WYL A;  5ACT A;  5A5Z A;  4TZE A;  5A0V A;  4UWS B;  1JJE A;  4NQ5 A;  1WW1 A;  4RAW A;  3RPC A;  1JJT A;  5AYA A;  4EFZ A;  3RKK A;  4ZO2 A;  5ACV A;  5LS3 A;  5HH6 A;  2VW8 A;  3IEM A;  1QH5 A;  5LCF A;  3ESH A;  2FHX B;  2GMN A;  4D02 A;  1X8I A;  2BG7 A;  2R2D A;  3SBL A;  3ZWF A;  5ACS A;  3KNR A;  4HKY A;  4Z5Z A;  1WUO A;  2BG6 A;  4U4L A;  1KO2 A;  2BG8 A;  2Q42 A;  5AHR A;  4AWZ A;  2WYM C;  5EW0 A;  5EH9 A;  2QED A;  2BFZ B;  2FU8 A;  1L9Y A;  3KL7 A;  5AXO A;  5B1U A;  2CG2 A;  3G1P A;  3BV6 A;  4UA4 A;  3L6N A;  4RM5 A;  2QDS A;  1A8T A;  5K4N A;  1MQO A;  4D1T A;  5FQA A;  4UBQ A;  5ACU A;  4C1C A;  2WHG A;  3DHC A;  1YCF A;  4C1H A;  1Y44 A;  2P18 A;  4C1D A;  2ZWR A;  4EYB A;  2FM6 A;  5A23 A;  2FU9 A;  3IE2 A;  4XUK A;  3FAI A;  4CHL A;  4FR7 A;  4EYF A;  4RL2 A;  4ZEJ A;  5LE1 A;  3F9O A;  2BMI A;  3I15 A;  2BGA A;  4NUR A;  5ACR A;  4BP0 A;  3A4Y A;  3X2Y A;  2BG8 B;  2Q0J A;  3DHA A;  3IEL A;  3ZR9 A;  5LSC A;  2OHI A;  5AEB A;  4H0D A;  5HIQ A;  3AF5 A;  5EWA A;  5DPX A;  1HLK A;  3JXP A;  4AXH A;  2Y8B A;  2NZE A;  5ACX A;  3MD7 A;  3T3N A;  5EHT A;  3I13 A;  3BK2 A;  4AX0 B;  5HIO A;  2FHX A;  2AZ4 A;  2M5D A;  1DXK A;  1YCH A;  5AXR A;  2CBN A;  4ZNB A;  2OHH A;  2QDT A;  1K07 A;  1BC2 A;  4LE6 A;  3VQZ A;  3I11 A;  2Y87 A;  2A7M A;  2GFJ A;  2Q9U A;  4J5F A;  4KEQ A;  2GKL A;  3SW3 A;  2CFU A;  5K4K A;  2YCB A;  2NZF A;  1A7T A;  3ZNB A;  1ZKP A;  1DD6 A;  4O98 A;  4YSK A;  1X8G A;  3WXC A;  4TZB A;  2YNV B;  5LM6 A;  3IDZ A;  2ZNB A;  4RAM A;  5K0W A;  5K4M A;  2WRS A;  3BC2 A;  2ZO4 A;  1ZTC A;  4UAM A;  3DHB A;  2BR6 A;  3VPE A;  3SPU A;  4V0H A;  1WUP A;  3SRX A;  2I7X A;  1DDK A; 
#chains in the Genus database with same CATH homology
 4Z60 A;  5ACP A;  2BTN A;  1WRA A;  3SFP A;  1JT1 A;  2XR1 A;  2QJS A;  4KEP A;  4XWW A;  3H3E A;  4DIL A;  1QH3 A;  2BG2 A;  5FQC A;  2H6A A;  2Q0I A;  2GCU A;  4F6Z A;  4HL1 A;  5LLD A;  2DOO A;  5EVB A;  2FK6 A;  2YNV A;  2I7T A;  3IOF A;  4YSB A;  5ACW A;  4UWO B;  3P2U A;  5ACQ A;  5AHO A;  4TYT A;  5HIS A;  4C09 A;  4EYL A;  5EV6 A;  5A0T A;  1KR3 A;  3TP9 A;  2YNT B;  2M5C A;  3RKJ A;  3PY5 A;  2DKF A;  3KNS A;  1ZNB A;  4P62 A;  2NXA A;  1XTO A;  3IOG A;  4TZ9 A;  3AJ3 A;  4B87 A;  3T3O A;  2P4Z A;  2FU6 A;  4DIK A;  3ZQ4 A;  2BFK A;  3S0Z A;  2E7Y A;  3AF6 A;  4JO0 A;  2GFK A;  4F6H A;  4NQ4 A;  5LCH A;  4TZF A;  3X2X A;  4HL2 A;  4EXY A;  5FQB A;  1VGN A;  3SD9 A;  4GCW A;  4TYF A;  1SML A;  4D1U A;  2YZ3 A;  5KIK A;  4NQ6 A;  3T9M A;  1M2X A;  1XM8 A;  2P97 A;  2YNT A;  4RL0 A;  4GYU A;  4AD9 A;  5EVD A;  3I0V A;  4WD6 A;  5HH4 A;  4NQ2 A;  1BVT A;  2OHJ A;  5B3R A;  4FEK A;  3X2Z A;  5LCA A;  1YCG A;  3DH8 A;  4Z5Y A;  1X8H A;  4AX1 B;  4D1W A;  5KIL A;  3Q6V A;  4ZO3 A;  5EVK A;  1E5D A;  3IE0 A;  5B15 A;  2BC2 A;  1VME A;  4AWY B;  2WYM A;  4UWR B;  4YSL A;  5LMC A;  2I7V A;  4PVT A;  3X30 A;  2UYX A;  4EXS A;  4XWT A;  2ZZI A;  2NYP A;  2Y8A A;  1P9E A;  3R2U A;  5EV8 A;  5A87 A;  4BZ3 A;  3LVZ A;  1KO3 A;  4GYQ A;  2QIN A;  2YNU A;  5IQK A;  4UWP B;  4Z6X A;  1VJN A;  2BIB A;  2YNW A;  2AIO A;  4C1E A;  1BMC A;  4J5H A;  4PVO A;  3IEK A;  5HH5 A;  2FU7 A;  4C1G A;  3ADR A;  3PY6 A;  3IE1 A;  2XF4 A;  3QH8 A;  4Z7R A;  3I14 A;  4EY2 A;  2BFZ A;  2HB9 A;  4Z67 A;  3FCZ A;  4FSB A;  4C1F A;  2BFL A;  5HIP A;  3BK1 A;  2P1E A;  3PG4 A;  4RBS A;  4D1V A;  2WYL A;  5ACT A;  5A5Z A;  4TZE A;  5A0V A;  4UWS B;  1JJE A;  4NQ5 A;  1WW1 A;  4RAW A;  3RPC A;  1JJT A;  5AYA A;  4EFZ A;  3RKK A;  4ZO2 A;  5ACV A;  5LS3 A;  5HH6 A;  2VW8 A;  3IEM A;  1QH5 A;  5LCF A;  3ESH A;  2FHX B;  2GMN A;  4D02 A;  1X8I A;  2BG7 A;  2R2D A;  3SBL A;  3ZWF A;  5ACS A;  3KNR A;  4HKY A;  4Z5Z A;  1WUO A;  2BG6 A;  4U4L A;  1KO2 A;  2BG8 A;  2Q42 A;  5AHR A;  4AWZ A;  2WYM C;  5EW0 A;  5EH9 A;  2QED A;  2BFZ B;  2FU8 A;  1L9Y A;  3KL7 A;  5AXO A;  5B1U A;  3G1P A;  3BV6 A;  4UA4 A;  3L6N A;  4RM5 A;  2QDS A;  1A8T A;  5K4N A;  1MQO A;  4D1T A;  5FQA A;  4UBQ A;  5ACU A;  4C1C A;  2WHG A;  3DHC A;  1YCF A;  4C1H A;  1Y44 A;  2P18 A;  4C1D A;  2ZWR A;  4EYB A;  2FM6 A;  2FU9 A;  3IE2 A;  4XUK A;  3FAI A;  4CHL A;  4FR7 A;  4EYF A;  4RL2 A;  4ZEJ A;  5LE1 A;  3F9O A;  2BMI A;  3I15 A;  2BGA A;  5ACR A;  4BP0 A;  3A4Y A;  3X2Y A;  2BG8 B;  2Q0J A;  3DHA A;  3IEL A;  3ZR9 A;  5LSC A;  2OHI A;  5AEB A;  4H0D A;  5HIQ A;  3AF5 A;  5EWA A;  5DPX A;  1HLK A;  3JXP A;  2Y8B A;  2NZE A;  5ACX A;  3MD7 A;  3T3N A;  5EHT A;  3I13 A;  3BK2 A;  4AX0 B;  5HIO A;  2FHX A;  2AZ4 A;  2M5D A;  1DXK A;  1YCH A;  5AXR A;  2CBN A;  4ZNB A;  2OHH A;  2QDT A;  1K07 A;  1BC2 A;  4LE6 A;  3VQZ A;  3I11 A;  2Y87 A;  2A7M A;  2GFJ A;  2Q9U A;  4J5F A;  4KEQ A;  2GKL A;  3SW3 A;  5K4K A;  2YCB A;  2NZF A;  1A7T A;  3ZNB A;  1ZKP A;  1DD6 A;  4O98 A;  4YSK A;  1X8G A;  3WXC A;  4TZB A;  2YNV B;  5LM6 A;  3IDZ A;  2ZNB A;  4RAM A;  5K0W A;  5K4M A;  2WRS A;  3BC2 A;  2ZO4 A;  1ZTC A;  4UAM A;  3DHB A;  2BR6 A;  3VPE A;  3SPU A;  4V0H A;  1WUP A;  3SRX A;  2I7X A;  1DDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...