4KEPA

Crystal structure of 4-pyridoxolactonase, wild-type
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
273
structure length
273
Chain Sequence
SDTKVYLLDGGSLVLDGYHVFWNRGPGGEVRFPVYSILIEHAEGRFLIDTGYDYDHVMKVLPFEKPIQEKHQTIPGALGLLGLEPRDIDVVVNSHFHFDHCGGNKYFPHAKKICHRSEVPQACNPQPFEHLGYSDLSFSAEAAEARGATAQLLEGTTRANSTFEGIDGDVDLARGVKLISTPGHSIGHYSLLVEFPRRKPILFTIDAAYTQKSLETLCQAAFHIDPVAGVNSMRKVKKLAEDHGAELMYSHDMDNFKTYRTGTQFYGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-pyridoxolactonase
publication title Structure of 4-pyridoxolactonase from Mesorhizobium loti
doi rcsb
source organism Mesorhizobium loti
molecule tags Hydrolase
total genus 93
structure length 273
sequence length 273
ec nomenclature ec 3.1.1.27: 4-pyridoxolactonase.
pdb deposition date 2013-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4kepA00
4UA4A 5AEBA 2UYXA 4D02A 2AZ4A 1X8IA 2BG8A 5HIPA 1XM8A 2GCUA 4LE6A 4YSKA 3FCZA 3MD7A 2ZNBA 2YNWA 4XWWA 2Y8BA 1BMCA 3IE1A 4NQ6A 4FSBA 4ZO3A 5KIKA 3ZWFA 5ACRA 2BFLA 1K07A 4RAMA 4UWRB 2YNUA 2FU7A 5HH6A 1QH5A 4HL2A 4TZ9A 2BC2A 4UBQA 2NZFA 4XUKA 1KR3A 2CBNA 2I7TA 4C1HA 4C1EA 5ACTA 5LM6A 5FQAA 4HKYA 1VJNA 3T9MA 5LCAA 1MQOA 3JXPA 3RPCA 1DDKA 4GCWA 3I13A 4YSLA 4RBSA 3ADRA 3KNSA 2Y8AA 5EVDA 2Q0IA 4Z6XA 2GFJA 5FQCA 1X8HA 5EV6A 2FK6A 2Q42A 2YNVB 1ZKPA 3KL7A 4GYUA 4EXYA 3SW3A 3PG4A 3T3NA 1VGNA 3IOFA 4NQ2A 5LCFA 2QDSA 2YNTB 4RAWA 5FQBA 2YNVA 5HH5A 3ZQ4A 2P1EA 2QJSA 1JJEA 3SD9A 3DHBA 5EV8A 2M5CA 4Z5ZA 2Q9UA 3QH8A 5ACXA 2FHXB 3SBLA 3A4YA 2WYLA 2NYPA 4Z67A 3RKJA 3BC2A 3VQZA 4JO0A 3LVZA 4WD6A 4KEQA 2NZEA 4H0DA 1WW1A 1ZTCA 2E7YA 2YCBA 1A7TA 4AD9A 2H6AA 5AHRA 5B15A 4FR7A 2ZZIA 5EH9A 3AF5A 4D1UA 4Z5YA 1JJTA 3ESHA 2GKLA 4DIKA 3RKKA 4O98A 3IEMA 3ZR9A 3P2UA 3BK1A 5AXRA 5ACQA 5EWAA 3PY5A 3X2YA 1QH3A 3DHAA 4RM5A 2P18A 4XWTA 5ACVA 1VMEA 2BFZB 5ACUA 2R2DA 3BK2A 1DD6A 4TZBA 3S0ZA 4EXSA 4C1DA 5K4NA 4CHLA 2BMIA 2M5DA 2I7VA 5B1UA 3DH8A 2WRSA 1KO2A 3WXCA 2Y87A 4NQ4A 5IQKA 3ZNBA 3F9OA 4ZNBA 4Z7RA 3IE0A 3FAIA 1JT1A 4BZ3A 4D1TA 1E5DA 5K4KA 2XF4A 4F6HA 2BFKA 1Y44A 2OHIA 3SRXA 2OHJA 3IEKA 5KILA 3AF6A 1YCFA 1HLKA 5K0WA 3SPUA 2WYMC 4ZEJA 2Q0JA 3IE2A 4FEKA 2QINA 5A87A 2YNTA 4KEPA 2BR6A 3BV6A 3I14A 2ZWRA 5HISA 5HH4A 3G1PA 2I7XA 2GFKA 1YCGA 5ACPA 4TYTA 1KO3A 2FU9A 5AYAA 2FHXA 5LSCA 4D1VA 3IOGA 5A0VA 1SMLA 2NXAA 4F6ZA 1BC2A 1DXKA 4V0HA 3X2ZA 1A8TA 5EW0A 5LS3A 2DOOA 4P62A 1X8GA 4EYFA 1P9EA 4HL1A 4EYLA 4UWPB 2YZ3A 2P4ZA 4C1CA 4EY2A 2ZO4A 3L6NA 4UAMA 4Z60A 5EHTA 3DHCA 4AWZA 5ACWA 5EVBA 4TYFA 2AIOA 4BP0A 5LLDA 2QDTA 4EYBA 4ZO2A 2VW8A 4C09A 5HIQA 4AX0B 5LCHA 2BG7A 2P97A 1WUPA 4D1WA 4GYQA 4EFZA 1ZNBA 5ACSA 1L9YA 3PY6A 2FU8A 2BG6A 2HB9A 2BFZA 4C1GA 4C1FA 5HIOA 1YCHA 3KNRA 2WHGA 2DKFA 4DILA 3AJ3A 4UWSB 1BVTA 5EVKA 2BTNA 1WUOA 3IELA 3X2XA 4B87A 4UWOB 4TZEA 4TZFA 5LMCA 5A0TA 4U4LA 1M2XA 3T3OA 2BIBA 3IDZA 1XTOA 5K4MA 2WYMA 3H3EA 4J5HA 4NQ5A 4AWYB 2XR1A 4AX1B 1WRAA 3TP9A 2BG2A 3I11A 4YSBA 4RL2A 3Q6VA 3I0VA 5AXOA 2GMNA 5AHOA 4PVTA 2FU6A 3VPEA 3I15A 5A5ZA 2QEDA 2A7MA 3X30A 3SFPA 5LE1A 2BG8B 2FM6A 2BGAA 2OHHA 4RL0A 5B3RA 4PVOA 5DPXA 4J5FA 3R2UA
chains in the Genus database with same CATH superfamily
4UA4A 5AEBA 2UYXA 4D02A 2AZ4A 1X8IA 2BG8A 5HIPA 1XM8A 2GCUA 4LE6A 4YSKA 3FCZA 3MD7A 2ZNBA 2YNWA 4XWWA 2Y8BA 1BMCA 3IE1A 4NQ6A 4FSBA 4ZO3A 5KIKA 3ZWFA 5ACRA 2BFLA 1K07A 4RAMA 4UWRB 2YNUA 2FU7A 5HH6A 1QH5A 4HL2A 4TZ9A 4AV7A 2BC2A 4UBQA 2NZFA 4XUKA 1KR3A 2CBNA 2I7TA 4C1HA 4C1EA 5ACTA 5LM6A 5FQAA 4HKYA 1VJNA 3T9MA 5LCAA 1MQOA 3JXPA 3RPCA 1DDKA 4GCWA 3I13A 4YSLA 4RBSA 3ADRA 3KNSA 2Y8AA 5EVDA 2Q0IA 4Z6XA 2GFJA 5FQCA 1X8HA 5EV6A 2FK6A 2Q42A 2YNVB 1ZKPA 3KL7A 4GYUA 4EXYA 2CG2A 3SW3A 3PG4A 5AJLA 3T3NA 1VGNA 3IOFA 4NQ2A 5LCFA 2QDSA 2YNTB 4RAWA 5FQBA 2YNVA 5HH5A 3ZQ4A 2P1EA 2QJSA 1JJEA 3SD9A 3DHBA 5EV8A 2M5CA 4Z5ZA 2Q9UA 3QH8A 5ACXA 2FHXB 3SBLA 3A4YA 2WYLA 2NYPA 2CFZA 4Z67A 3RKJA 3BC2A 3VQZA 5A23A 4JO0A 3LVZA 4NURA 4AXHA 4WD6A 4KEQA 2NZEA 4H0DA 1WW1A 1ZTCA 2E7YA 2YCBA 1A7TA 4AD9A 2H6AA 5AHRA 5B15A 4FR7A 2ZZIA 5EH9A 3AF5A 4D1UA 4Z5YA 1JJTA 3ESHA 2GKLA 4DIKA 3RKKA 4O98A 3IEMA 3ZR9A 3P2UA 3BK1A 5AXRA 5ACQA 5EWAA 5AIJA 3PY5A 3X2YA 1QH3A 3DHAA 4RM5A 2P18A 4XWTA 5ACVA 1VMEA 2BFZB 5ACUA 2R2DA 3BK2A 1DD6A 4TZBA 3S0ZA 4EXSA 4C1DA 5K4NA 4CHLA 2BMIA 2M5DA 2I7VA 5B1UA 3DH8A 2WRSA 1KO2A 3WXCA 2Y87A 4NQ4A 5IQKA 3ZNBA 3F9OA 4ZNBA 4Z7RA 3IE0A 3FAIA 1JT1A 4BZ3A 4D1TA 1E5DA 5K4KA 2XF4A 4F6HA 2BFKA 1Y44A 2OHIA 3SRXA 2OHJA 3IEKA 5KILA 3AF6A 1YCFA 1HLKA 5K0WA 3SPUA 2WYMC 4ZEJA 2Q0JA 3IE2A 4FEKA 2QINA 5A87A 2YNTA 4KEPA 2BR6A 3BV6A 3I14A 2ZWRA 5HISA 5HH4A 3G1PA 2I7XA 2GFKA 1YCGA 5ACPA 4TYTA 1KO3A 2FU9A 5AYAA 2FHXA 5LSCA 4D1VA 3IOGA 5A0VA 1SMLA 2NXAA 4F6ZA 1BC2A 1DXKA 4V0HA 3X2ZA 1A8TA 5EW0A 5LS3A 2DOOA 4P62A 1X8GA 4EYFA 1P9EA 4HL1A 4EYLA 4UWPB 2YZ3A 2P4ZA 4C1CA 4EY2A 2ZO4A 3L6NA 4UAMA 4Z60A 5EHTA 3DHCA 4AWZA 5ACWA 5EVBA 4TYFA 2AIOA 4BP0A 5LLDA 4PDXA 2QDTA 4ZO2A 4EYBA 2VW8A 4C09A 5HIQA 2CG3A 4AX0B 5LCHA 2BG7A 2P97A 1WUPA 4D1WA 4GYQA 2YHEA 4EFZA 2CFUA 1ZNBA 5ACSA 1L9YA 3PY6A 2FU8A 2BG6A 2HB9A 2BFZA 4C1GA 4C1FA 5HIOA 1YCHA 3KNRA 2WHGA 2DKFA 4DILA 3AJ3A 4UWSB 1BVTA 5EVKA 2BTNA 1WUOA 3IELA 3X2XA 4B87A 4UWOB 4TZEA 4TZFA 5LMCA 5A0TA 4U4LA 1M2XA 3T3OA 2BIBA 3IDZA 1XTOA 5K4MA 2WYMA 3H3EA 4J5HA 4NQ5A 4AWYB 2XR1A 4AX1B 1WRAA 3TP9A 2BG2A 3I11A 4YSBA 4RL2A 3Q6VA 3I0VA 5AXOA 2GMNA 5AHOA 4PVTA 2FU6A 3VPEA 3I15A 5A5ZA 2QEDA 2A7MA 3X30A 3SFPA 5LE1A 2BG8B 2FM6A 2BGAA 2OHHA 4RL0A 5B3RA 4PVOA 5DPXA 4J5FA 3R2UA
chains in the Genus database with same CATH topology
4UA4A 5AEBA 2UYXA 4D02A 2AZ4A 1X8IA 2BG8A 5HIPA 1XM8A 2GCUA 4LE6A 4YSKA 3FCZA 3MD7A 2ZNBA 2YNWA 4XWWA 2Y8BA 1BMCA 3IE1A 4NQ6A 4FSBA 4ZO3A 5KIKA 3ZWFA 5ACRA 2BFLA 1K07A 4RAMA 4UWRB 2YNUA 2FU7A 5HH6A 1QH5A 4HL2A 4TZ9A 2BC2A 4UBQA 2NZFA 4XUKA 1KR3A 2CBNA 2I7TA 4C1HA 4C1EA 5ACTA 5LM6A 5FQAA 4HKYA 1VJNA 3T9MA 5LCAA 1MQOA 3JXPA 3RPCA 1DDKA 4GCWA 3I13A 4YSLA 4RBSA 3ADRA 3KNSA 2Y8AA 5EVDA 2Q0IA 4Z6XA 2GFJA 5FQCA 1X8HA 5EV6A 2FK6A 2Q42A 2YNVB 1ZKPA 3KL7A 4GYUA 4EXYA 3SW3A 3PG4A 3T3NA 1VGNA 3IOFA 4NQ2A 5LCFA 2QDSA 2YNTB 4RAWA 5FQBA 2YNVA 5HH5A 3ZQ4A 2P1EA 2QJSA 1JJEA 3SD9A 3DHBA 5EV8A 2M5CA 4Z5ZA 2Q9UA 3QH8A 5ACXA 2FHXB 3SBLA 3A4YA 2WYLA 2NYPA 4Z67A 3RKJA 3BC2A 3VQZA 4JO0A 3LVZA 4WD6A 4KEQA 2NZEA 4H0DA 1WW1A 1ZTCA 2E7YA 2YCBA 1A7TA 4AD9A 2H6AA 5AHRA 5B15A 4FR7A 2ZZIA 5EH9A 3AF5A 4D1UA 4Z5YA 1JJTA 3ESHA 2GKLA 4DIKA 3RKKA 4O98A 3IEMA 3ZR9A 3P2UA 3BK1A 5AXRA 5ACQA 5EWAA 3PY5A 3X2YA 1QH3A 3DHAA 4RM5A 2P18A 4XWTA 5ACVA 1VMEA 2BFZB 5ACUA 2R2DA 3BK2A 1DD6A 4TZBA 3S0ZA 4EXSA 4C1DA 5K4NA 4CHLA 2BMIA 2M5DA 2I7VA 5B1UA 3DH8A 2WRSA 1KO2A 3WXCA 2Y87A 4NQ4A 5IQKA 3ZNBA 3F9OA 4ZNBA 4Z7RA 3IE0A 3FAIA 1JT1A 4BZ3A 4D1TA 1E5DA 5K4KA 2XF4A 4F6HA 2BFKA 1Y44A 2OHIA 3SRXA 2OHJA 3IEKA 5KILA 3AF6A 1YCFA 1HLKA 5K0WA 3SPUA 2WYMC 4ZEJA 2Q0JA 3IE2A 4FEKA 2QINA 5A87A 2YNTA 4KEPA 2BR6A 3BV6A 3I14A 2ZWRA 5HISA 5HH4A 3G1PA 2I7XA 2GFKA 1YCGA 5ACPA 4TYTA 1KO3A 2FU9A 5AYAA 2FHXA 5LSCA 4D1VA 3IOGA 5A0VA 1SMLA 2NXAA 4F6ZA 1BC2A 1DXKA 4V0HA 3X2ZA 1A8TA 5EW0A 5LS3A 2DOOA 4P62A 1X8GA 4EYFA 1P9EA 4HL1A 4EYLA 4UWPB 2YZ3A 2P4ZA 4C1CA 4EY2A 2ZO4A 3L6NA 4UAMA 4Z60A 5EHTA 3DHCA 4AWZA 5ACWA 5EVBA 4TYFA 2AIOA 4BP0A 5LLDA 2QDTA 4EYBA 4ZO2A 2VW8A 4C09A 5HIQA 4AX0B 5LCHA 2BG7A 2P97A 1WUPA 4D1WA 4GYQA 4EFZA 1ZNBA 5ACSA 1L9YA 3PY6A 2FU8A 2BG6A 2HB9A 2BFZA 4C1GA 4C1FA 5HIOA 1YCHA 3KNRA 2WHGA 2DKFA 4DILA 3AJ3A 4UWSB 1BVTA 5EVKA 2BTNA 1WUOA 3IELA 3X2XA 4B87A 4UWOB 4TZEA 4TZFA 5LMCA 5A0TA 4U4LA 1M2XA 3T3OA 2BIBA 3IDZA 1XTOA 5K4MA 2WYMA 3H3EA 4J5HA 4NQ5A 4AWYB 2XR1A 4AX1B 1WRAA 3TP9A 2BG2A 3I11A 4YSBA 4RL2A 3Q6VA 3I0VA 5AXOA 2GMNA 5AHOA 4PVTA 2FU6A 3VPEA 3I15A 5A5ZA 2QEDA 2A7MA 3X30A 3SFPA 5LE1A 2BG8B 2FM6A 2BGAA 2OHHA 4RL0A 5B3RA 4PVOA 5DPXA 4J5FA 3R2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UA4 A;  5AEB A;  2UYX A;  4D02 A;  2AZ4 A;  1X8I A;  2BG8 A;  5HIP A;  1XM8 A;  2GCU A;  4LE6 A;  4YSK A;  3FCZ A;  3MD7 A;  2ZNB A;  2YNW A;  4XWW A;  2Y8B A;  1BMC A;  3IE1 A;  4NQ6 A;  4FSB A;  4ZO3 A;  5KIK A;  3ZWF A;  5ACR A;  2BFL A;  1K07 A;  4RAM A;  4UWR B;  2YNU A;  2FU7 A;  5HH6 A;  1QH5 A;  4HL2 A;  4TZ9 A;  2BC2 A;  4UBQ A;  2NZF A;  4XUK A;  1KR3 A;  2CBN A;  2I7T A;  4C1H A;  4C1E A;  5ACT A;  5LM6 A;  5FQA A;  4HKY A;  1VJN A;  3T9M A;  5LCA A;  1MQO A;  3JXP A;  3RPC A;  1DDK A;  4GCW A;  3I13 A;  4YSL A;  4RBS A;  3ADR A;  3KNS A;  2Y8A A;  5EVD A;  2Q0I A;  4Z6X A;  2GFJ A;  5FQC A;  1X8H A;  5EV6 A;  2FK6 A;  2Q42 A;  2YNV B;  1ZKP A;  3KL7 A;  4GYU A;  4EXY A;  3SW3 A;  3PG4 A;  3T3N A;  1VGN A;  3IOF A;  4NQ2 A;  5LCF A;  2QDS A;  2YNT B;  4RAW A;  5FQB A;  2YNV A;  5HH5 A;  3ZQ4 A;  2P1E A;  2QJS A;  1JJE A;  3SD9 A;  3DHB A;  5EV8 A;  2M5C A;  4Z5Z A;  2Q9U A;  3QH8 A;  5ACX A;  2FHX B;  3SBL A;  3A4Y A;  2WYL A;  2NYP A;  4Z67 A;  3RKJ A;  3BC2 A;  3VQZ A;  4JO0 A;  3LVZ A;  4WD6 A;  4KEQ A;  2NZE A;  4H0D A;  1WW1 A;  1ZTC A;  2E7Y A;  2YCB A;  1A7T A;  4AD9 A;  2H6A A;  5AHR A;  5B15 A;  4FR7 A;  2ZZI A;  5EH9 A;  3AF5 A;  4D1U A;  4Z5Y A;  1JJT A;  3ESH A;  2GKL A;  4DIK A;  3RKK A;  4O98 A;  3IEM A;  3ZR9 A;  3P2U A;  3BK1 A;  5AXR A;  5ACQ A;  5EWA A;  3PY5 A;  3X2Y A;  1QH3 A;  3DHA A;  4RM5 A;  2P18 A;  4XWT A;  5ACV A;  1VME A;  2BFZ B;  5ACU A;  2R2D A;  3BK2 A;  1DD6 A;  4TZB A;  3S0Z A;  4EXS A;  4C1D A;  5K4N A;  4CHL A;  2BMI A;  2M5D A;  2I7V A;  5B1U A;  3DH8 A;  2WRS A;  1KO2 A;  3WXC A;  2Y87 A;  4NQ4 A;  5IQK A;  3ZNB A;  3F9O A;  4ZNB A;  4Z7R A;  3IE0 A;  3FAI A;  1JT1 A;  4BZ3 A;  4D1T A;  1E5D A;  5K4K A;  2XF4 A;  4F6H A;  2BFK A;  1Y44 A;  2OHI A;  3SRX A;  2OHJ A;  3IEK A;  5KIL A;  3AF6 A;  1YCF A;  1HLK A;  5K0W A;  3SPU A;  2WYM C;  4ZEJ A;  2Q0J A;  3IE2 A;  4FEK A;  2QIN A;  5A87 A;  2YNT A;  4KEP A;  2BR6 A;  3BV6 A;  3I14 A;  2ZWR A;  5HIS A;  5HH4 A;  3G1P A;  2I7X A;  2GFK A;  1YCG A;  5ACP A;  4TYT A;  1KO3 A;  2FU9 A;  5AYA A;  2FHX A;  5LSC A;  4D1V A;  3IOG A;  5A0V A;  1SML A;  2NXA A;  4F6Z A;  1BC2 A;  1DXK A;  4V0H A;  3X2Z A;  1A8T A;  5EW0 A;  5LS3 A;  2DOO A;  4P62 A;  1X8G A;  4EYF A;  1P9E A;  4HL1 A;  4EYL A;  4UWP B;  2YZ3 A;  2P4Z A;  4C1C A;  4EY2 A;  2ZO4 A;  3L6N A;  4UAM A;  4Z60 A;  5EHT A;  3DHC A;  4AWZ A;  5ACW A;  5EVB A;  4TYF A;  2AIO A;  4BP0 A;  5LLD A;  2QDT A;  4EYB A;  4ZO2 A;  2VW8 A;  4C09 A;  5HIQ A;  4AX0 B;  5LCH A;  2BG7 A;  2P97 A;  1WUP A;  4D1W A;  4GYQ A;  4EFZ A;  1ZNB A;  5ACS A;  1L9Y A;  3PY6 A;  2FU8 A;  2BG6 A;  2HB9 A;  2BFZ A;  4C1G A;  4C1F A;  5HIO A;  1YCH A;  3KNR A;  2WHG A;  2DKF A;  4DIL A;  3AJ3 A;  4UWS B;  1BVT A;  5EVK A;  2BTN A;  1WUO A;  3IEL A;  3X2X A;  4B87 A;  4UWO B;  4TZE A;  4TZF A;  5LMC A;  5A0T A;  4U4L A;  1M2X A;  3T3O A;  2BIB A;  3IDZ A;  1XTO A;  5K4M A;  2WYM A;  3H3E A;  4J5H A;  4NQ5 A;  4AWY B;  2XR1 A;  4AX1 B;  1WRA A;  3TP9 A;  2BG2 A;  3I11 A;  4YSB A;  4RL2 A;  3Q6V A;  3I0V A;  5AXO A;  2GMN A;  5AHO A;  4PVT A;  2FU6 A;  3VPE A;  3I15 A;  5A5Z A;  2QED A;  2A7M A;  3X30 A;  3SFP A;  5LE1 A;  2BG8 B;  2FM6 A;  2BGA A;  2OHH A;  4RL0 A;  5B3R A;  4PVO A;  5DPX A;  4J5F A;  3R2U A; 
#chains in the Genus database with same CATH topology
 4UA4 A;  5AEB A;  2UYX A;  4D02 A;  2AZ4 A;  1X8I A;  2BG8 A;  5HIP A;  1XM8 A;  2GCU A;  4LE6 A;  4YSK A;  3FCZ A;  3MD7 A;  2ZNB A;  2YNW A;  4XWW A;  2Y8B A;  1BMC A;  3IE1 A;  4NQ6 A;  4FSB A;  4ZO3 A;  5KIK A;  3ZWF A;  5ACR A;  2BFL A;  1K07 A;  4RAM A;  4UWR B;  2YNU A;  2FU7 A;  5HH6 A;  1QH5 A;  4HL2 A;  4TZ9 A;  4AV7 A;  2BC2 A;  4UBQ A;  2NZF A;  4XUK A;  1KR3 A;  2CBN A;  2I7T A;  4C1H A;  4C1E A;  5ACT A;  5LM6 A;  5FQA A;  4HKY A;  1VJN A;  3T9M A;  5LCA A;  1MQO A;  3JXP A;  3RPC A;  1DDK A;  4GCW A;  3I13 A;  4YSL A;  4RBS A;  3ADR A;  3KNS A;  2Y8A A;  5EVD A;  2Q0I A;  4Z6X A;  2GFJ A;  5FQC A;  1X8H A;  5EV6 A;  2FK6 A;  2Q42 A;  2YNV B;  1ZKP A;  3KL7 A;  4GYU A;  4EXY A;  2CG2 A;  3SW3 A;  3PG4 A;  5AJL A;  3T3N A;  1VGN A;  3IOF A;  4NQ2 A;  5LCF A;  2QDS A;  2YNT B;  4RAW A;  5FQB A;  2YNV A;  5HH5 A;  3ZQ4 A;  2P1E A;  2QJS A;  1JJE A;  3SD9 A;  3DHB A;  5EV8 A;  2M5C A;  4Z5Z A;  2Q9U A;  3QH8 A;  5ACX A;  2FHX B;  3SBL A;  3A4Y A;  2WYL A;  2NYP A;  2CFZ A;  4Z67 A;  3RKJ A;  3BC2 A;  3VQZ A;  5A23 A;  4JO0 A;  3LVZ A;  4NUR A;  4AXH A;  4WD6 A;  4KEQ A;  2NZE A;  4H0D A;  1WW1 A;  1ZTC A;  2E7Y A;  2YCB A;  1A7T A;  4AD9 A;  2H6A A;  5AHR A;  5B15 A;  4FR7 A;  2ZZI A;  5EH9 A;  3AF5 A;  4D1U A;  4Z5Y A;  1JJT A;  3ESH A;  2GKL A;  4DIK A;  3RKK A;  4O98 A;  3IEM A;  3ZR9 A;  3P2U A;  3BK1 A;  5AXR A;  5ACQ A;  5EWA A;  5AIJ A;  3PY5 A;  3X2Y A;  1QH3 A;  3DHA A;  4RM5 A;  2P18 A;  4XWT A;  5ACV A;  1VME A;  2BFZ B;  5ACU A;  2R2D A;  3BK2 A;  1DD6 A;  4TZB A;  3S0Z A;  4EXS A;  4C1D A;  5K4N A;  4CHL A;  2BMI A;  2M5D A;  2I7V A;  5B1U A;  3DH8 A;  2WRS A;  1KO2 A;  3WXC A;  2Y87 A;  4NQ4 A;  5IQK A;  3ZNB A;  3F9O A;  4ZNB A;  4Z7R A;  3IE0 A;  3FAI A;  1JT1 A;  4BZ3 A;  4D1T A;  1E5D A;  5K4K A;  2XF4 A;  4F6H A;  2BFK A;  1Y44 A;  2OHI A;  3SRX A;  2OHJ A;  3IEK A;  5KIL A;  3AF6 A;  1YCF A;  1HLK A;  5K0W A;  3SPU A;  2WYM C;  4ZEJ A;  2Q0J A;  3IE2 A;  4FEK A;  2QIN A;  5A87 A;  2YNT A;  4KEP A;  2BR6 A;  3BV6 A;  3I14 A;  2ZWR A;  5HIS A;  5HH4 A;  3G1P A;  2I7X A;  2GFK A;  1YCG A;  5ACP A;  4TYT A;  1KO3 A;  2FU9 A;  5AYA A;  2FHX A;  5LSC A;  4D1V A;  3IOG A;  5A0V A;  1SML A;  2NXA A;  4F6Z A;  1BC2 A;  1DXK A;  4V0H A;  3X2Z A;  1A8T A;  5EW0 A;  5LS3 A;  2DOO A;  4P62 A;  1X8G A;  4EYF A;  1P9E A;  4HL1 A;  4EYL A;  4UWP B;  2YZ3 A;  2P4Z A;  4C1C A;  4EY2 A;  2ZO4 A;  3L6N A;  4UAM A;  4Z60 A;  5EHT A;  3DHC A;  4AWZ A;  5ACW A;  5EVB A;  4TYF A;  2AIO A;  4BP0 A;  5LLD A;  4PDX A;  2QDT A;  4ZO2 A;  4EYB A;  2VW8 A;  4C09 A;  5HIQ A;  2CG3 A;  4AX0 B;  5LCH A;  2BG7 A;  2P97 A;  1WUP A;  4D1W A;  4GYQ A;  2YHE A;  4EFZ A;  2CFU A;  1ZNB A;  5ACS A;  1L9Y A;  3PY6 A;  2FU8 A;  2BG6 A;  2HB9 A;  2BFZ A;  4C1G A;  4C1F A;  5HIO A;  1YCH A;  3KNR A;  2WHG A;  2DKF A;  4DIL A;  3AJ3 A;  4UWS B;  1BVT A;  5EVK A;  2BTN A;  1WUO A;  3IEL A;  3X2X A;  4B87 A;  4UWO B;  4TZE A;  4TZF A;  5LMC A;  5A0T A;  4U4L A;  1M2X A;  3T3O A;  2BIB A;  3IDZ A;  1XTO A;  5K4M A;  2WYM A;  3H3E A;  4J5H A;  4NQ5 A;  4AWY B;  2XR1 A;  4AX1 B;  1WRA A;  3TP9 A;  2BG2 A;  3I11 A;  4YSB A;  4RL2 A;  3Q6V A;  3I0V A;  5AXO A;  2GMN A;  5AHO A;  4PVT A;  2FU6 A;  3VPE A;  3I15 A;  5A5Z A;  2QED A;  2A7M A;  3X30 A;  3SFP A;  5LE1 A;  2BG8 B;  2FM6 A;  2BGA A;  2OHH A;  4RL0 A;  5B3R A;  4PVO A;  5DPX A;  4J5F A;  3R2U A; 
#chains in the Genus database with same CATH homology
 4UA4 A;  5AEB A;  2UYX A;  4D02 A;  2AZ4 A;  1X8I A;  2BG8 A;  5HIP A;  1XM8 A;  2GCU A;  4LE6 A;  4YSK A;  3FCZ A;  3MD7 A;  2ZNB A;  2YNW A;  4XWW A;  2Y8B A;  1BMC A;  3IE1 A;  4NQ6 A;  4FSB A;  4ZO3 A;  5KIK A;  3ZWF A;  5ACR A;  2BFL A;  1K07 A;  4RAM A;  4UWR B;  2YNU A;  2FU7 A;  5HH6 A;  1QH5 A;  4HL2 A;  4TZ9 A;  2BC2 A;  4UBQ A;  2NZF A;  4XUK A;  1KR3 A;  2CBN A;  2I7T A;  4C1H A;  4C1E A;  5ACT A;  5LM6 A;  5FQA A;  4HKY A;  1VJN A;  3T9M A;  5LCA A;  1MQO A;  3JXP A;  3RPC A;  1DDK A;  4GCW A;  3I13 A;  4YSL A;  4RBS A;  3ADR A;  3KNS A;  2Y8A A;  5EVD A;  2Q0I A;  4Z6X A;  2GFJ A;  5FQC A;  1X8H A;  5EV6 A;  2FK6 A;  2Q42 A;  2YNV B;  1ZKP A;  3KL7 A;  4GYU A;  4EXY A;  3SW3 A;  3PG4 A;  3T3N A;  1VGN A;  3IOF A;  4NQ2 A;  5LCF A;  2QDS A;  2YNT B;  4RAW A;  5FQB A;  2YNV A;  5HH5 A;  3ZQ4 A;  2P1E A;  2QJS A;  1JJE A;  3SD9 A;  3DHB A;  5EV8 A;  2M5C A;  4Z5Z A;  2Q9U A;  3QH8 A;  5ACX A;  2FHX B;  3SBL A;  3A4Y A;  2WYL A;  2NYP A;  4Z67 A;  3RKJ A;  3BC2 A;  3VQZ A;  4JO0 A;  3LVZ A;  4WD6 A;  4KEQ A;  2NZE A;  4H0D A;  1WW1 A;  1ZTC A;  2E7Y A;  2YCB A;  1A7T A;  4AD9 A;  2H6A A;  5AHR A;  5B15 A;  4FR7 A;  2ZZI A;  5EH9 A;  3AF5 A;  4D1U A;  4Z5Y A;  1JJT A;  3ESH A;  2GKL A;  4DIK A;  3RKK A;  4O98 A;  3IEM A;  3ZR9 A;  3P2U A;  3BK1 A;  5AXR A;  5ACQ A;  5EWA A;  3PY5 A;  3X2Y A;  1QH3 A;  3DHA A;  4RM5 A;  2P18 A;  4XWT A;  5ACV A;  1VME A;  2BFZ B;  5ACU A;  2R2D A;  3BK2 A;  1DD6 A;  4TZB A;  3S0Z A;  4EXS A;  4C1D A;  5K4N A;  4CHL A;  2BMI A;  2M5D A;  2I7V A;  5B1U A;  3DH8 A;  2WRS A;  1KO2 A;  3WXC A;  2Y87 A;  4NQ4 A;  5IQK A;  3ZNB A;  3F9O A;  4ZNB A;  4Z7R A;  3IE0 A;  3FAI A;  1JT1 A;  4BZ3 A;  4D1T A;  1E5D A;  5K4K A;  2XF4 A;  4F6H A;  2BFK A;  1Y44 A;  2OHI A;  3SRX A;  2OHJ A;  3IEK A;  5KIL A;  3AF6 A;  1YCF A;  1HLK A;  5K0W A;  3SPU A;  2WYM C;  4ZEJ A;  2Q0J A;  3IE2 A;  4FEK A;  2QIN A;  5A87 A;  2YNT A;  4KEP A;  2BR6 A;  3BV6 A;  3I14 A;  2ZWR A;  5HIS A;  5HH4 A;  3G1P A;  2I7X A;  2GFK A;  1YCG A;  5ACP A;  4TYT A;  1KO3 A;  2FU9 A;  5AYA A;  2FHX A;  5LSC A;  4D1V A;  3IOG A;  5A0V A;  1SML A;  2NXA A;  4F6Z A;  1BC2 A;  1DXK A;  4V0H A;  3X2Z A;  1A8T A;  5EW0 A;  5LS3 A;  2DOO A;  4P62 A;  1X8G A;  4EYF A;  1P9E A;  4HL1 A;  4EYL A;  4UWP B;  2YZ3 A;  2P4Z A;  4C1C A;  4EY2 A;  2ZO4 A;  3L6N A;  4UAM A;  4Z60 A;  5EHT A;  3DHC A;  4AWZ A;  5ACW A;  5EVB A;  4TYF A;  2AIO A;  4BP0 A;  5LLD A;  2QDT A;  4EYB A;  4ZO2 A;  2VW8 A;  4C09 A;  5HIQ A;  4AX0 B;  5LCH A;  2BG7 A;  2P97 A;  1WUP A;  4D1W A;  4GYQ A;  4EFZ A;  1ZNB A;  5ACS A;  1L9Y A;  3PY6 A;  2FU8 A;  2BG6 A;  2HB9 A;  2BFZ A;  4C1G A;  4C1F A;  5HIO A;  1YCH A;  3KNR A;  2WHG A;  2DKF A;  4DIL A;  3AJ3 A;  4UWS B;  1BVT A;  5EVK A;  2BTN A;  1WUO A;  3IEL A;  3X2X A;  4B87 A;  4UWO B;  4TZE A;  4TZF A;  5LMC A;  5A0T A;  4U4L A;  1M2X A;  3T3O A;  2BIB A;  3IDZ A;  1XTO A;  5K4M A;  2WYM A;  3H3E A;  4J5H A;  4NQ5 A;  4AWY B;  2XR1 A;  4AX1 B;  1WRA A;  3TP9 A;  2BG2 A;  3I11 A;  4YSB A;  4RL2 A;  3Q6V A;  3I0V A;  5AXO A;  2GMN A;  5AHO A;  4PVT A;  2FU6 A;  3VPE A;  3I15 A;  5A5Z A;  2QED A;  2A7M A;  3X30 A;  3SFP A;  5LE1 A;  2BG8 B;  2FM6 A;  2BGA A;  2OHH A;  4RL0 A;  5B3R A;  4PVO A;  5DPX A;  4J5F A;  3R2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...