4KEPA

Crystal structure of 4-pyridoxolactonase, wild-type
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
b'SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-pyridoxolactonase
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
molecule tags Hydrolase
total genus 93
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4kepA00
5EV6A 5EVDA 2GMNA 3SPUA 4Z67A 4NQ5A 4EYBA 4JO0A 5A0TA 4ZNBA 4Z6XA 5LSCA 5LMCA 3IOFA 3IE1A 2DKFA 4ZO2A 4C1FA 4RM5A 2Y8AA 2I7XA 3IEKA 2R2DA 1BMCA 4YSLA 5DPXA 4FSBA 2P4ZA 2ZNBA 3SBLA 3IOGA 1WUPA 5A87A 5K4KA 2BR6A 1KR3A 1A8TA 4AWZA 2I7VA 3IEMA 1WRAA 3H3EA 4UAMA 2BFZA 3X2ZA 1JJTA 4WD6A 3BK1A 5KILA 2BIBA 5AHOA 5ACRA 2BG7A 2WYLA 5KIKA 4C1DA 1P9EA 4EY2A 2FM6A 1K07A 1JT1A 3RKKA 4ZEJA 3I15A 3SD9A 1BC2A 4RBSA 3AF5A 4NQ6A 3X2XA 3R2UA 2OHJA 5EV8A 2BMIA 3MD7A 2XR1A 3I13A 4UA4A 4EYLA 5LCHA 4Z5YA 4F6HA 2I7TA 5LS3A 2ZZIA 2FHXA 4EFZA 2GCUA 3LVZA 1DD6A 3ZWFA 4D1VA 1DXKA 2NXAA 1A7TA 5LE1A 2YNVA 2QJSA 2BG8A 4TZEA 4XUKA 2M5DA 3DH8A 2BG2A 4LE6A 4U4LA 2Q0IA 3IDZA 5AXOA 2E7YA 5ACVA 5B15A 3SFPA 4DILA 1KO3A 2YNVB 4HL2A 1QH5A 3SRXA 3PY5A 2QEDA 5ACXA 5HH6A 2FU7A 5K4NA 1ZTCA 2Q42A 4V0HA 3X2YA 3T3OA 1WW1A 3P2UA 1ZKPA 2Q9UA 3ESHA 4AWYB 4YSKA 2YZ3A 4AD9A 3QH8A 5B3RA 2DOOA 5A0VA 4KEQA 4FEKA 2NYPA 2FU6A 2AZ4A 5HIOA 2FU9A 4PVOA 4TYFA 3AF6A 1X8HA 4GYUA 2OHIA 3IELA 2P97A 4AX1B 5EVBA 2YNTA 4YSBA 1VGNA 4J5FA 2OHHA 3RKJA 1X8GA 1XTOA 4GYQA 2BFZB 3KNRA 4DIKA 3FCZA 3KL7A 3BK2A 1SMLA 5ACSA 3VPEA 4J5HA 5LM6A 4GCWA 4C1GA 1VMEA 3IE2A 1DDKA 1VJNA 2WYMC 4C1EA 1Y44A 1L9YA 5LCFA 2AIOA 1QH3A 4EYFA 2BG6A 5B1UA 2Y87A 2YNWA 1X8IA 5K4MA 5A5ZA 4FR7A 2YNUA 5LCAA 4D02A 4UWSB 2FHXB 3F9OA 5FQAA 3SW3A 1YCGA 1ZNBA 5EHTA 2XF4A 4TYTA 3VQZA 2NZEA 3L6NA 4B87A 3AJ3A 2BFKA 1MQOA 3BV6A 2ZWRA 5ACPA 2BFLA 2BG8B 1E5DA 2P18A 4F6ZA 3I14A 3DHBA 1JJEA 4O98A 4RAMA 4CHLA 4PVTA 2A7MA 4TZBA 4BP0A 4C09A 1XM8A 3S0ZA 4H0DA 5AYAA 2WRSA 2YCBA 3KNSA 3TP9A 4BZ3A 1M2XA 4P62A 2UYXA 4UWRB 4RL2A 3RPCA 2HB9A 5HH5A 4EXYA 3PG4A 4Z60A 2Y8BA 1BVTA 5ACTA 4ZO3A 5EVKA 3DHAA 4AX0B 2WHGA 4TZFA 3I11A 3T9MA 4UWPB 2FK6A 3T3NA 5AEBA 4C1CA 2GFJA 1KO2A 2Q0JA 4UWOB 2ZO4A 4NQ4A 3A4YA 4KEPA 3JXPA 2FU8A 2YNTB 4NQ2A 5K0WA 2QINA 3WXCA 2QDTA 3FAIA 3ZR9A 5ACQA 5FQBA 5HH4A 5HISA 2QDSA 3ZNBA 4D1UA 3PY6A 2P1EA 2GKLA 1HLKA 2GFKA 4RL0A 5EWAA 5IQKA 2WYMA 5HIPA 3I0VA 3IE0A 2CBNA 4C1HA 5ACUA 4RAWA 5FQCA 5ACWA 3BC2A 2BC2A 4D1TA 4UBQA 1YCFA 5AXRA 4TZ9A 3ZQ4A 5AHRA 4D1WA 4HL1A 1YCHA 3DHCA 5EH9A 2VW8A 2BTNA 3X30A 4HKYA 5HIQA 4Z7RA 5LLDA 4EXSA 2BGAA 4Z5ZA 3G1PA 2M5CA 1WUOA 2H6AA 4XWTA 2NZFA 4XWWA 3ADRA 3Q6VA 5EW0A
chains in the Genus database with same CATH superfamily
5EV6A 5EVDA 2GMNA 3SPUA 4Z67A 4NQ5A 4EYBA 4JO0A 2CFUA 5A0TA 4ZNBA 2CG2A 4Z6XA 5LSCA 5LMCA 3IOFA 3IE1A 2DKFA 4ZO2A 4C1FA 4RM5A 2Y8AA 2I7XA 3IEKA 2R2DA 1BMCA 4YSLA 5DPXA 4FSBA 2P4ZA 2ZNBA 3SBLA 3IOGA 1WUPA 5A87A 5K4KA 2BR6A 1KR3A 1A8TA 4AWZA 2I7VA 3IEMA 1WRAA 3H3EA 4UAMA 2BFZA 3X2ZA 1JJTA 4WD6A 3BK1A 5KILA 2BIBA 5AHOA 5ACRA 2BG7A 2WYLA 5KIKA 4C1DA 1P9EA 4EY2A 2FM6A 1K07A 1JT1A 3RKKA 4ZEJA 3I15A 3SD9A 1BC2A 4RBSA 3AF5A 4NQ6A 3X2XA 3R2UA 2OHJA 5EV8A 2BMIA 3MD7A 2XR1A 3I13A 4UA4A 4EYLA 5LCHA 4Z5YA 4F6HA 2I7TA 5LS3A 2ZZIA 2FHXA 4EFZA 2GCUA 3LVZA 1DD6A 3ZWFA 4D1VA 1DXKA 2NXAA 1A7TA 5LE1A 2YNVA 2QJSA 2BG8A 4TZEA 4XUKA 2M5DA 3DH8A 2BG2A 4LE6A 5AIJA 4U4LA 2Q0IA 3IDZA 5AXOA 2E7YA 5ACVA 5B15A 3SFPA 4DILA 1KO3A 2YNVB 4HL2A 1QH5A 3SRXA 3PY5A 2QEDA 5ACXA 5HH6A 2FU7A 5K4NA 1ZTCA 2Q42A 4V0HA 3X2YA 3T3OA 1WW1A 3P2UA 1ZKPA 2Q9UA 3ESHA 4AWYB 4YSKA 2YZ3A 4AD9A 3QH8A 5B3RA 2DOOA 5A0VA 4KEQA 4FEKA 2NYPA 2FU6A 2AZ4A 5HIOA 2FU9A 4PDXA 5A23A 4PVOA 4TYFA 3AF6A 1X8HA 4GYUA 2OHIA 3IELA 2P97A 4AX1B 5EVBA 2YNTA 4YSBA 1VGNA 4J5FA 2OHHA 3RKJA 1X8GA 1XTOA 4GYQA 2BFZB 3KNRA 4DIKA 3FCZA 3KL7A 3BK2A 1SMLA 5ACSA 3VPEA 2YHEA 4J5HA 5LM6A 4GCWA 4C1GA 1VMEA 2CFZA 3IE2A 1DDKA 1VJNA 2WYMC 4C1EA 1Y44A 1L9YA 5LCFA 2AIOA 1QH3A 4EYFA 2BG6A 5B1UA 2Y87A 2YNWA 1X8IA 5K4MA 5A5ZA 4FR7A 2YNUA 5LCAA 4D02A 4UWSB 2FHXB 3F9OA 5FQAA 3SW3A 1YCGA 1ZNBA 4AV7A 5EHTA 2XF4A 4TYTA 3VQZA 2NZEA 3L6NA 4B87A 3AJ3A 2BFKA 1MQOA 3BV6A 2ZWRA 5ACPA 2BFLA 2BG8B 1E5DA 2P18A 4F6ZA 3I14A 3DHBA 1JJEA 4O98A 4RAMA 4CHLA 4PVTA 2A7MA 4TZBA 4BP0A 4C09A 1XM8A 3S0ZA 4H0DA 5AYAA 2WRSA 2YCBA 3KNSA 3TP9A 4BZ3A 1M2XA 4P62A 2UYXA 4UWRB 4RL2A 3RPCA 2HB9A 5HH5A 4EXYA 3PG4A 4Z60A 2Y8BA 1BVTA 5ACTA 4ZO3A 5EVKA 3DHAA 4AX0B 2WHGA 4TZFA 3I11A 3T9MA 4UWPB 2FK6A 3T3NA 5AEBA 4C1CA 2GFJA 1KO2A 2Q0JA 4UWOB 2ZO4A 4NQ4A 5AJLA 3A4YA 4KEPA 3JXPA 2FU8A 2YNTB 4NQ2A 5K0WA 2QINA 3WXCA 2QDTA 3FAIA 3ZR9A 5ACQA 5FQBA 5HH4A 5HISA 2QDSA 3ZNBA 4D1UA 3PY6A 2P1EA 2GKLA 1HLKA 2GFKA 4RL0A 2CG3A 5EWAA 5IQKA 2WYMA 4NURA 5HIPA 3I0VA 3IE0A 2CBNA 4C1HA 5ACUA 4RAWA 5FQCA 5ACWA 3BC2A 2BC2A 4D1TA 4UBQA 1YCFA 4AXHA 5AXRA 4TZ9A 3ZQ4A 5AHRA 4D1WA 4HL1A 1YCHA 3DHCA 5EH9A 2VW8A 2BTNA 3X30A 4HKYA 5HIQA 4Z7RA 5LLDA 4EXSA 2BGAA 4Z5ZA 3G1PA 2M5CA 1WUOA 2H6AA 4XWTA 2NZFA 4XWWA 3ADRA 3Q6VA 5EW0A
chains in the Genus database with same CATH topology
5EV6A 5EVDA 2GMNA 3SPUA 4Z67A 4NQ5A 4EYBA 4JO0A 5A0TA 4ZNBA 4Z6XA 5LSCA 5LMCA 3IOFA 3IE1A 2DKFA 4ZO2A 4C1FA 4RM5A 2Y8AA 2I7XA 3IEKA 2R2DA 1BMCA 4YSLA 5DPXA 4FSBA 2P4ZA 2ZNBA 3SBLA 3IOGA 1WUPA 5A87A 5K4KA 2BR6A 1KR3A 1A8TA 4AWZA 2I7VA 3IEMA 1WRAA 3H3EA 4UAMA 2BFZA 3X2ZA 1JJTA 4WD6A 3BK1A 5KILA 2BIBA 5AHOA 5ACRA 2BG7A 2WYLA 5KIKA 4C1DA 1P9EA 4EY2A 2FM6A 1K07A 1JT1A 3RKKA 4ZEJA 3I15A 3SD9A 1BC2A 4RBSA 3AF5A 4NQ6A 3X2XA 3R2UA 2OHJA 5EV8A 2BMIA 3MD7A 2XR1A 3I13A 4UA4A 4EYLA 5LCHA 4Z5YA 4F6HA 2I7TA 5LS3A 2ZZIA 2FHXA 4EFZA 2GCUA 3LVZA 1DD6A 3ZWFA 4D1VA 1DXKA 2NXAA 1A7TA 5LE1A 2YNVA 2QJSA 2BG8A 4TZEA 4XUKA 2M5DA 3DH8A 2BG2A 4LE6A 4U4LA 2Q0IA 3IDZA 5AXOA 2E7YA 5ACVA 5B15A 3SFPA 4DILA 1KO3A 2YNVB 4HL2A 1QH5A 3SRXA 3PY5A 2QEDA 5ACXA 5HH6A 2FU7A 5K4NA 1ZTCA 2Q42A 4V0HA 3X2YA 3T3OA 1WW1A 3P2UA 1ZKPA 2Q9UA 3ESHA 4AWYB 4YSKA 2YZ3A 4AD9A 3QH8A 5B3RA 2DOOA 5A0VA 4KEQA 4FEKA 2NYPA 2FU6A 2AZ4A 5HIOA 2FU9A 4PVOA 4TYFA 3AF6A 1X8HA 4GYUA 2OHIA 3IELA 2P97A 4AX1B 5EVBA 2YNTA 4YSBA 1VGNA 4J5FA 2OHHA 3RKJA 1X8GA 1XTOA 4GYQA 2BFZB 3KNRA 4DIKA 3FCZA 3KL7A 3BK2A 1SMLA 5ACSA 3VPEA 4J5HA 5LM6A 4GCWA 4C1GA 1VMEA 3IE2A 1DDKA 1VJNA 2WYMC 4C1EA 1Y44A 1L9YA 5LCFA 2AIOA 1QH3A 4EYFA 2BG6A 5B1UA 2Y87A 2YNWA 1X8IA 5K4MA 5A5ZA 4FR7A 2YNUA 5LCAA 4D02A 4UWSB 2FHXB 3F9OA 5FQAA 3SW3A 1YCGA 1ZNBA 5EHTA 2XF4A 4TYTA 3VQZA 2NZEA 3L6NA 4B87A 3AJ3A 2BFKA 1MQOA 3BV6A 2ZWRA 5ACPA 2BFLA 2BG8B 1E5DA 2P18A 4F6ZA 3I14A 3DHBA 1JJEA 4O98A 4RAMA 4CHLA 4PVTA 2A7MA 4TZBA 4BP0A 4C09A 1XM8A 3S0ZA 4H0DA 5AYAA 2WRSA 2YCBA 3KNSA 3TP9A 4BZ3A 1M2XA 4P62A 2UYXA 4UWRB 4RL2A 3RPCA 2HB9A 5HH5A 4EXYA 3PG4A 4Z60A 2Y8BA 1BVTA 5ACTA 4ZO3A 5EVKA 3DHAA 4AX0B 2WHGA 4TZFA 3I11A 3T9MA 4UWPB 2FK6A 3T3NA 5AEBA 4C1CA 2GFJA 1KO2A 2Q0JA 4UWOB 2ZO4A 4NQ4A 3A4YA 4KEPA 3JXPA 2FU8A 2YNTB 4NQ2A 5K0WA 2QINA 3WXCA 2QDTA 3FAIA 3ZR9A 5ACQA 5FQBA 5HH4A 5HISA 2QDSA 3ZNBA 4D1UA 3PY6A 2P1EA 2GKLA 1HLKA 2GFKA 4RL0A 5EWAA 5IQKA 2WYMA 5HIPA 3I0VA 3IE0A 2CBNA 4C1HA 5ACUA 4RAWA 5FQCA 5ACWA 3BC2A 2BC2A 4D1TA 4UBQA 1YCFA 5AXRA 4TZ9A 3ZQ4A 5AHRA 4D1WA 4HL1A 1YCHA 3DHCA 5EH9A 2VW8A 2BTNA 3X30A 4HKYA 5HIQA 4Z7RA 5LLDA 4EXSA 2BGAA 4Z5ZA 3G1PA 2M5CA 1WUOA 2H6AA 4XWTA 2NZFA 4XWWA 3ADRA 3Q6VA 5EW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EV6 A;  5EVD A;  2GMN A;  3SPU A;  4Z67 A;  4NQ5 A;  4EYB A;  4JO0 A;  5A0T A;  4ZNB A;  4Z6X A;  5LSC A;  5LMC A;  3IOF A;  3IE1 A;  2DKF A;  4ZO2 A;  4C1F A;  4RM5 A;  2Y8A A;  2I7X A;  3IEK A;  2R2D A;  1BMC A;  4YSL A;  5DPX A;  4FSB A;  2P4Z A;  2ZNB A;  3SBL A;  3IOG A;  1WUP A;  5A87 A;  5K4K A;  2BR6 A;  1KR3 A;  1A8T A;  4AWZ A;  2I7V A;  3IEM A;  1WRA A;  3H3E A;  4UAM A;  2BFZ A;  3X2Z A;  1JJT A;  4WD6 A;  3BK1 A;  5KIL A;  2BIB A;  5AHO A;  5ACR A;  2BG7 A;  2WYL A;  5KIK A;  4C1D A;  1P9E A;  4EY2 A;  2FM6 A;  1K07 A;  1JT1 A;  3RKK A;  4ZEJ A;  3I15 A;  3SD9 A;  1BC2 A;  4RBS A;  3AF5 A;  4NQ6 A;  3X2X A;  3R2U A;  2OHJ A;  5EV8 A;  2BMI A;  3MD7 A;  2XR1 A;  3I13 A;  4UA4 A;  4EYL A;  5LCH A;  4Z5Y A;  4F6H A;  2I7T A;  5LS3 A;  2ZZI A;  2FHX A;  4EFZ A;  2GCU A;  3LVZ A;  1DD6 A;  3ZWF A;  4D1V A;  1DXK A;  2NXA A;  1A7T A;  5LE1 A;  2YNV A;  2QJS A;  2BG8 A;  4TZE A;  4XUK A;  2M5D A;  3DH8 A;  2BG2 A;  4LE6 A;  4U4L A;  2Q0I A;  3IDZ A;  5AXO A;  2E7Y A;  5ACV A;  5B15 A;  3SFP A;  4DIL A;  1KO3 A;  2YNV B;  4HL2 A;  1QH5 A;  3SRX A;  3PY5 A;  2QED A;  5ACX A;  5HH6 A;  2FU7 A;  5K4N A;  1ZTC A;  2Q42 A;  4V0H A;  3X2Y A;  3T3O A;  1WW1 A;  3P2U A;  1ZKP A;  2Q9U A;  3ESH A;  4AWY B;  4YSK A;  2YZ3 A;  4AD9 A;  3QH8 A;  5B3R A;  2DOO A;  5A0V A;  4KEQ A;  4FEK A;  2NYP A;  2FU6 A;  2AZ4 A;  5HIO A;  2FU9 A;  4PVO A;  4TYF A;  3AF6 A;  1X8H A;  4GYU A;  2OHI A;  3IEL A;  2P97 A;  4AX1 B;  5EVB A;  2YNT A;  4YSB A;  1VGN A;  4J5F A;  2OHH A;  3RKJ A;  1X8G A;  1XTO A;  4GYQ A;  2BFZ B;  3KNR A;  4DIK A;  3FCZ A;  3KL7 A;  3BK2 A;  1SML A;  5ACS A;  3VPE A;  4J5H A;  5LM6 A;  4GCW A;  4C1G A;  1VME A;  3IE2 A;  1DDK A;  1VJN A;  2WYM C;  4C1E A;  1Y44 A;  1L9Y A;  5LCF A;  2AIO A;  1QH3 A;  4EYF A;  2BG6 A;  5B1U A;  2Y87 A;  2YNW A;  1X8I A;  5K4M A;  5A5Z A;  4FR7 A;  2YNU A;  5LCA A;  4D02 A;  4UWS B;  2FHX B;  3F9O A;  5FQA A;  3SW3 A;  1YCG A;  1ZNB A;  5EHT A;  2XF4 A;  4TYT A;  3VQZ A;  2NZE A;  3L6N A;  4B87 A;  3AJ3 A;  2BFK A;  1MQO A;  3BV6 A;  2ZWR A;  5ACP A;  2BFL A;  2BG8 B;  1E5D A;  2P18 A;  4F6Z A;  3I14 A;  3DHB A;  1JJE A;  4O98 A;  4RAM A;  4CHL A;  4PVT A;  2A7M A;  4TZB A;  4BP0 A;  4C09 A;  1XM8 A;  3S0Z A;  4H0D A;  5AYA A;  2WRS A;  2YCB A;  3KNS A;  3TP9 A;  4BZ3 A;  1M2X A;  4P62 A;  2UYX A;  4UWR B;  4RL2 A;  3RPC A;  2HB9 A;  5HH5 A;  4EXY A;  3PG4 A;  4Z60 A;  2Y8B A;  1BVT A;  5ACT A;  4ZO3 A;  5EVK A;  3DHA A;  4AX0 B;  2WHG A;  4TZF A;  3I11 A;  3T9M A;  4UWP B;  2FK6 A;  3T3N A;  5AEB A;  4C1C A;  2GFJ A;  1KO2 A;  2Q0J A;  4UWO B;  2ZO4 A;  4NQ4 A;  3A4Y A;  4KEP A;  3JXP A;  2FU8 A;  2YNT B;  4NQ2 A;  5K0W A;  2QIN A;  3WXC A;  2QDT A;  3FAI A;  3ZR9 A;  5ACQ A;  5FQB A;  5HH4 A;  5HIS A;  2QDS A;  3ZNB A;  4D1U A;  3PY6 A;  2P1E A;  2GKL A;  1HLK A;  2GFK A;  4RL0 A;  5EWA A;  5IQK A;  2WYM A;  5HIP A;  3I0V A;  3IE0 A;  2CBN A;  4C1H A;  5ACU A;  4RAW A;  5FQC A;  5ACW A;  3BC2 A;  2BC2 A;  4D1T A;  4UBQ A;  1YCF A;  5AXR A;  4TZ9 A;  3ZQ4 A;  5AHR A;  4D1W A;  4HL1 A;  1YCH A;  3DHC A;  5EH9 A;  2VW8 A;  2BTN A;  3X30 A;  4HKY A;  5HIQ A;  4Z7R A;  5LLD A;  4EXS A;  2BGA A;  4Z5Z A;  3G1P A;  2M5C A;  1WUO A;  2H6A A;  4XWT A;  2NZF A;  4XWW A;  3ADR A;  3Q6V A;  5EW0 A; 
#chains in the Genus database with same CATH topology
 5EV6 A;  5EVD A;  2GMN A;  3SPU A;  4Z67 A;  4NQ5 A;  4EYB A;  4JO0 A;  2CFU A;  5A0T A;  4ZNB A;  2CG2 A;  4Z6X A;  5LSC A;  5LMC A;  3IOF A;  3IE1 A;  2DKF A;  4ZO2 A;  4C1F A;  4RM5 A;  2Y8A A;  2I7X A;  3IEK A;  2R2D A;  1BMC A;  4YSL A;  5DPX A;  4FSB A;  2P4Z A;  2ZNB A;  3SBL A;  3IOG A;  1WUP A;  5A87 A;  5K4K A;  2BR6 A;  1KR3 A;  1A8T A;  4AWZ A;  2I7V A;  3IEM A;  1WRA A;  3H3E A;  4UAM A;  2BFZ A;  3X2Z A;  1JJT A;  4WD6 A;  3BK1 A;  5KIL A;  2BIB A;  5AHO A;  5ACR A;  2BG7 A;  2WYL A;  5KIK A;  4C1D A;  1P9E A;  4EY2 A;  2FM6 A;  1K07 A;  1JT1 A;  3RKK A;  4ZEJ A;  3I15 A;  3SD9 A;  1BC2 A;  4RBS A;  3AF5 A;  4NQ6 A;  3X2X A;  3R2U A;  2OHJ A;  5EV8 A;  2BMI A;  3MD7 A;  2XR1 A;  3I13 A;  4UA4 A;  4EYL A;  5LCH A;  4Z5Y A;  4F6H A;  2I7T A;  5LS3 A;  2ZZI A;  2FHX A;  4EFZ A;  2GCU A;  3LVZ A;  1DD6 A;  3ZWF A;  4D1V A;  1DXK A;  2NXA A;  1A7T A;  5LE1 A;  2YNV A;  2QJS A;  2BG8 A;  4TZE A;  4XUK A;  2M5D A;  3DH8 A;  2BG2 A;  4LE6 A;  5AIJ A;  4U4L A;  2Q0I A;  3IDZ A;  5AXO A;  2E7Y A;  5ACV A;  5B15 A;  3SFP A;  4DIL A;  1KO3 A;  2YNV B;  4HL2 A;  1QH5 A;  3SRX A;  3PY5 A;  2QED A;  5ACX A;  5HH6 A;  2FU7 A;  5K4N A;  1ZTC A;  2Q42 A;  4V0H A;  3X2Y A;  3T3O A;  1WW1 A;  3P2U A;  1ZKP A;  2Q9U A;  3ESH A;  4AWY B;  4YSK A;  2YZ3 A;  4AD9 A;  3QH8 A;  5B3R A;  2DOO A;  5A0V A;  4KEQ A;  4FEK A;  2NYP A;  2FU6 A;  2AZ4 A;  5HIO A;  2FU9 A;  4PDX A;  5A23 A;  4PVO A;  4TYF A;  3AF6 A;  1X8H A;  4GYU A;  2OHI A;  3IEL A;  2P97 A;  4AX1 B;  5EVB A;  2YNT A;  4YSB A;  1VGN A;  4J5F A;  2OHH A;  3RKJ A;  1X8G A;  1XTO A;  4GYQ A;  2BFZ B;  3KNR A;  4DIK A;  3FCZ A;  3KL7 A;  3BK2 A;  1SML A;  5ACS A;  3VPE A;  2YHE A;  4J5H A;  5LM6 A;  4GCW A;  4C1G A;  1VME A;  2CFZ A;  3IE2 A;  1DDK A;  1VJN A;  2WYM C;  4C1E A;  1Y44 A;  1L9Y A;  5LCF A;  2AIO A;  1QH3 A;  4EYF A;  2BG6 A;  5B1U A;  2Y87 A;  2YNW A;  1X8I A;  5K4M A;  5A5Z A;  4FR7 A;  2YNU A;  5LCA A;  4D02 A;  4UWS B;  2FHX B;  3F9O A;  5FQA A;  3SW3 A;  1YCG A;  1ZNB A;  4AV7 A;  5EHT A;  2XF4 A;  4TYT A;  3VQZ A;  2NZE A;  3L6N A;  4B87 A;  3AJ3 A;  2BFK A;  1MQO A;  3BV6 A;  2ZWR A;  5ACP A;  2BFL A;  2BG8 B;  1E5D A;  2P18 A;  4F6Z A;  3I14 A;  3DHB A;  1JJE A;  4O98 A;  4RAM A;  4CHL A;  4PVT A;  2A7M A;  4TZB A;  4BP0 A;  4C09 A;  1XM8 A;  3S0Z A;  4H0D A;  5AYA A;  2WRS A;  2YCB A;  3KNS A;  3TP9 A;  4BZ3 A;  1M2X A;  4P62 A;  2UYX A;  4UWR B;  4RL2 A;  3RPC A;  2HB9 A;  5HH5 A;  4EXY A;  3PG4 A;  4Z60 A;  2Y8B A;  1BVT A;  5ACT A;  4ZO3 A;  5EVK A;  3DHA A;  4AX0 B;  2WHG A;  4TZF A;  3I11 A;  3T9M A;  4UWP B;  2FK6 A;  3T3N A;  5AEB A;  4C1C A;  2GFJ A;  1KO2 A;  2Q0J A;  4UWO B;  2ZO4 A;  4NQ4 A;  5AJL A;  3A4Y A;  4KEP A;  3JXP A;  2FU8 A;  2YNT B;  4NQ2 A;  5K0W A;  2QIN A;  3WXC A;  2QDT A;  3FAI A;  3ZR9 A;  5ACQ A;  5FQB A;  5HH4 A;  5HIS A;  2QDS A;  3ZNB A;  4D1U A;  3PY6 A;  2P1E A;  2GKL A;  1HLK A;  2GFK A;  4RL0 A;  2CG3 A;  5EWA A;  5IQK A;  2WYM A;  4NUR A;  5HIP A;  3I0V A;  3IE0 A;  2CBN A;  4C1H A;  5ACU A;  4RAW A;  5FQC A;  5ACW A;  3BC2 A;  2BC2 A;  4D1T A;  4UBQ A;  1YCF A;  4AXH A;  5AXR A;  4TZ9 A;  3ZQ4 A;  5AHR A;  4D1W A;  4HL1 A;  1YCH A;  3DHC A;  5EH9 A;  2VW8 A;  2BTN A;  3X30 A;  4HKY A;  5HIQ A;  4Z7R A;  5LLD A;  4EXS A;  2BGA A;  4Z5Z A;  3G1P A;  2M5C A;  1WUO A;  2H6A A;  4XWT A;  2NZF A;  4XWW A;  3ADR A;  3Q6V A;  5EW0 A; 
#chains in the Genus database with same CATH homology
 5EV6 A;  5EVD A;  2GMN A;  3SPU A;  4Z67 A;  4NQ5 A;  4EYB A;  4JO0 A;  5A0T A;  4ZNB A;  4Z6X A;  5LSC A;  5LMC A;  3IOF A;  3IE1 A;  2DKF A;  4ZO2 A;  4C1F A;  4RM5 A;  2Y8A A;  2I7X A;  3IEK A;  2R2D A;  1BMC A;  4YSL A;  5DPX A;  4FSB A;  2P4Z A;  2ZNB A;  3SBL A;  3IOG A;  1WUP A;  5A87 A;  5K4K A;  2BR6 A;  1KR3 A;  1A8T A;  4AWZ A;  2I7V A;  3IEM A;  1WRA A;  3H3E A;  4UAM A;  2BFZ A;  3X2Z A;  1JJT A;  4WD6 A;  3BK1 A;  5KIL A;  2BIB A;  5AHO A;  5ACR A;  2BG7 A;  2WYL A;  5KIK A;  4C1D A;  1P9E A;  4EY2 A;  2FM6 A;  1K07 A;  1JT1 A;  3RKK A;  4ZEJ A;  3I15 A;  3SD9 A;  1BC2 A;  4RBS A;  3AF5 A;  4NQ6 A;  3X2X A;  3R2U A;  2OHJ A;  5EV8 A;  2BMI A;  3MD7 A;  2XR1 A;  3I13 A;  4UA4 A;  4EYL A;  5LCH A;  4Z5Y A;  4F6H A;  2I7T A;  5LS3 A;  2ZZI A;  2FHX A;  4EFZ A;  2GCU A;  3LVZ A;  1DD6 A;  3ZWF A;  4D1V A;  1DXK A;  2NXA A;  1A7T A;  5LE1 A;  2YNV A;  2QJS A;  2BG8 A;  4TZE A;  4XUK A;  2M5D A;  3DH8 A;  2BG2 A;  4LE6 A;  4U4L A;  2Q0I A;  3IDZ A;  5AXO A;  2E7Y A;  5ACV A;  5B15 A;  3SFP A;  4DIL A;  1KO3 A;  2YNV B;  4HL2 A;  1QH5 A;  3SRX A;  3PY5 A;  2QED A;  5ACX A;  5HH6 A;  2FU7 A;  5K4N A;  1ZTC A;  2Q42 A;  4V0H A;  3X2Y A;  3T3O A;  1WW1 A;  3P2U A;  1ZKP A;  2Q9U A;  3ESH A;  4AWY B;  4YSK A;  2YZ3 A;  4AD9 A;  3QH8 A;  5B3R A;  2DOO A;  5A0V A;  4KEQ A;  4FEK A;  2NYP A;  2FU6 A;  2AZ4 A;  5HIO A;  2FU9 A;  4PVO A;  4TYF A;  3AF6 A;  1X8H A;  4GYU A;  2OHI A;  3IEL A;  2P97 A;  4AX1 B;  5EVB A;  2YNT A;  4YSB A;  1VGN A;  4J5F A;  2OHH A;  3RKJ A;  1X8G A;  1XTO A;  4GYQ A;  2BFZ B;  3KNR A;  4DIK A;  3FCZ A;  3KL7 A;  3BK2 A;  1SML A;  5ACS A;  3VPE A;  4J5H A;  5LM6 A;  4GCW A;  4C1G A;  1VME A;  3IE2 A;  1DDK A;  1VJN A;  2WYM C;  4C1E A;  1Y44 A;  1L9Y A;  5LCF A;  2AIO A;  1QH3 A;  4EYF A;  2BG6 A;  5B1U A;  2Y87 A;  2YNW A;  1X8I A;  5K4M A;  5A5Z A;  4FR7 A;  2YNU A;  5LCA A;  4D02 A;  4UWS B;  2FHX B;  3F9O A;  5FQA A;  3SW3 A;  1YCG A;  1ZNB A;  5EHT A;  2XF4 A;  4TYT A;  3VQZ A;  2NZE A;  3L6N A;  4B87 A;  3AJ3 A;  2BFK A;  1MQO A;  3BV6 A;  2ZWR A;  5ACP A;  2BFL A;  2BG8 B;  1E5D A;  2P18 A;  4F6Z A;  3I14 A;  3DHB A;  1JJE A;  4O98 A;  4RAM A;  4CHL A;  4PVT A;  2A7M A;  4TZB A;  4BP0 A;  4C09 A;  1XM8 A;  3S0Z A;  4H0D A;  5AYA A;  2WRS A;  2YCB A;  3KNS A;  3TP9 A;  4BZ3 A;  1M2X A;  4P62 A;  2UYX A;  4UWR B;  4RL2 A;  3RPC A;  2HB9 A;  5HH5 A;  4EXY A;  3PG4 A;  4Z60 A;  2Y8B A;  1BVT A;  5ACT A;  4ZO3 A;  5EVK A;  3DHA A;  4AX0 B;  2WHG A;  4TZF A;  3I11 A;  3T9M A;  4UWP B;  2FK6 A;  3T3N A;  5AEB A;  4C1C A;  2GFJ A;  1KO2 A;  2Q0J A;  4UWO B;  2ZO4 A;  4NQ4 A;  3A4Y A;  4KEP A;  3JXP A;  2FU8 A;  2YNT B;  4NQ2 A;  5K0W A;  2QIN A;  3WXC A;  2QDT A;  3FAI A;  3ZR9 A;  5ACQ A;  5FQB A;  5HH4 A;  5HIS A;  2QDS A;  3ZNB A;  4D1U A;  3PY6 A;  2P1E A;  2GKL A;  1HLK A;  2GFK A;  4RL0 A;  5EWA A;  5IQK A;  2WYM A;  5HIP A;  3I0V A;  3IE0 A;  2CBN A;  4C1H A;  5ACU A;  4RAW A;  5FQC A;  5ACW A;  3BC2 A;  2BC2 A;  4D1T A;  4UBQ A;  1YCF A;  5AXR A;  4TZ9 A;  3ZQ4 A;  5AHR A;  4D1W A;  4HL1 A;  1YCH A;  3DHC A;  5EH9 A;  2VW8 A;  2BTN A;  3X30 A;  4HKY A;  5HIQ A;  4Z7R A;  5LLD A;  4EXS A;  2BGA A;  4Z5Z A;  3G1P A;  2M5C A;  1WUO A;  2H6A A;  4XWT A;  2NZF A;  4XWW A;  3ADR A;  3Q6V A;  5EW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...