4KEPA

Crystal structure of 4-pyridoxolactonase, wild-type
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 4-pyridoxolactonase
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
total genus 93
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4kepA00
1DXKA 4EXYA 4Z5ZA 4FSBA 3RPCA 2I7XA 3ZNBA 5EVKA 5LM6A 1VGNA 4D1WA 4FR7A 2YNWA 4Z5YA 1DD6A 4TYFA 4BZ3A 4RM5A 5FQCA 4C1HA 3IELA 5AXRA 1YCFA 2FU6A 3ZWFA 3IEKA 1K07A 4ZNBA 1L9YA 5EVBA 4P62A 4YSBA 4D02A 4C1FA 2BR6A 2QINA 4UA4A 2FHXA 4RL0A 2BIBA 5EW0A 2ZNBA 1M2XA 2WYMC 5ACSA 5ACUA 4F6ZA 1YCHA 3FAIA 5LE1A 3X2ZA 2NXAA 4EYFA 3R2UA 3SRXA 5ACQA 2Q0IA 3T3NA 2BFZA 2BTNA 5ACXA 3TP9A 2Y8BA 3ESHA 1QH3A 5EV6A 5AYAA 5EH9A 5LLDA 2M5CA 4D1TA 1BMCA 2Q0JA 4RAMA 5ACVA 3G1PA 2FU8A 1P9EA 1ZTCA 1YCGA 3FCZA 4H0DA 1BC2A 4RL2A 3X2XA 1A8TA 4DIKA 2FHXB 1SMLA 4V0HA 4AX0B 2BMIA 5HIPA 4JO0A 2BGAA 4EY2A 5EWAA 4B87A 4HKYA 2BG2A 5HH4A 2AZ4A 3DHCA 2QDTA 4UWPB 1VJNA 4J5FA 3BV6A 1WUPA 2OHHA 3I15A 2Y87A 2BFZB 1KO2A 5KIKA 3SFPA 3IE0A 3DHBA 4FEKA 5ACPA 2P4ZA 1DDKA 4HL1A 4PVTA 3IEMA 5K4MA 4TZEA 3I14A 4J5HA 3JXPA 4D1UA 4ZO2A 1X8IA 2WYMA 3AJ3A 2BG8A 1QH5A 2NZEA 4GCWA 1MQOA 4EFZA 4UWOB 4WD6A 3LVZA 5LS3A 5KILA 5A87A 2BC2A 2NYPA 5A0VA 2GKLA 2BG6A 2BFKA 4EYLA 3T9MA 4XUKA 2FU9A 2FM6A 2I7TA 5B1UA 3P2UA 4C1EA 3VQZA 4Z60A 2BG7A 4Z6XA 4ZEJA 3ZR9A 4GYQA 3ZQ4A 3WXCA 3SBLA 4CHLA 2DOOA 4UAMA 3IOGA 1JJEA 5B3RA 1ZNBA 2HB9A 4TZBA 5FQBA 3H3EA 5A5ZA 3PY6A 1JT1A 2FU7A 2YCBA 2M5DA 3RKKA 2QJSA 2BG8B 5FQAA 1XTOA 4RAWA 4AD9A 3DHAA 3I13A 3BC2A 5K4KA 4AWZA 5K0WA 3KNRA 4Z67A 5AHRA 5LSCA 5LMCA 2ZO4A 3IDZA 2A7MA 2R2DA 2ZWRA 3L6NA 4YSLA 4NQ5A 4UWRB 2OHIA 4TZFA 2FK6A 4C1DA 2GMNA 2CBNA 3T3OA 1A7TA 1JJTA 3IOFA 3F9OA 4C1GA 3SPUA 2GCUA 1HLKA 3ADRA 1XM8A 5HIOA 5LCFA 4U4LA 3I11A 1ZKPA 5LCAA 5HH6A 5HIQA 1KR3A 2DKFA 3RKJA 3KL7A 2YNUA 2WHGA 2WYLA 5IQKA 2OHJA 2WRSA 3VPEA 3PY5A 5EVDA 3QH8A 4XWTA 4TYTA 4O98A 2UYXA 4YSKA 3SD9A 4EYBA 1BVTA 2YNVA 3PG4A 5ACRA 3AF6A 4DILA 4RBSA 5K4NA 3AF5A 1KO3A 3SW3A 5ACTA 2H6AA 2Q9UA 4D1VA 2I7VA 3BK2A 1WRAA 2VW8A 1WW1A 2XR1A 5DPXA 3MD7A 4KEQA 4KEPA 1VMEA 2Y8AA 5AEBA 4UBQA 2YNTA 4NQ4A 3KNSA 5EHTA 2BFLA 2YZ3A 3IE2A 2XF4A 2ZZIA 3X30A 3IE1A 2P1EA 1X8HA 2GFJA 5LCHA 2P18A 5HISA 4EXSA 2QDSA 3DH8A 2YNVB 4GYUA 5A0TA 4NQ2A 4NQ6A 5ACWA 2GFKA 4TZ9A 1X8GA 4Z7RA 4LE6A 5HH5A 4AWYB 4AX1B 1WUOA 4ZO3A 4PVOA 3Q6VA 4BP0A 2NZFA 2QEDA 2YNTB 5AXOA 4F6HA 5B15A 4XWWA 3A4YA 4C1CA 2AIOA 3I0VA 3S0ZA 2E7YA 1Y44A 2P97A 5EV8A 3BK1A 4UWSB 2Q42A 3X2YA 5AHOA 4C09A 4HL2A 1E5DA
chains in the Genus database with same CATH superfamily
1DXKA 4AV7A 4EXYA 4Z5ZA 4FSBA 3RPCA 2I7XA 2CFUA 3ZNBA 5EVKA 5LM6A 1VGNA 4D1WA 4FR7A 2YNWA 4Z5YA 1DD6A 4TYFA 4BZ3A 4RM5A 5FQCA 4C1HA 3IELA 5AXRA 1YCFA 2FU6A 3ZWFA 3IEKA 1K07A 4ZNBA 1L9YA 5EVBA 4P62A 4YSBA 4D02A 4C1FA 2BR6A 2QINA 4UA4A 2FHXA 4RL0A 5AJLA 2BIBA 5EW0A 2ZNBA 1M2XA 2WYMC 5ACSA 5ACUA 4F6ZA 1YCHA 3FAIA 5LE1A 3X2ZA 4AXHA 2NXAA 4EYFA 3R2UA 3SRXA 5ACQA 2Q0IA 3T3NA 2BFZA 2BTNA 5ACXA 3TP9A 2Y8BA 3ESHA 1QH3A 5EV6A 5AYAA 5EH9A 5LLDA 2M5CA 4D1TA 1BMCA 2Q0JA 4RAMA 5ACVA 3G1PA 2FU8A 1P9EA 1ZTCA 1YCGA 3FCZA 4H0DA 1BC2A 4RL2A 3X2XA 1A8TA 4DIKA 2YHEA 2FHXB 1SMLA 4V0HA 4AX0B 2BMIA 5HIPA 4JO0A 2BGAA 4EY2A 5EWAA 2CG2A 4B87A 4HKYA 2BG2A 5HH4A 2AZ4A 3DHCA 2QDTA 4UWPB 1VJNA 4J5FA 3BV6A 1WUPA 2OHHA 3I15A 2Y87A 2BFZB 1KO2A 5KIKA 3SFPA 3IE0A 3DHBA 4FEKA 5ACPA 2P4ZA 1DDKA 4HL1A 4PVTA 3IEMA 5K4MA 4TZEA 3I14A 4J5HA 5A23A 3JXPA 4D1UA 4ZO2A 1X8IA 2WYMA 3AJ3A 2BG8A 1QH5A 2NZEA 4GCWA 1MQOA 4EFZA 4UWOB 4WD6A 3LVZA 5LS3A 5KILA 5A87A 2BC2A 2NYPA 5A0VA 2GKLA 2BG6A 2BFKA 4EYLA 3T9MA 4XUKA 2FU9A 2FM6A 2I7TA 5B1UA 3P2UA 4C1EA 3VQZA 4Z60A 2BG7A 4Z6XA 4ZEJA 3ZR9A 4GYQA 4PDXA 3WXCA 3SBLA 3ZQ4A 4CHLA 2DOOA 4UAMA 3IOGA 1JJEA 5B3RA 1ZNBA 2HB9A 4TZBA 5FQBA 3H3EA 5A5ZA 3PY6A 1JT1A 2FU7A 2YCBA 2M5DA 3RKKA 2QJSA 2BG8B 5FQAA 1XTOA 4RAWA 4AD9A 3DHAA 3I13A 3BC2A 5K4KA 4AWZA 5K0WA 3KNRA 4Z67A 5AHRA 5LSCA 5LMCA 2ZO4A 3IDZA 2A7MA 2CFZA 2R2DA 2ZWRA 3L6NA 4YSLA 4NQ5A 4UWRB 2OHIA 4TZFA 2FK6A 4C1DA 2GMNA 2CBNA 3T3OA 1A7TA 1JJTA 3IOFA 3F9OA 4C1GA 3SPUA 2GCUA 1HLKA 3ADRA 1XM8A 5HIOA 5LCFA 4U4LA 3I11A 1ZKPA 5LCAA 5HH6A 5HIQA 2CG3A 1KR3A 2DKFA 3RKJA 3KL7A 2YNUA 2WHGA 2WYLA 5IQKA 2OHJA 2WRSA 3VPEA 3PY5A 5EVDA 3QH8A 4XWTA 4TYTA 4O98A 2UYXA 4YSKA 3SD9A 4EYBA 1BVTA 2YNVA 3PG4A 5ACRA 3AF6A 4DILA 4RBSA 5K4NA 3AF5A 1KO3A 3SW3A 5ACTA 2H6AA 2Q9UA 4D1VA 2I7VA 3BK2A 1WRAA 2VW8A 1WW1A 2XR1A 5DPXA 3MD7A 4KEQA 4KEPA 1VMEA 2Y8AA 5AEBA 4UBQA 2YNTA 4NQ4A 3KNSA 5EHTA 2BFLA 2YZ3A 3IE2A 2XF4A 2ZZIA 3X30A 3IE1A 2P1EA 1X8HA 2GFJA 5LCHA 2P18A 5HISA 4EXSA 2QDSA 3DH8A 2YNVB 4GYUA 5A0TA 4NQ2A 4NQ6A 5ACWA 2GFKA 4TZ9A 1X8GA 4Z7RA 4NURA 4LE6A 5HH5A 4AWYB 5AIJA 4AX1B 1WUOA 4ZO3A 4PVOA 3Q6VA 4BP0A 2NZFA 2QEDA 2YNTB 5AXOA 4F6HA 5B15A 4XWWA 3A4YA 4C1CA 2AIOA 3I0VA 3S0ZA 2E7YA 1Y44A 2P97A 5EV8A 3BK1A 4UWSB 2Q42A 3X2YA 5AHOA 4C09A 4HL2A 1E5DA
chains in the Genus database with same CATH topology
1DXKA 4EXYA 4Z5ZA 4FSBA 3RPCA 2I7XA 3ZNBA 5EVKA 5LM6A 1VGNA 4D1WA 4FR7A 2YNWA 4Z5YA 1DD6A 4TYFA 4BZ3A 4RM5A 5FQCA 4C1HA 3IELA 5AXRA 1YCFA 2FU6A 3ZWFA 3IEKA 1K07A 4ZNBA 1L9YA 5EVBA 4P62A 4YSBA 4D02A 4C1FA 2BR6A 2QINA 4UA4A 2FHXA 4RL0A 2BIBA 5EW0A 2ZNBA 1M2XA 2WYMC 5ACSA 5ACUA 4F6ZA 1YCHA 3FAIA 5LE1A 3X2ZA 2NXAA 4EYFA 3R2UA 3SRXA 5ACQA 2Q0IA 3T3NA 2BFZA 2BTNA 5ACXA 3TP9A 2Y8BA 3ESHA 1QH3A 5EV6A 5AYAA 5EH9A 5LLDA 2M5CA 4D1TA 1BMCA 2Q0JA 4RAMA 5ACVA 3G1PA 2FU8A 1P9EA 1ZTCA 1YCGA 3FCZA 4H0DA 1BC2A 4RL2A 3X2XA 1A8TA 4DIKA 2FHXB 1SMLA 4V0HA 4AX0B 2BMIA 5HIPA 4JO0A 2BGAA 4EY2A 5EWAA 4B87A 4HKYA 2BG2A 5HH4A 2AZ4A 3DHCA 2QDTA 4UWPB 1VJNA 4J5FA 3BV6A 1WUPA 2OHHA 3I15A 2Y87A 2BFZB 1KO2A 5KIKA 3SFPA 3IE0A 3DHBA 4FEKA 5ACPA 2P4ZA 1DDKA 4HL1A 4PVTA 3IEMA 5K4MA 4TZEA 3I14A 4J5HA 3JXPA 4D1UA 4ZO2A 1X8IA 2WYMA 3AJ3A 2BG8A 1QH5A 2NZEA 4GCWA 1MQOA 4EFZA 4UWOB 4WD6A 3LVZA 5LS3A 5KILA 5A87A 2BC2A 2NYPA 5A0VA 2GKLA 2BG6A 2BFKA 4EYLA 3T9MA 4XUKA 2FU9A 2FM6A 2I7TA 5B1UA 3P2UA 4C1EA 3VQZA 4Z60A 2BG7A 4Z6XA 4ZEJA 3ZR9A 4GYQA 3ZQ4A 3WXCA 3SBLA 4CHLA 2DOOA 4UAMA 3IOGA 1JJEA 5B3RA 1ZNBA 2HB9A 4TZBA 5FQBA 3H3EA 5A5ZA 3PY6A 1JT1A 2FU7A 2YCBA 2M5DA 3RKKA 2QJSA 2BG8B 5FQAA 1XTOA 4RAWA 4AD9A 3DHAA 3I13A 3BC2A 5K4KA 4AWZA 5K0WA 3KNRA 4Z67A 5AHRA 5LSCA 5LMCA 2ZO4A 3IDZA 2A7MA 2R2DA 2ZWRA 3L6NA 4YSLA 4NQ5A 4UWRB 2OHIA 4TZFA 2FK6A 4C1DA 2GMNA 2CBNA 3T3OA 1A7TA 1JJTA 3IOFA 3F9OA 4C1GA 3SPUA 2GCUA 1HLKA 3ADRA 1XM8A 5HIOA 5LCFA 4U4LA 3I11A 1ZKPA 5LCAA 5HH6A 5HIQA 1KR3A 2DKFA 3RKJA 3KL7A 2YNUA 2WHGA 2WYLA 5IQKA 2OHJA 2WRSA 3VPEA 3PY5A 5EVDA 3QH8A 4XWTA 4TYTA 4O98A 2UYXA 4YSKA 3SD9A 4EYBA 1BVTA 2YNVA 3PG4A 5ACRA 3AF6A 4DILA 4RBSA 5K4NA 3AF5A 1KO3A 3SW3A 5ACTA 2H6AA 2Q9UA 4D1VA 2I7VA 3BK2A 1WRAA 2VW8A 1WW1A 2XR1A 5DPXA 3MD7A 4KEQA 4KEPA 1VMEA 2Y8AA 5AEBA 4UBQA 2YNTA 4NQ4A 3KNSA 5EHTA 2BFLA 2YZ3A 3IE2A 2XF4A 2ZZIA 3X30A 3IE1A 2P1EA 1X8HA 2GFJA 5LCHA 2P18A 5HISA 4EXSA 2QDSA 3DH8A 2YNVB 4GYUA 5A0TA 4NQ2A 4NQ6A 5ACWA 2GFKA 4TZ9A 1X8GA 4Z7RA 4LE6A 5HH5A 4AWYB 4AX1B 1WUOA 4ZO3A 4PVOA 3Q6VA 4BP0A 2NZFA 2QEDA 2YNTB 5AXOA 4F6HA 5B15A 4XWWA 3A4YA 4C1CA 2AIOA 3I0VA 3S0ZA 2E7YA 1Y44A 2P97A 5EV8A 3BK1A 4UWSB 2Q42A 3X2YA 5AHOA 4C09A 4HL2A 1E5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DXK A;  4EXY A;  4Z5Z A;  4FSB A;  3RPC A;  2I7X A;  3ZNB A;  5EVK A;  5LM6 A;  1VGN A;  4D1W A;  4FR7 A;  2YNW A;  4Z5Y A;  1DD6 A;  4TYF A;  4BZ3 A;  4RM5 A;  5FQC A;  4C1H A;  3IEL A;  5AXR A;  1YCF A;  2FU6 A;  3ZWF A;  3IEK A;  1K07 A;  4ZNB A;  1L9Y A;  5EVB A;  4P62 A;  4YSB A;  4D02 A;  4C1F A;  2BR6 A;  2QIN A;  4UA4 A;  2FHX A;  4RL0 A;  2BIB A;  5EW0 A;  2ZNB A;  1M2X A;  2WYM C;  5ACS A;  5ACU A;  4F6Z A;  1YCH A;  3FAI A;  5LE1 A;  3X2Z A;  2NXA A;  4EYF A;  3R2U A;  3SRX A;  5ACQ A;  2Q0I A;  3T3N A;  2BFZ A;  2BTN A;  5ACX A;  3TP9 A;  2Y8B A;  3ESH A;  1QH3 A;  5EV6 A;  5AYA A;  5EH9 A;  5LLD A;  2M5C A;  4D1T A;  1BMC A;  2Q0J A;  4RAM A;  5ACV A;  3G1P A;  2FU8 A;  1P9E A;  1ZTC A;  1YCG A;  3FCZ A;  4H0D A;  1BC2 A;  4RL2 A;  3X2X A;  1A8T A;  4DIK A;  2FHX B;  1SML A;  4V0H A;  4AX0 B;  2BMI A;  5HIP A;  4JO0 A;  2BGA A;  4EY2 A;  5EWA A;  4B87 A;  4HKY A;  2BG2 A;  5HH4 A;  2AZ4 A;  3DHC A;  2QDT A;  4UWP B;  1VJN A;  4J5F A;  3BV6 A;  1WUP A;  2OHH A;  3I15 A;  2Y87 A;  2BFZ B;  1KO2 A;  5KIK A;  3SFP A;  3IE0 A;  3DHB A;  4FEK A;  5ACP A;  2P4Z A;  1DDK A;  4HL1 A;  4PVT A;  3IEM A;  5K4M A;  4TZE A;  3I14 A;  4J5H A;  3JXP A;  4D1U A;  4ZO2 A;  1X8I A;  2WYM A;  3AJ3 A;  2BG8 A;  1QH5 A;  2NZE A;  4GCW A;  1MQO A;  4EFZ A;  4UWO B;  4WD6 A;  3LVZ A;  5LS3 A;  5KIL A;  5A87 A;  2BC2 A;  2NYP A;  5A0V A;  2GKL A;  2BG6 A;  2BFK A;  4EYL A;  3T9M A;  4XUK A;  2FU9 A;  2FM6 A;  2I7T A;  5B1U A;  3P2U A;  4C1E A;  3VQZ A;  4Z60 A;  2BG7 A;  4Z6X A;  4ZEJ A;  3ZR9 A;  4GYQ A;  3ZQ4 A;  3WXC A;  3SBL A;  4CHL A;  2DOO A;  4UAM A;  3IOG A;  1JJE A;  5B3R A;  1ZNB A;  2HB9 A;  4TZB A;  5FQB A;  3H3E A;  5A5Z A;  3PY6 A;  1JT1 A;  2FU7 A;  2YCB A;  2M5D A;  3RKK A;  2QJS A;  2BG8 B;  5FQA A;  1XTO A;  4RAW A;  4AD9 A;  3DHA A;  3I13 A;  3BC2 A;  5K4K A;  4AWZ A;  5K0W A;  3KNR A;  4Z67 A;  5AHR A;  5LSC A;  5LMC A;  2ZO4 A;  3IDZ A;  2A7M A;  2R2D A;  2ZWR A;  3L6N A;  4YSL A;  4NQ5 A;  4UWR B;  2OHI A;  4TZF A;  2FK6 A;  4C1D A;  2GMN A;  2CBN A;  3T3O A;  1A7T A;  1JJT A;  3IOF A;  3F9O A;  4C1G A;  3SPU A;  2GCU A;  1HLK A;  3ADR A;  1XM8 A;  5HIO A;  5LCF A;  4U4L A;  3I11 A;  1ZKP A;  5LCA A;  5HH6 A;  5HIQ A;  1KR3 A;  2DKF A;  3RKJ A;  3KL7 A;  2YNU A;  2WHG A;  2WYL A;  5IQK A;  2OHJ A;  2WRS A;  3VPE A;  3PY5 A;  5EVD A;  3QH8 A;  4XWT A;  4TYT A;  4O98 A;  2UYX A;  4YSK A;  3SD9 A;  4EYB A;  1BVT A;  2YNV A;  3PG4 A;  5ACR A;  3AF6 A;  4DIL A;  4RBS A;  5K4N A;  3AF5 A;  1KO3 A;  3SW3 A;  5ACT A;  2H6A A;  2Q9U A;  4D1V A;  2I7V A;  3BK2 A;  1WRA A;  2VW8 A;  1WW1 A;  2XR1 A;  5DPX A;  3MD7 A;  4KEQ A;  4KEP A;  1VME A;  2Y8A A;  5AEB A;  4UBQ A;  2YNT A;  4NQ4 A;  3KNS A;  5EHT A;  2BFL A;  2YZ3 A;  3IE2 A;  2XF4 A;  2ZZI A;  3X30 A;  3IE1 A;  2P1E A;  1X8H A;  2GFJ A;  5LCH A;  2P18 A;  5HIS A;  4EXS A;  2QDS A;  3DH8 A;  2YNV B;  4GYU A;  5A0T A;  4NQ2 A;  4NQ6 A;  5ACW A;  2GFK A;  4TZ9 A;  1X8G A;  4Z7R A;  4LE6 A;  5HH5 A;  4AWY B;  4AX1 B;  1WUO A;  4ZO3 A;  4PVO A;  3Q6V A;  4BP0 A;  2NZF A;  2QED A;  2YNT B;  5AXO A;  4F6H A;  5B15 A;  4XWW A;  3A4Y A;  4C1C A;  2AIO A;  3I0V A;  3S0Z A;  2E7Y A;  1Y44 A;  2P97 A;  5EV8 A;  3BK1 A;  4UWS B;  2Q42 A;  3X2Y A;  5AHO A;  4C09 A;  4HL2 A;  1E5D A; 
#chains in the Genus database with same CATH topology
 1DXK A;  4AV7 A;  4EXY A;  4Z5Z A;  4FSB A;  3RPC A;  2I7X A;  2CFU A;  3ZNB A;  5EVK A;  5LM6 A;  1VGN A;  4D1W A;  4FR7 A;  2YNW A;  4Z5Y A;  1DD6 A;  4TYF A;  4BZ3 A;  4RM5 A;  5FQC A;  4C1H A;  3IEL A;  5AXR A;  1YCF A;  2FU6 A;  3ZWF A;  3IEK A;  1K07 A;  4ZNB A;  1L9Y A;  5EVB A;  4P62 A;  4YSB A;  4D02 A;  4C1F A;  2BR6 A;  2QIN A;  4UA4 A;  2FHX A;  4RL0 A;  5AJL A;  2BIB A;  5EW0 A;  2ZNB A;  1M2X A;  2WYM C;  5ACS A;  5ACU A;  4F6Z A;  1YCH A;  3FAI A;  5LE1 A;  3X2Z A;  4AXH A;  2NXA A;  4EYF A;  3R2U A;  3SRX A;  5ACQ A;  2Q0I A;  3T3N A;  2BFZ A;  2BTN A;  5ACX A;  3TP9 A;  2Y8B A;  3ESH A;  1QH3 A;  5EV6 A;  5AYA A;  5EH9 A;  5LLD A;  2M5C A;  4D1T A;  1BMC A;  2Q0J A;  4RAM A;  5ACV A;  3G1P A;  2FU8 A;  1P9E A;  1ZTC A;  1YCG A;  3FCZ A;  4H0D A;  1BC2 A;  4RL2 A;  3X2X A;  1A8T A;  4DIK A;  2YHE A;  2FHX B;  1SML A;  4V0H A;  4AX0 B;  2BMI A;  5HIP A;  4JO0 A;  2BGA A;  4EY2 A;  5EWA A;  2CG2 A;  4B87 A;  4HKY A;  2BG2 A;  5HH4 A;  2AZ4 A;  3DHC A;  2QDT A;  4UWP B;  1VJN A;  4J5F A;  3BV6 A;  1WUP A;  2OHH A;  3I15 A;  2Y87 A;  2BFZ B;  1KO2 A;  5KIK A;  3SFP A;  3IE0 A;  3DHB A;  4FEK A;  5ACP A;  2P4Z A;  1DDK A;  4HL1 A;  4PVT A;  3IEM A;  5K4M A;  4TZE A;  3I14 A;  4J5H A;  5A23 A;  3JXP A;  4D1U A;  4ZO2 A;  1X8I A;  2WYM A;  3AJ3 A;  2BG8 A;  1QH5 A;  2NZE A;  4GCW A;  1MQO A;  4EFZ A;  4UWO B;  4WD6 A;  3LVZ A;  5LS3 A;  5KIL A;  5A87 A;  2BC2 A;  2NYP A;  5A0V A;  2GKL A;  2BG6 A;  2BFK A;  4EYL A;  3T9M A;  4XUK A;  2FU9 A;  2FM6 A;  2I7T A;  5B1U A;  3P2U A;  4C1E A;  3VQZ A;  4Z60 A;  2BG7 A;  4Z6X A;  4ZEJ A;  3ZR9 A;  4GYQ A;  4PDX A;  3WXC A;  3SBL A;  3ZQ4 A;  4CHL A;  2DOO A;  4UAM A;  3IOG A;  1JJE A;  5B3R A;  1ZNB A;  2HB9 A;  4TZB A;  5FQB A;  3H3E A;  5A5Z A;  3PY6 A;  1JT1 A;  2FU7 A;  2YCB A;  2M5D A;  3RKK A;  2QJS A;  2BG8 B;  5FQA A;  1XTO A;  4RAW A;  4AD9 A;  3DHA A;  3I13 A;  3BC2 A;  5K4K A;  4AWZ A;  5K0W A;  3KNR A;  4Z67 A;  5AHR A;  5LSC A;  5LMC A;  2ZO4 A;  3IDZ A;  2A7M A;  2CFZ A;  2R2D A;  2ZWR A;  3L6N A;  4YSL A;  4NQ5 A;  4UWR B;  2OHI A;  4TZF A;  2FK6 A;  4C1D A;  2GMN A;  2CBN A;  3T3O A;  1A7T A;  1JJT A;  3IOF A;  3F9O A;  4C1G A;  3SPU A;  2GCU A;  1HLK A;  3ADR A;  1XM8 A;  5HIO A;  5LCF A;  4U4L A;  3I11 A;  1ZKP A;  5LCA A;  5HH6 A;  5HIQ A;  2CG3 A;  1KR3 A;  2DKF A;  3RKJ A;  3KL7 A;  2YNU A;  2WHG A;  2WYL A;  5IQK A;  2OHJ A;  2WRS A;  3VPE A;  3PY5 A;  5EVD A;  3QH8 A;  4XWT A;  4TYT A;  4O98 A;  2UYX A;  4YSK A;  3SD9 A;  4EYB A;  1BVT A;  2YNV A;  3PG4 A;  5ACR A;  3AF6 A;  4DIL A;  4RBS A;  5K4N A;  3AF5 A;  1KO3 A;  3SW3 A;  5ACT A;  2H6A A;  2Q9U A;  4D1V A;  2I7V A;  3BK2 A;  1WRA A;  2VW8 A;  1WW1 A;  2XR1 A;  5DPX A;  3MD7 A;  4KEQ A;  4KEP A;  1VME A;  2Y8A A;  5AEB A;  4UBQ A;  2YNT A;  4NQ4 A;  3KNS A;  5EHT A;  2BFL A;  2YZ3 A;  3IE2 A;  2XF4 A;  2ZZI A;  3X30 A;  3IE1 A;  2P1E A;  1X8H A;  2GFJ A;  5LCH A;  2P18 A;  5HIS A;  4EXS A;  2QDS A;  3DH8 A;  2YNV B;  4GYU A;  5A0T A;  4NQ2 A;  4NQ6 A;  5ACW A;  2GFK A;  4TZ9 A;  1X8G A;  4Z7R A;  4NUR A;  4LE6 A;  5HH5 A;  4AWY B;  5AIJ A;  4AX1 B;  1WUO A;  4ZO3 A;  4PVO A;  3Q6V A;  4BP0 A;  2NZF A;  2QED A;  2YNT B;  5AXO A;  4F6H A;  5B15 A;  4XWW A;  3A4Y A;  4C1C A;  2AIO A;  3I0V A;  3S0Z A;  2E7Y A;  1Y44 A;  2P97 A;  5EV8 A;  3BK1 A;  4UWS B;  2Q42 A;  3X2Y A;  5AHO A;  4C09 A;  4HL2 A;  1E5D A; 
#chains in the Genus database with same CATH homology
 1DXK A;  4EXY A;  4Z5Z A;  4FSB A;  3RPC A;  2I7X A;  3ZNB A;  5EVK A;  5LM6 A;  1VGN A;  4D1W A;  4FR7 A;  2YNW A;  4Z5Y A;  1DD6 A;  4TYF A;  4BZ3 A;  4RM5 A;  5FQC A;  4C1H A;  3IEL A;  5AXR A;  1YCF A;  2FU6 A;  3ZWF A;  3IEK A;  1K07 A;  4ZNB A;  1L9Y A;  5EVB A;  4P62 A;  4YSB A;  4D02 A;  4C1F A;  2BR6 A;  2QIN A;  4UA4 A;  2FHX A;  4RL0 A;  2BIB A;  5EW0 A;  2ZNB A;  1M2X A;  2WYM C;  5ACS A;  5ACU A;  4F6Z A;  1YCH A;  3FAI A;  5LE1 A;  3X2Z A;  2NXA A;  4EYF A;  3R2U A;  3SRX A;  5ACQ A;  2Q0I A;  3T3N A;  2BFZ A;  2BTN A;  5ACX A;  3TP9 A;  2Y8B A;  3ESH A;  1QH3 A;  5EV6 A;  5AYA A;  5EH9 A;  5LLD A;  2M5C A;  4D1T A;  1BMC A;  2Q0J A;  4RAM A;  5ACV A;  3G1P A;  2FU8 A;  1P9E A;  1ZTC A;  1YCG A;  3FCZ A;  4H0D A;  1BC2 A;  4RL2 A;  3X2X A;  1A8T A;  4DIK A;  2FHX B;  1SML A;  4V0H A;  4AX0 B;  2BMI A;  5HIP A;  4JO0 A;  2BGA A;  4EY2 A;  5EWA A;  4B87 A;  4HKY A;  2BG2 A;  5HH4 A;  2AZ4 A;  3DHC A;  2QDT A;  4UWP B;  1VJN A;  4J5F A;  3BV6 A;  1WUP A;  2OHH A;  3I15 A;  2Y87 A;  2BFZ B;  1KO2 A;  5KIK A;  3SFP A;  3IE0 A;  3DHB A;  4FEK A;  5ACP A;  2P4Z A;  1DDK A;  4HL1 A;  4PVT A;  3IEM A;  5K4M A;  4TZE A;  3I14 A;  4J5H A;  3JXP A;  4D1U A;  4ZO2 A;  1X8I A;  2WYM A;  3AJ3 A;  2BG8 A;  1QH5 A;  2NZE A;  4GCW A;  1MQO A;  4EFZ A;  4UWO B;  4WD6 A;  3LVZ A;  5LS3 A;  5KIL A;  5A87 A;  2BC2 A;  2NYP A;  5A0V A;  2GKL A;  2BG6 A;  2BFK A;  4EYL A;  3T9M A;  4XUK A;  2FU9 A;  2FM6 A;  2I7T A;  5B1U A;  3P2U A;  4C1E A;  3VQZ A;  4Z60 A;  2BG7 A;  4Z6X A;  4ZEJ A;  3ZR9 A;  4GYQ A;  3ZQ4 A;  3WXC A;  3SBL A;  4CHL A;  2DOO A;  4UAM A;  3IOG A;  1JJE A;  5B3R A;  1ZNB A;  2HB9 A;  4TZB A;  5FQB A;  3H3E A;  5A5Z A;  3PY6 A;  1JT1 A;  2FU7 A;  2YCB A;  2M5D A;  3RKK A;  2QJS A;  2BG8 B;  5FQA A;  1XTO A;  4RAW A;  4AD9 A;  3DHA A;  3I13 A;  3BC2 A;  5K4K A;  4AWZ A;  5K0W A;  3KNR A;  4Z67 A;  5AHR A;  5LSC A;  5LMC A;  2ZO4 A;  3IDZ A;  2A7M A;  2R2D A;  2ZWR A;  3L6N A;  4YSL A;  4NQ5 A;  4UWR B;  2OHI A;  4TZF A;  2FK6 A;  4C1D A;  2GMN A;  2CBN A;  3T3O A;  1A7T A;  1JJT A;  3IOF A;  3F9O A;  4C1G A;  3SPU A;  2GCU A;  1HLK A;  3ADR A;  1XM8 A;  5HIO A;  5LCF A;  4U4L A;  3I11 A;  1ZKP A;  5LCA A;  5HH6 A;  5HIQ A;  1KR3 A;  2DKF A;  3RKJ A;  3KL7 A;  2YNU A;  2WHG A;  2WYL A;  5IQK A;  2OHJ A;  2WRS A;  3VPE A;  3PY5 A;  5EVD A;  3QH8 A;  4XWT A;  4TYT A;  4O98 A;  2UYX A;  4YSK A;  3SD9 A;  4EYB A;  1BVT A;  2YNV A;  3PG4 A;  5ACR A;  3AF6 A;  4DIL A;  4RBS A;  5K4N A;  3AF5 A;  1KO3 A;  3SW3 A;  5ACT A;  2H6A A;  2Q9U A;  4D1V A;  2I7V A;  3BK2 A;  1WRA A;  2VW8 A;  1WW1 A;  2XR1 A;  5DPX A;  3MD7 A;  4KEQ A;  4KEP A;  1VME A;  2Y8A A;  5AEB A;  4UBQ A;  2YNT A;  4NQ4 A;  3KNS A;  5EHT A;  2BFL A;  2YZ3 A;  3IE2 A;  2XF4 A;  2ZZI A;  3X30 A;  3IE1 A;  2P1E A;  1X8H A;  2GFJ A;  5LCH A;  2P18 A;  5HIS A;  4EXS A;  2QDS A;  3DH8 A;  2YNV B;  4GYU A;  5A0T A;  4NQ2 A;  4NQ6 A;  5ACW A;  2GFK A;  4TZ9 A;  1X8G A;  4Z7R A;  4LE6 A;  5HH5 A;  4AWY B;  4AX1 B;  1WUO A;  4ZO3 A;  4PVO A;  3Q6V A;  4BP0 A;  2NZF A;  2QED A;  2YNT B;  5AXO A;  4F6H A;  5B15 A;  4XWW A;  3A4Y A;  4C1C A;  2AIO A;  3I0V A;  3S0Z A;  2E7Y A;  1Y44 A;  2P97 A;  5EV8 A;  3BK1 A;  4UWS B;  2Q42 A;  3X2Y A;  5AHO A;  4C09 A;  4HL2 A;  1E5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...