4KEPA

Crystal structure of 4-pyridoxolactonase, wild-type
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
molecule tags Hydrolase
molecule keywords 4-pyridoxolactonase
total genus 93
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4kepA00
3SW3A 2NZFA 4V0HA 3LVZA 3A4YA 1YCFA 2YZ3A 3KNSA 3IEMA 3IOFA 3AJ3A 5EHTA 5HIPA 2BG7A 4C1DA 4PVOA 5B15A 4D1UA 5HIQA 2H6AA 3ADRA 1HLKA 4NQ6A 5K4NA 3ESHA 1XM8A 5HH6A 4FR7A 4LE6A 3PY6A 2FU6A 4D02A 2AIOA 4H0DA 2UYXA 2P97A 4RAMA 4D1TA 5ACXA 1K07A 2YNUA 1XTOA 3AF5A 5FQAA 2FHXA 4XWTA 5HH4A 2BFZB 4BP0A 4YSKA 4AWYB 1E5DA 4RAWA 3PY5A 3SPUA 4ZO3A 3SD9A 3G1PA 4EFZA 4RBSA 4C1GA 2BR6A 4Z5ZA 5LE1A 2QDTA 4NQ4A 4EYFA 5HIOA 3IE0A 4P62A 1Y44A 3DHCA 3QH8A 1KO3A 4D1VA 5A0TA 3SFPA 4UWRB 2M5DA 1QH3A 5EVDA 4TZ9A 5LMCA 1ZNBA 3ZWFA 5HISA 3BK1A 2FU8A 1JT1A 2GFKA 2ZNBA 3JXPA 5ACRA 2Y87A 1M2XA 4B87A 1DXKA 2QINA 3ZQ4A 2NYPA 4TYFA 5ACSA 3X2XA 5IQKA 5LS3A 4PVTA 5FQBA 3SRXA 2GCUA 2XF4A 4J5FA 4C1EA 4WD6A 2Q0JA 3WXCA 4BZ3A 3PG4A 4UAMA 3T3OA 2OHHA 2DKFA 3H3EA 4J5HA 3X30A 4UWOB 3S0ZA 4UWPB 5A87A 5A0VA 2GFJA 2FHXB 5EH9A 4GYQA 4HL2A 5LLDA 1YCHA 3BK2A 3ZNBA 5LSCA 2NXAA 2BFZA 3DHBA 5AEBA 3MD7A 5ACTA 2I7TA 4YSLA 3VQZA 2BG6A 2WYMA 4O98A 1A8TA 2FK6A 5B1UA 2YNVB 2WYLA 3I0VA 4C1CA 1BC2A 4UWSB 4ZEJA 1X8HA 2OHJA 2HB9A 4Z6XA 5KIKA 4DIKA 1WRAA 4C09A 4C1HA 2FU7A 4DILA 5EV6A 2BFLA 1JJTA 2BTNA 1A7TA 2Y8AA 2WRSA 4Z7RA 3RKJA 5HH5A 4EXYA 4TZEA 2ZWRA 4YSBA 4KEQA 4XUKA 3IE2A 3DHAA 5K4MA 2BMIA 2OHIA 2NZEA 4NQ5A 2P1EA 2BG8B 3F9OA 2R2DA 5AYAA 2QEDA 1WW1A 3IE1A 1BVTA 5KILA 3FAIA 4XWWA 2WYMC 2I7VA 2BGAA 1P9EA 3L6NA 2GMNA 2YNTB 4RL2A 4RM5A 5AHOA 5EWAA 4AX0B 4F6HA 2Q0IA 5EW0A 1WUOA 2P4ZA 3ZR9A 4KEPA 1JJEA 2YNVA 3BC2A 1DDKA 5ACQA 2WHGA 4CHLA 4HKYA 1L9YA 3RKKA 4TZFA 4HL1A 5B3RA 1ZKPA 1MQOA 3IELA 2QJSA 4TZBA 2A7MA 4FEKA 3X2ZA 4D1WA 4AWZA 2BC2A 1KR3A 1X8GA 3VPEA 3SBLA 2YCBA 4Z67A 5A5ZA 1BMCA 1SMLA 4ZO2A 4EXSA 3BV6A 3IOGA 1WUPA 3T9MA 4EY2A 1VMEA 2ZZIA 5LCHA 5ACVA 2FU9A 3RPCA 1VJNA 4U4LA 5K0WA 2BG8A 2M5CA 3Q6VA 2GKLA 3X2YA 2P18A 2FM6A 4Z5YA 4UA4A 4RL0A 4GCWA 3AF6A 3TP9A 1YCGA 1KO2A 5LM6A 4TYTA 2BFKA 4F6ZA 2BG2A 2YNTA 5EVKA 3T3NA 2I7XA 1X8IA 3I15A 5K4KA 4EYBA 3I14A 3R2UA 2VW8A 5ACWA 1VGNA 2Q42A 4Z60A 2Y8BA 4GYUA 5LCAA 2BIBA 4NQ2A 3DH8A 3I13A 3IEKA 1ZTCA 2AZ4A 4UBQA 5ACUA 4FSBA 3FCZA 3IDZA 2E7YA 2ZO4A 2Q9UA 5AHRA 1QH5A 5DPXA 4C1FA 4EYLA 4ZNBA 5EVBA 3KL7A 1DD6A 2CBNA 5AXRA 2YNWA 2QDSA 2DOOA 3I11A 2XR1A 4JO0A 3KNRA 5ACPA 5FQCA 5AXOA 5LCFA 4AX1B 5EV8A 3P2UA 4AD9A
chains in the Genus database with same CATH superfamily
3SW3A 2NZFA 4V0HA 3LVZA 3A4YA 1YCFA 2YZ3A 3KNSA 3IEMA 3IOFA 3AJ3A 5EHTA 5HIPA 2BG7A 4C1DA 4PVOA 5B15A 4D1UA 5HIQA 2H6AA 3ADRA 1HLKA 4AXHA 4NQ6A 5K4NA 3ESHA 1XM8A 5HH6A 4FR7A 4LE6A 3PY6A 2FU6A 4D02A 2AIOA 4H0DA 2UYXA 2P97A 4RAMA 4D1TA 5ACXA 1K07A 2YNUA 1XTOA 3AF5A 5FQAA 2FHXA 4XWTA 5HH4A 2BFZB 4BP0A 4YSKA 4AWYB 1E5DA 4RAWA 3PY5A 3SPUA 4ZO3A 3SD9A 3G1PA 4EFZA 4RBSA 5AJLA 4C1GA 2BR6A 2CFUA 4Z5ZA 5LE1A 2QDTA 4NQ4A 4EYFA 5HIOA 3IE0A 4P62A 1Y44A 3DHCA 3QH8A 1KO3A 4D1VA 5A0TA 3SFPA 4UWRB 2M5DA 1QH3A 5EVDA 4TZ9A 5LMCA 1ZNBA 3ZWFA 5HISA 3BK1A 2FU8A 1JT1A 2GFKA 2ZNBA 3JXPA 5ACRA 2Y87A 1M2XA 4B87A 1DXKA 2QINA 3ZQ4A 2NYPA 4TYFA 5ACSA 3X2XA 2CG2A 5IQKA 5LS3A 4PVTA 5FQBA 3SRXA 2GCUA 2XF4A 4J5FA 4C1EA 4WD6A 2Q0JA 3WXCA 4BZ3A 3PG4A 4UAMA 3T3OA 2OHHA 2DKFA 3H3EA 4J5HA 3X30A 4UWOB 3S0ZA 4UWPB 5A87A 5A0VA 2GFJA 2FHXB 5EH9A 4GYQA 4HL2A 5LLDA 1YCHA 3BK2A 3ZNBA 5LSCA 2NXAA 2BFZA 3DHBA 5AEBA 2CFZA 3MD7A 5ACTA 2I7TA 4YSLA 3VQZA 2BG6A 2WYMA 4O98A 1A8TA 2FK6A 5B1UA 2YNVB 2WYLA 3I0VA 4C1CA 1BC2A 4UWSB 4ZEJA 1X8HA 2OHJA 2HB9A 4Z6XA 5KIKA 4DIKA 1WRAA 4C09A 4C1HA 2FU7A 4DILA 5EV6A 2BFLA 1JJTA 2BTNA 1A7TA 2Y8AA 2WRSA 4Z7RA 3RKJA 5HH5A 4EXYA 4TZEA 2ZWRA 4YSBA 4KEQA 4XUKA 3IE2A 3DHAA 5K4MA 2BMIA 2OHIA 2NZEA 4NQ5A 2P1EA 2BG8B 3F9OA 2R2DA 5AYAA 2QEDA 1WW1A 3IE1A 1BVTA 5KILA 3FAIA 4XWWA 2WYMC 2I7VA 2BGAA 1P9EA 3L6NA 2GMNA 2YNTB 4RL2A 4RM5A 5AHOA 5EWAA 4AX0B 4F6HA 2CG3A 2Q0IA 5EW0A 1WUOA 2P4ZA 3ZR9A 4KEPA 1JJEA 2YNVA 3BC2A 1DDKA 5ACQA 2WHGA 4CHLA 4HKYA 1L9YA 3RKKA 4TZFA 4HL1A 5B3RA 1ZKPA 1MQOA 3IELA 2QJSA 4TZBA 2A7MA 4FEKA 3X2ZA 4D1WA 5A23A 4AWZA 2BC2A 1KR3A 5AIJA 1X8GA 4NURA 3VPEA 3SBLA 2YCBA 4Z67A 5A5ZA 1BMCA 1SMLA 4ZO2A 4EXSA 3BV6A 3IOGA 1WUPA 3T9MA 4EY2A 1VMEA 2ZZIA 5LCHA 5ACVA 2FU9A 3RPCA 1VJNA 4U4LA 5K0WA 2BG8A 2M5CA 3Q6VA 2GKLA 3X2YA 2P18A 2FM6A 4Z5YA 4UA4A 4RL0A 4GCWA 3AF6A 3TP9A 1YCGA 1KO2A 5LM6A 4TYTA 2BFKA 4F6ZA 2BG2A 2YNTA 5EVKA 3T3NA 2I7XA 1X8IA 3I15A 5K4KA 4EYBA 3I14A 3R2UA 2VW8A 2YHEA 5ACWA 1VGNA 2Q42A 4Z60A 2Y8BA 4GYUA 5LCAA 2BIBA 4NQ2A 3DH8A 3I13A 3IEKA 1ZTCA 2AZ4A 4UBQA 5ACUA 4FSBA 3FCZA 3IDZA 2E7YA 2ZO4A 2Q9UA 5AHRA 1QH5A 5DPXA 4C1FA 4EYLA 4ZNBA 5EVBA 3KL7A 1DD6A 2CBNA 5AXRA 4PDXA 2YNWA 2QDSA 2DOOA 3I11A 2XR1A 4AV7A 4JO0A 3KNRA 5ACPA 5FQCA 5AXOA 5LCFA 4AX1B 5EV8A 3P2UA 4AD9A
chains in the Genus database with same CATH topology
3SW3A 2NZFA 4V0HA 3LVZA 3A4YA 1YCFA 2YZ3A 3KNSA 3IEMA 3IOFA 3AJ3A 5EHTA 5HIPA 2BG7A 4C1DA 4PVOA 5B15A 4D1UA 5HIQA 2H6AA 3ADRA 1HLKA 4NQ6A 5K4NA 3ESHA 1XM8A 5HH6A 4FR7A 4LE6A 3PY6A 2FU6A 4D02A 2AIOA 4H0DA 2UYXA 2P97A 4RAMA 4D1TA 5ACXA 1K07A 2YNUA 1XTOA 3AF5A 5FQAA 2FHXA 4XWTA 5HH4A 2BFZB 4BP0A 4YSKA 4AWYB 1E5DA 4RAWA 3PY5A 3SPUA 4ZO3A 3SD9A 3G1PA 4EFZA 4RBSA 4C1GA 2BR6A 4Z5ZA 5LE1A 2QDTA 4NQ4A 4EYFA 5HIOA 3IE0A 4P62A 1Y44A 3DHCA 3QH8A 1KO3A 4D1VA 5A0TA 3SFPA 4UWRB 2M5DA 1QH3A 5EVDA 4TZ9A 5LMCA 1ZNBA 3ZWFA 5HISA 3BK1A 2FU8A 1JT1A 2GFKA 2ZNBA 3JXPA 5ACRA 2Y87A 1M2XA 4B87A 1DXKA 2QINA 3ZQ4A 2NYPA 4TYFA 5ACSA 3X2XA 5IQKA 5LS3A 4PVTA 5FQBA 3SRXA 2GCUA 2XF4A 4J5FA 4C1EA 4WD6A 2Q0JA 3WXCA 4BZ3A 3PG4A 4UAMA 3T3OA 2OHHA 2DKFA 3H3EA 4J5HA 3X30A 4UWOB 3S0ZA 4UWPB 5A87A 5A0VA 2GFJA 2FHXB 5EH9A 4GYQA 4HL2A 5LLDA 1YCHA 3BK2A 3ZNBA 5LSCA 2NXAA 2BFZA 3DHBA 5AEBA 3MD7A 5ACTA 2I7TA 4YSLA 3VQZA 2BG6A 2WYMA 4O98A 1A8TA 2FK6A 5B1UA 2YNVB 2WYLA 3I0VA 4C1CA 1BC2A 4UWSB 4ZEJA 1X8HA 2OHJA 2HB9A 4Z6XA 5KIKA 4DIKA 1WRAA 4C09A 4C1HA 2FU7A 4DILA 5EV6A 2BFLA 1JJTA 2BTNA 1A7TA 2Y8AA 2WRSA 4Z7RA 3RKJA 5HH5A 4EXYA 4TZEA 2ZWRA 4YSBA 4KEQA 4XUKA 3IE2A 3DHAA 5K4MA 2BMIA 2OHIA 2NZEA 4NQ5A 2P1EA 2BG8B 3F9OA 2R2DA 5AYAA 2QEDA 1WW1A 3IE1A 1BVTA 5KILA 3FAIA 4XWWA 2WYMC 2I7VA 2BGAA 1P9EA 3L6NA 2GMNA 2YNTB 4RL2A 4RM5A 5AHOA 5EWAA 4AX0B 4F6HA 2Q0IA 5EW0A 1WUOA 2P4ZA 3ZR9A 4KEPA 1JJEA 2YNVA 3BC2A 1DDKA 5ACQA 2WHGA 4CHLA 4HKYA 1L9YA 3RKKA 4TZFA 4HL1A 5B3RA 1ZKPA 1MQOA 3IELA 2QJSA 4TZBA 2A7MA 4FEKA 3X2ZA 4D1WA 4AWZA 2BC2A 1KR3A 1X8GA 3VPEA 3SBLA 2YCBA 4Z67A 5A5ZA 1BMCA 1SMLA 4ZO2A 4EXSA 3BV6A 3IOGA 1WUPA 3T9MA 4EY2A 1VMEA 2ZZIA 5LCHA 5ACVA 2FU9A 3RPCA 1VJNA 4U4LA 5K0WA 2BG8A 2M5CA 3Q6VA 2GKLA 3X2YA 2P18A 2FM6A 4Z5YA 4UA4A 4RL0A 4GCWA 3AF6A 3TP9A 1YCGA 1KO2A 5LM6A 4TYTA 2BFKA 4F6ZA 2BG2A 2YNTA 5EVKA 3T3NA 2I7XA 1X8IA 3I15A 5K4KA 4EYBA 3I14A 3R2UA 2VW8A 5ACWA 1VGNA 2Q42A 4Z60A 2Y8BA 4GYUA 5LCAA 2BIBA 4NQ2A 3DH8A 3I13A 3IEKA 1ZTCA 2AZ4A 4UBQA 5ACUA 4FSBA 3FCZA 3IDZA 2E7YA 2ZO4A 2Q9UA 5AHRA 1QH5A 5DPXA 4C1FA 4EYLA 4ZNBA 5EVBA 3KL7A 1DD6A 2CBNA 5AXRA 2YNWA 2QDSA 2DOOA 3I11A 2XR1A 4JO0A 3KNRA 5ACPA 5FQCA 5AXOA 5LCFA 4AX1B 5EV8A 3P2UA 4AD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SW3 A;  2NZF A;  4V0H A;  3LVZ A;  3A4Y A;  1YCF A;  2YZ3 A;  3KNS A;  3IEM A;  3IOF A;  3AJ3 A;  5EHT A;  5HIP A;  2BG7 A;  4C1D A;  4PVO A;  5B15 A;  4D1U A;  5HIQ A;  2H6A A;  3ADR A;  1HLK A;  4NQ6 A;  5K4N A;  3ESH A;  1XM8 A;  5HH6 A;  4FR7 A;  4LE6 A;  3PY6 A;  2FU6 A;  4D02 A;  2AIO A;  4H0D A;  2UYX A;  2P97 A;  4RAM A;  4D1T A;  5ACX A;  1K07 A;  2YNU A;  1XTO A;  3AF5 A;  5FQA A;  2FHX A;  4XWT A;  5HH4 A;  2BFZ B;  4BP0 A;  4YSK A;  4AWY B;  1E5D A;  4RAW A;  3PY5 A;  3SPU A;  4ZO3 A;  3SD9 A;  3G1P A;  4EFZ A;  4RBS A;  4C1G A;  2BR6 A;  4Z5Z A;  5LE1 A;  2QDT A;  4NQ4 A;  4EYF A;  5HIO A;  3IE0 A;  4P62 A;  1Y44 A;  3DHC A;  3QH8 A;  1KO3 A;  4D1V A;  5A0T A;  3SFP A;  4UWR B;  2M5D A;  1QH3 A;  5EVD A;  4TZ9 A;  5LMC A;  1ZNB A;  3ZWF A;  5HIS A;  3BK1 A;  2FU8 A;  1JT1 A;  2GFK A;  2ZNB A;  3JXP A;  5ACR A;  2Y87 A;  1M2X A;  4B87 A;  1DXK A;  2QIN A;  3ZQ4 A;  2NYP A;  4TYF A;  5ACS A;  3X2X A;  5IQK A;  5LS3 A;  4PVT A;  5FQB A;  3SRX A;  2GCU A;  2XF4 A;  4J5F A;  4C1E A;  4WD6 A;  2Q0J A;  3WXC A;  4BZ3 A;  3PG4 A;  4UAM A;  3T3O A;  2OHH A;  2DKF A;  3H3E A;  4J5H A;  3X30 A;  4UWO B;  3S0Z A;  4UWP B;  5A87 A;  5A0V A;  2GFJ A;  2FHX B;  5EH9 A;  4GYQ A;  4HL2 A;  5LLD A;  1YCH A;  3BK2 A;  3ZNB A;  5LSC A;  2NXA A;  2BFZ A;  3DHB A;  5AEB A;  3MD7 A;  5ACT A;  2I7T A;  4YSL A;  3VQZ A;  2BG6 A;  2WYM A;  4O98 A;  1A8T A;  2FK6 A;  5B1U A;  2YNV B;  2WYL A;  3I0V A;  4C1C A;  1BC2 A;  4UWS B;  4ZEJ A;  1X8H A;  2OHJ A;  2HB9 A;  4Z6X A;  5KIK A;  4DIK A;  1WRA A;  4C09 A;  4C1H A;  2FU7 A;  4DIL A;  5EV6 A;  2BFL A;  1JJT A;  2BTN A;  1A7T A;  2Y8A A;  2WRS A;  4Z7R A;  3RKJ A;  5HH5 A;  4EXY A;  4TZE A;  2ZWR A;  4YSB A;  4KEQ A;  4XUK A;  3IE2 A;  3DHA A;  5K4M A;  2BMI A;  2OHI A;  2NZE A;  4NQ5 A;  2P1E A;  2BG8 B;  3F9O A;  2R2D A;  5AYA A;  2QED A;  1WW1 A;  3IE1 A;  1BVT A;  5KIL A;  3FAI A;  4XWW A;  2WYM C;  2I7V A;  2BGA A;  1P9E A;  3L6N A;  2GMN A;  2YNT B;  4RL2 A;  4RM5 A;  5AHO A;  5EWA A;  4AX0 B;  4F6H A;  2Q0I A;  5EW0 A;  1WUO A;  2P4Z A;  3ZR9 A;  4KEP A;  1JJE A;  2YNV A;  3BC2 A;  1DDK A;  5ACQ A;  2WHG A;  4CHL A;  4HKY A;  1L9Y A;  3RKK A;  4TZF A;  4HL1 A;  5B3R A;  1ZKP A;  1MQO A;  3IEL A;  2QJS A;  4TZB A;  2A7M A;  4FEK A;  3X2Z A;  4D1W A;  4AWZ A;  2BC2 A;  1KR3 A;  1X8G A;  3VPE A;  3SBL A;  2YCB A;  4Z67 A;  5A5Z A;  1BMC A;  1SML A;  4ZO2 A;  4EXS A;  3BV6 A;  3IOG A;  1WUP A;  3T9M A;  4EY2 A;  1VME A;  2ZZI A;  5LCH A;  5ACV A;  2FU9 A;  3RPC A;  1VJN A;  4U4L A;  5K0W A;  2BG8 A;  2M5C A;  3Q6V A;  2GKL A;  3X2Y A;  2P18 A;  2FM6 A;  4Z5Y A;  4UA4 A;  4RL0 A;  4GCW A;  3AF6 A;  3TP9 A;  1YCG A;  1KO2 A;  5LM6 A;  4TYT A;  2BFK A;  4F6Z A;  2BG2 A;  2YNT A;  5EVK A;  3T3N A;  2I7X A;  1X8I A;  3I15 A;  5K4K A;  4EYB A;  3I14 A;  3R2U A;  2VW8 A;  5ACW A;  1VGN A;  2Q42 A;  4Z60 A;  2Y8B A;  4GYU A;  5LCA A;  2BIB A;  4NQ2 A;  3DH8 A;  3I13 A;  3IEK A;  1ZTC A;  2AZ4 A;  4UBQ A;  5ACU A;  4FSB A;  3FCZ A;  3IDZ A;  2E7Y A;  2ZO4 A;  2Q9U A;  5AHR A;  1QH5 A;  5DPX A;  4C1F A;  4EYL A;  4ZNB A;  5EVB A;  3KL7 A;  1DD6 A;  2CBN A;  5AXR A;  2YNW A;  2QDS A;  2DOO A;  3I11 A;  2XR1 A;  4JO0 A;  3KNR A;  5ACP A;  5FQC A;  5AXO A;  5LCF A;  4AX1 B;  5EV8 A;  3P2U A;  4AD9 A; 
#chains in the Genus database with same CATH topology
 3SW3 A;  2NZF A;  4V0H A;  3LVZ A;  3A4Y A;  1YCF A;  2YZ3 A;  3KNS A;  3IEM A;  3IOF A;  3AJ3 A;  5EHT A;  5HIP A;  2BG7 A;  4C1D A;  4PVO A;  5B15 A;  4D1U A;  5HIQ A;  2H6A A;  3ADR A;  1HLK A;  4AXH A;  4NQ6 A;  5K4N A;  3ESH A;  1XM8 A;  5HH6 A;  4FR7 A;  4LE6 A;  3PY6 A;  2FU6 A;  4D02 A;  2AIO A;  4H0D A;  2UYX A;  2P97 A;  4RAM A;  4D1T A;  5ACX A;  1K07 A;  2YNU A;  1XTO A;  3AF5 A;  5FQA A;  2FHX A;  4XWT A;  5HH4 A;  2BFZ B;  4BP0 A;  4YSK A;  4AWY B;  1E5D A;  4RAW A;  3PY5 A;  3SPU A;  4ZO3 A;  3SD9 A;  3G1P A;  4EFZ A;  4RBS A;  5AJL A;  4C1G A;  2BR6 A;  2CFU A;  4Z5Z A;  5LE1 A;  2QDT A;  4NQ4 A;  4EYF A;  5HIO A;  3IE0 A;  4P62 A;  1Y44 A;  3DHC A;  3QH8 A;  1KO3 A;  4D1V A;  5A0T A;  3SFP A;  4UWR B;  2M5D A;  1QH3 A;  5EVD A;  4TZ9 A;  5LMC A;  1ZNB A;  3ZWF A;  5HIS A;  3BK1 A;  2FU8 A;  1JT1 A;  2GFK A;  2ZNB A;  3JXP A;  5ACR A;  2Y87 A;  1M2X A;  4B87 A;  1DXK A;  2QIN A;  3ZQ4 A;  2NYP A;  4TYF A;  5ACS A;  3X2X A;  2CG2 A;  5IQK A;  5LS3 A;  4PVT A;  5FQB A;  3SRX A;  2GCU A;  2XF4 A;  4J5F A;  4C1E A;  4WD6 A;  2Q0J A;  3WXC A;  4BZ3 A;  3PG4 A;  4UAM A;  3T3O A;  2OHH A;  2DKF A;  3H3E A;  4J5H A;  3X30 A;  4UWO B;  3S0Z A;  4UWP B;  5A87 A;  5A0V A;  2GFJ A;  2FHX B;  5EH9 A;  4GYQ A;  4HL2 A;  5LLD A;  1YCH A;  3BK2 A;  3ZNB A;  5LSC A;  2NXA A;  2BFZ A;  3DHB A;  5AEB A;  2CFZ A;  3MD7 A;  5ACT A;  2I7T A;  4YSL A;  3VQZ A;  2BG6 A;  2WYM A;  4O98 A;  1A8T A;  2FK6 A;  5B1U A;  2YNV B;  2WYL A;  3I0V A;  4C1C A;  1BC2 A;  4UWS B;  4ZEJ A;  1X8H A;  2OHJ A;  2HB9 A;  4Z6X A;  5KIK A;  4DIK A;  1WRA A;  4C09 A;  4C1H A;  2FU7 A;  4DIL A;  5EV6 A;  2BFL A;  1JJT A;  2BTN A;  1A7T A;  2Y8A A;  2WRS A;  4Z7R A;  3RKJ A;  5HH5 A;  4EXY A;  4TZE A;  2ZWR A;  4YSB A;  4KEQ A;  4XUK A;  3IE2 A;  3DHA A;  5K4M A;  2BMI A;  2OHI A;  2NZE A;  4NQ5 A;  2P1E A;  2BG8 B;  3F9O A;  2R2D A;  5AYA A;  2QED A;  1WW1 A;  3IE1 A;  1BVT A;  5KIL A;  3FAI A;  4XWW A;  2WYM C;  2I7V A;  2BGA A;  1P9E A;  3L6N A;  2GMN A;  2YNT B;  4RL2 A;  4RM5 A;  5AHO A;  5EWA A;  4AX0 B;  4F6H A;  2CG3 A;  2Q0I A;  5EW0 A;  1WUO A;  2P4Z A;  3ZR9 A;  4KEP A;  1JJE A;  2YNV A;  3BC2 A;  1DDK A;  5ACQ A;  2WHG A;  4CHL A;  4HKY A;  1L9Y A;  3RKK A;  4TZF A;  4HL1 A;  5B3R A;  1ZKP A;  1MQO A;  3IEL A;  2QJS A;  4TZB A;  2A7M A;  4FEK A;  3X2Z A;  4D1W A;  5A23 A;  4AWZ A;  2BC2 A;  1KR3 A;  5AIJ A;  1X8G A;  4NUR A;  3VPE A;  3SBL A;  2YCB A;  4Z67 A;  5A5Z A;  1BMC A;  1SML A;  4ZO2 A;  4EXS A;  3BV6 A;  3IOG A;  1WUP A;  3T9M A;  4EY2 A;  1VME A;  2ZZI A;  5LCH A;  5ACV A;  2FU9 A;  3RPC A;  1VJN A;  4U4L A;  5K0W A;  2BG8 A;  2M5C A;  3Q6V A;  2GKL A;  3X2Y A;  2P18 A;  2FM6 A;  4Z5Y A;  4UA4 A;  4RL0 A;  4GCW A;  3AF6 A;  3TP9 A;  1YCG A;  1KO2 A;  5LM6 A;  4TYT A;  2BFK A;  4F6Z A;  2BG2 A;  2YNT A;  5EVK A;  3T3N A;  2I7X A;  1X8I A;  3I15 A;  5K4K A;  4EYB A;  3I14 A;  3R2U A;  2VW8 A;  2YHE A;  5ACW A;  1VGN A;  2Q42 A;  4Z60 A;  2Y8B A;  4GYU A;  5LCA A;  2BIB A;  4NQ2 A;  3DH8 A;  3I13 A;  3IEK A;  1ZTC A;  2AZ4 A;  4UBQ A;  5ACU A;  4FSB A;  3FCZ A;  3IDZ A;  2E7Y A;  2ZO4 A;  2Q9U A;  5AHR A;  1QH5 A;  5DPX A;  4C1F A;  4EYL A;  4ZNB A;  5EVB A;  3KL7 A;  1DD6 A;  2CBN A;  5AXR A;  4PDX A;  2YNW A;  2QDS A;  2DOO A;  3I11 A;  2XR1 A;  4AV7 A;  4JO0 A;  3KNR A;  5ACP A;  5FQC A;  5AXO A;  5LCF A;  4AX1 B;  5EV8 A;  3P2U A;  4AD9 A; 
#chains in the Genus database with same CATH homology
 3SW3 A;  2NZF A;  4V0H A;  3LVZ A;  3A4Y A;  1YCF A;  2YZ3 A;  3KNS A;  3IEM A;  3IOF A;  3AJ3 A;  5EHT A;  5HIP A;  2BG7 A;  4C1D A;  4PVO A;  5B15 A;  4D1U A;  5HIQ A;  2H6A A;  3ADR A;  1HLK A;  4NQ6 A;  5K4N A;  3ESH A;  1XM8 A;  5HH6 A;  4FR7 A;  4LE6 A;  3PY6 A;  2FU6 A;  4D02 A;  2AIO A;  4H0D A;  2UYX A;  2P97 A;  4RAM A;  4D1T A;  5ACX A;  1K07 A;  2YNU A;  1XTO A;  3AF5 A;  5FQA A;  2FHX A;  4XWT A;  5HH4 A;  2BFZ B;  4BP0 A;  4YSK A;  4AWY B;  1E5D A;  4RAW A;  3PY5 A;  3SPU A;  4ZO3 A;  3SD9 A;  3G1P A;  4EFZ A;  4RBS A;  4C1G A;  2BR6 A;  4Z5Z A;  5LE1 A;  2QDT A;  4NQ4 A;  4EYF A;  5HIO A;  3IE0 A;  4P62 A;  1Y44 A;  3DHC A;  3QH8 A;  1KO3 A;  4D1V A;  5A0T A;  3SFP A;  4UWR B;  2M5D A;  1QH3 A;  5EVD A;  4TZ9 A;  5LMC A;  1ZNB A;  3ZWF A;  5HIS A;  3BK1 A;  2FU8 A;  1JT1 A;  2GFK A;  2ZNB A;  3JXP A;  5ACR A;  2Y87 A;  1M2X A;  4B87 A;  1DXK A;  2QIN A;  3ZQ4 A;  2NYP A;  4TYF A;  5ACS A;  3X2X A;  5IQK A;  5LS3 A;  4PVT A;  5FQB A;  3SRX A;  2GCU A;  2XF4 A;  4J5F A;  4C1E A;  4WD6 A;  2Q0J A;  3WXC A;  4BZ3 A;  3PG4 A;  4UAM A;  3T3O A;  2OHH A;  2DKF A;  3H3E A;  4J5H A;  3X30 A;  4UWO B;  3S0Z A;  4UWP B;  5A87 A;  5A0V A;  2GFJ A;  2FHX B;  5EH9 A;  4GYQ A;  4HL2 A;  5LLD A;  1YCH A;  3BK2 A;  3ZNB A;  5LSC A;  2NXA A;  2BFZ A;  3DHB A;  5AEB A;  3MD7 A;  5ACT A;  2I7T A;  4YSL A;  3VQZ A;  2BG6 A;  2WYM A;  4O98 A;  1A8T A;  2FK6 A;  5B1U A;  2YNV B;  2WYL A;  3I0V A;  4C1C A;  1BC2 A;  4UWS B;  4ZEJ A;  1X8H A;  2OHJ A;  2HB9 A;  4Z6X A;  5KIK A;  4DIK A;  1WRA A;  4C09 A;  4C1H A;  2FU7 A;  4DIL A;  5EV6 A;  2BFL A;  1JJT A;  2BTN A;  1A7T A;  2Y8A A;  2WRS A;  4Z7R A;  3RKJ A;  5HH5 A;  4EXY A;  4TZE A;  2ZWR A;  4YSB A;  4KEQ A;  4XUK A;  3IE2 A;  3DHA A;  5K4M A;  2BMI A;  2OHI A;  2NZE A;  4NQ5 A;  2P1E A;  2BG8 B;  3F9O A;  2R2D A;  5AYA A;  2QED A;  1WW1 A;  3IE1 A;  1BVT A;  5KIL A;  3FAI A;  4XWW A;  2WYM C;  2I7V A;  2BGA A;  1P9E A;  3L6N A;  2GMN A;  2YNT B;  4RL2 A;  4RM5 A;  5AHO A;  5EWA A;  4AX0 B;  4F6H A;  2Q0I A;  5EW0 A;  1WUO A;  2P4Z A;  3ZR9 A;  4KEP A;  1JJE A;  2YNV A;  3BC2 A;  1DDK A;  5ACQ A;  2WHG A;  4CHL A;  4HKY A;  1L9Y A;  3RKK A;  4TZF A;  4HL1 A;  5B3R A;  1ZKP A;  1MQO A;  3IEL A;  2QJS A;  4TZB A;  2A7M A;  4FEK A;  3X2Z A;  4D1W A;  4AWZ A;  2BC2 A;  1KR3 A;  1X8G A;  3VPE A;  3SBL A;  2YCB A;  4Z67 A;  5A5Z A;  1BMC A;  1SML A;  4ZO2 A;  4EXS A;  3BV6 A;  3IOG A;  1WUP A;  3T9M A;  4EY2 A;  1VME A;  2ZZI A;  5LCH A;  5ACV A;  2FU9 A;  3RPC A;  1VJN A;  4U4L A;  5K0W A;  2BG8 A;  2M5C A;  3Q6V A;  2GKL A;  3X2Y A;  2P18 A;  2FM6 A;  4Z5Y A;  4UA4 A;  4RL0 A;  4GCW A;  3AF6 A;  3TP9 A;  1YCG A;  1KO2 A;  5LM6 A;  4TYT A;  2BFK A;  4F6Z A;  2BG2 A;  2YNT A;  5EVK A;  3T3N A;  2I7X A;  1X8I A;  3I15 A;  5K4K A;  4EYB A;  3I14 A;  3R2U A;  2VW8 A;  5ACW A;  1VGN A;  2Q42 A;  4Z60 A;  2Y8B A;  4GYU A;  5LCA A;  2BIB A;  4NQ2 A;  3DH8 A;  3I13 A;  3IEK A;  1ZTC A;  2AZ4 A;  4UBQ A;  5ACU A;  4FSB A;  3FCZ A;  3IDZ A;  2E7Y A;  2ZO4 A;  2Q9U A;  5AHR A;  1QH5 A;  5DPX A;  4C1F A;  4EYL A;  4ZNB A;  5EVB A;  3KL7 A;  1DD6 A;  2CBN A;  5AXR A;  2YNW A;  2QDS A;  2DOO A;  3I11 A;  2XR1 A;  4JO0 A;  3KNR A;  5ACP A;  5FQC A;  5AXO A;  5LCF A;  4AX1 B;  5EV8 A;  3P2U A;  4AD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...