5B15A

Crystal structure of metallo-beta-lactamase smb-1 bound to hydrolyzed doripenem
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
259
structure length
259
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSLSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase
publication title Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to Hydrolyzed Doripenem
rcsb
source organism Serratia marcescens
total genus 88
structure length 259
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5b15A00
4D1VA 2M5CA 3H3EA 3BK1A 4LE6A 2BG6A 1DDKA 1ZKPA 5EVDA 4FEKA 2GFKA 1Y44A 5AYAA 2NYPA 5A0VA 1QH5A 5B15A 3QH8A 1WUPA 5LCAA 3FAIA 2P1EA 2BC2A 4TYFA 4TZ9A 3L6NA 4O98A 4Z6XA 4EYBA 5EW0A 5LS3A 5EVKA 2DKFA 2BG8B 4GYUA 4UWSB 4TZBA 4RAWA 2P97A 3DH8A 3KNRA 2BG7A 4BP0A 1WUOA 4YSKA 2ZZIA 2YNVA 5AXRA 4XWWA 3KL7A 5AEBA 1VMEA 2NZEA 3IOFA 4Z60A 4KEQA 2FU6A 5ACWA 2NXAA 2I7TA 1E5DA 1MQOA 2ZO4A 4D1WA 5KIKA 4EY2A 1WRAA 4EYLA 5LM6A 3X2XA 2OHJA 3T3NA 3G1PA 3ADRA 4ZO3A 1BC2A 2WYMC 4YSLA 5LMCA 2WRSA 1L9YA 5ACXA 1HLKA 2WYMA 5ACVA 5A87A 3TP9A 4UAMA 1KR3A 1ZTCA 4C1HA 2BGAA 3Q6VA 4KEPA 5HIPA 4DIKA 2BFKA 4JO0A 3PY6A 5HIOA 2XR1A 2BFZB 4Z67A 4UWPB 4GYQA 1YCFA 5EVBA 1JJEA 1XTOA 4NQ4A 2YNWA 1VGNA 2BR6A 1P9EA 5K4MA 3IE0A 4C1DA 2NZFA 2Y8BA 4B87A 4EYFA 3BK2A 5FQAA 2FK6A 3I13A 1M2XA 2ZWRA 2BIBA 2AZ4A 5IQKA 2FHXA 4F6ZA 3IDZA 4UA4A 5B1UA 1QH3A 4TZEA 4D1TA 5LCHA 4F6HA 5LLDA 3RPCA 4RL2A 4WD6A 2UYXA 5ACPA 1K07A 4UBQA 3F9OA 5HH5A 2YNVB 1X8GA 1VJNA 4RM5A 3P2UA 2GCUA 2OHHA 4GCWA 5EWAA 5FQBA 2I7XA 3I14A 5B3RA 2YCBA 5HISA 3T3OA 2QDSA 4Z5YA 3SBLA 3ZWFA 4C1EA 4EXYA 4UWRB 4PVTA 1YCHA 4J5FA 2FU7A 3T9MA 1A8TA 4NQ5A 2DOOA 1YCGA 3AF5A 1JJTA 4BZ3A 4AWYB 2YZ3A 2WYLA 4J5HA 2ZNBA 1KO2A 1XM8A 2GFJA 4YSBA 4EXSA 2QDTA 4HL2A 3JXPA 5HH4A 3IOGA 4C1FA 5AHRA 2OHIA 4AX1B 5EV8A 3A4YA 1WW1A 1X8HA 3RKKA 5EV6A 2HB9A 5K4KA 5K4NA 3DHAA 2CBNA 5DPXA 3IE1A 1ZNBA 5KILA 3AF6A 3KNSA 2BTNA 4RAMA 3I15A 2YNTA 2BMIA 2Q42A 3I0VA 3ZQ4A 5K0WA 2R2DA 2VW8A 5EH9A 3ZNBA 3IEMA 4XWTA 2FU9A 2XF4A 3X2ZA 4PVOA 4H0DA 4RBSA 2Q0IA 2E7YA 2QJSA 3IELA 3MD7A 4NQ2A 4HKYA 4V0HA 4C09A 1X8IA 3VQZA 4C1CA 3DHCA 4U4LA 4Z5ZA 2AIOA 3IEKA 3AJ3A 2YNUA 3BV6A 3X30A 2Q0JA 4ZNBA 1DXKA 2M5DA 2QINA 3ZR9A 2FHXB 4EFZA 3LVZA 1A7TA 4FSBA 5ACRA 5LSCA 5ACTA 2I7VA 4D1UA 2BG8A 4D02A 3BC2A 4C1GA 2QEDA 5LE1A 3FCZA 1BVTA 5AHOA 2BFLA 5ACUA 3X2YA 2H6AA 4CHLA 2P4ZA 3WXCA 2Q9UA 2WHGA 1BMCA 4AWZA 2GKLA 4XUKA 2P18A 1DD6A 3RKJA 3SFPA 2FU8A 5HIQA 2Y87A 4P62A 5A5ZA 4RL0A 4UWOB 2Y8AA 3SPUA 3IE2A 4NQ6A 3SW3A 5HH6A 4FR7A 3DHBA 3I11A 4Z7RA 5AXOA 5FQCA 2BG2A 5EHTA 2A7MA 2FM6A 1KO3A 3PG4A 3VPEA 3SD9A 1JT1A 3SRXA 4DILA 3R2UA 5ACSA 4ZO2A 5A0TA 5ACQA 3S0ZA 3PY5A 3ESHA 1SMLA 4TZFA 4HL1A 4ZEJA 5LCFA 4AX0B 2BFZA 2GMNA 2YNTB 4AD9A 4TYTA
chains in the Genus database with same CATH superfamily
4D1VA 2M5CA 3H3EA 3BK1A 4LE6A 2BG6A 1DDKA 1ZKPA 5EVDA 4FEKA 2GFKA 1Y44A 5AYAA 2NYPA 5A0VA 1QH5A 5B15A 3QH8A 1WUPA 5LCAA 3FAIA 2P1EA 2BC2A 4TYFA 4TZ9A 3L6NA 4O98A 4Z6XA 4AV7A 4EYBA 5EW0A 5LS3A 5EVKA 2DKFA 2BG8B 4GYUA 4UWSB 4TZBA 4RAWA 2P97A 3DH8A 2CFUA 3KNRA 2BG7A 4BP0A 1WUOA 4YSKA 2ZZIA 2YNVA 5AXRA 4XWWA 3KL7A 5AEBA 4AXHA 1VMEA 2NZEA 3IOFA 4Z60A 4KEQA 2FU6A 5ACWA 2NXAA 2I7TA 1E5DA 1MQOA 2ZO4A 4D1WA 5KIKA 4EY2A 1WRAA 4EYLA 5LM6A 3X2XA 2OHJA 3T3NA 3G1PA 3ADRA 4ZO3A 1BC2A 2WYMC 4YSLA 5LMCA 2WRSA 1L9YA 2CFZA 5ACXA 1HLKA 2WYMA 5ACVA 5A87A 3TP9A 4UAMA 1KR3A 1ZTCA 4C1HA 2BGAA 3Q6VA 4KEPA 5HIPA 4DIKA 2BFKA 4JO0A 3PY6A 5HIOA 2XR1A 2BFZB 4Z67A 4UWPB 4GYQA 1YCFA 5EVBA 1JJEA 1XTOA 4NQ4A 2YNWA 1VGNA 2BR6A 1P9EA 5K4MA 3IE0A 4C1DA 2NZFA 2Y8BA 4B87A 4EYFA 3BK2A 5FQAA 2CG3A 2FK6A 3I13A 1M2XA 2ZWRA 2BIBA 2AZ4A 5IQKA 2FHXA 4F6ZA 3IDZA 4UA4A 5B1UA 1QH3A 4TZEA 4D1TA 5LCHA 4F6HA 5LLDA 3RPCA 4RL2A 4WD6A 2UYXA 5ACPA 1K07A 4UBQA 3F9OA 5HH5A 2YNVB 1X8GA 1VJNA 4RM5A 3P2UA 2GCUA 2OHHA 4GCWA 5EWAA 5FQBA 2I7XA 3I14A 5B3RA 2YCBA 5HISA 3T3OA 2QDSA 4Z5YA 3SBLA 3ZWFA 4C1EA 4EXYA 4UWRB 4PVTA 1YCHA 4J5FA 2FU7A 3T9MA 1A8TA 4NQ5A 2DOOA 1YCGA 2CG2A 3AF5A 1JJTA 4BZ3A 4AWYB 2YZ3A 2WYLA 4J5HA 2ZNBA 1KO2A 1XM8A 2GFJA 4YSBA 4EXSA 2QDTA 4HL2A 3JXPA 2YHEA 5HH4A 3IOGA 4C1FA 5AHRA 2OHIA 4AX1B 5EV8A 5A23A 3A4YA 1WW1A 1X8HA 3RKKA 5EV6A 2HB9A 5K4KA 5K4NA 3DHAA 2CBNA 5DPXA 3IE1A 1ZNBA 5KILA 3AF6A 3KNSA 2BTNA 4PDXA 4RAMA 2YNTA 3I15A 2BMIA 2Q42A 3I0VA 3ZQ4A 5K0WA 2R2DA 2VW8A 5EH9A 3ZNBA 3IEMA 4XWTA 2FU9A 2XF4A 3X2ZA 4PVOA 4H0DA 4RBSA 2Q0IA 2E7YA 2QJSA 3IELA 3MD7A 4NQ2A 4HKYA 4V0HA 4C09A 1X8IA 3VQZA 4C1CA 3DHCA 4U4LA 4Z5ZA 2AIOA 3IEKA 3AJ3A 2YNUA 3BV6A 3X30A 2Q0JA 4ZNBA 1DXKA 2M5DA 2QINA 3ZR9A 2FHXB 4EFZA 3LVZA 1A7TA 4FSBA 5AJLA 5ACRA 5LSCA 5ACTA 2I7VA 4D1UA 2BG8A 4D02A 3BC2A 4C1GA 2QEDA 5LE1A 3FCZA 1BVTA 5AHOA 2BFLA 5ACUA 3X2YA 2H6AA 4CHLA 2P4ZA 3WXCA 2Q9UA 2WHGA 1BMCA 4AWZA 2GKLA 4XUKA 2P18A 1DD6A 3RKJA 3SFPA 2FU8A 5AIJA 5HIQA 2Y87A 4NURA 4P62A 5A5ZA 4RL0A 4UWOB 2Y8AA 3SPUA 3IE2A 4NQ6A 3SW3A 5HH6A 4FR7A 3DHBA 3I11A 4Z7RA 5AXOA 5FQCA 2BG2A 5EHTA 2A7MA 2FM6A 1KO3A 3PG4A 3VPEA 3SD9A 1JT1A 3SRXA 4DILA 3R2UA 5ACSA 4ZO2A 5A0TA 5ACQA 3S0ZA 3PY5A 3ESHA 1SMLA 4TZFA 4HL1A 4ZEJA 5LCFA 4AX0B 2BFZA 2GMNA 2YNTB 4AD9A 4TYTA
chains in the Genus database with same CATH topology
4D1VA 2M5CA 3H3EA 3BK1A 4LE6A 2BG6A 1DDKA 1ZKPA 5EVDA 4FEKA 2GFKA 1Y44A 5AYAA 2NYPA 5A0VA 1QH5A 5B15A 3QH8A 1WUPA 5LCAA 3FAIA 2P1EA 2BC2A 4TYFA 4TZ9A 3L6NA 4O98A 4Z6XA 4EYBA 5EW0A 5LS3A 5EVKA 2DKFA 2BG8B 4GYUA 4UWSB 4TZBA 4RAWA 2P97A 3DH8A 3KNRA 2BG7A 4BP0A 1WUOA 4YSKA 2ZZIA 2YNVA 5AXRA 4XWWA 3KL7A 5AEBA 1VMEA 2NZEA 3IOFA 4Z60A 4KEQA 2FU6A 5ACWA 2NXAA 2I7TA 1E5DA 1MQOA 2ZO4A 4D1WA 5KIKA 4EY2A 1WRAA 4EYLA 5LM6A 3X2XA 2OHJA 3T3NA 3G1PA 3ADRA 4ZO3A 1BC2A 2WYMC 4YSLA 5LMCA 2WRSA 1L9YA 5ACXA 1HLKA 2WYMA 5ACVA 5A87A 3TP9A 4UAMA 1KR3A 1ZTCA 4C1HA 2BGAA 3Q6VA 4KEPA 5HIPA 4DIKA 2BFKA 4JO0A 3PY6A 5HIOA 2XR1A 2BFZB 4Z67A 4UWPB 4GYQA 1YCFA 5EVBA 1JJEA 1XTOA 4NQ4A 2YNWA 1VGNA 2BR6A 1P9EA 5K4MA 3IE0A 4C1DA 2NZFA 2Y8BA 4B87A 4EYFA 3BK2A 5FQAA 2FK6A 3I13A 1M2XA 2ZWRA 2BIBA 2AZ4A 5IQKA 2FHXA 4F6ZA 3IDZA 4UA4A 5B1UA 1QH3A 4TZEA 4D1TA 5LCHA 4F6HA 5LLDA 3RPCA 4RL2A 4WD6A 2UYXA 5ACPA 1K07A 4UBQA 3F9OA 5HH5A 2YNVB 1X8GA 1VJNA 4RM5A 3P2UA 2GCUA 2OHHA 4GCWA 5EWAA 5FQBA 2I7XA 3I14A 5B3RA 2YCBA 5HISA 3T3OA 2QDSA 4Z5YA 3SBLA 3ZWFA 4C1EA 4EXYA 4UWRB 4PVTA 1YCHA 4J5FA 2FU7A 3T9MA 1A8TA 4NQ5A 2DOOA 1YCGA 3AF5A 1JJTA 4BZ3A 4AWYB 2YZ3A 2WYLA 4J5HA 2ZNBA 1KO2A 1XM8A 2GFJA 4YSBA 4EXSA 2QDTA 4HL2A 3JXPA 5HH4A 3IOGA 4C1FA 5AHRA 2OHIA 4AX1B 5EV8A 3A4YA 1WW1A 1X8HA 3RKKA 5EV6A 2HB9A 5K4KA 5K4NA 3DHAA 2CBNA 5DPXA 3IE1A 1ZNBA 5KILA 3AF6A 3KNSA 2BTNA 4RAMA 3I15A 2YNTA 2BMIA 2Q42A 3I0VA 3ZQ4A 5K0WA 2R2DA 2VW8A 5EH9A 3ZNBA 3IEMA 4XWTA 2FU9A 2XF4A 3X2ZA 4PVOA 4H0DA 4RBSA 2Q0IA 2E7YA 2QJSA 3IELA 3MD7A 4NQ2A 4HKYA 4V0HA 4C09A 1X8IA 3VQZA 4C1CA 3DHCA 4U4LA 4Z5ZA 2AIOA 3IEKA 3AJ3A 2YNUA 3BV6A 3X30A 2Q0JA 4ZNBA 1DXKA 2M5DA 2QINA 3ZR9A 2FHXB 4EFZA 3LVZA 1A7TA 4FSBA 5ACRA 5LSCA 5ACTA 2I7VA 4D1UA 2BG8A 4D02A 3BC2A 4C1GA 2QEDA 5LE1A 3FCZA 1BVTA 5AHOA 2BFLA 5ACUA 3X2YA 2H6AA 4CHLA 2P4ZA 3WXCA 2Q9UA 2WHGA 1BMCA 4AWZA 2GKLA 4XUKA 2P18A 1DD6A 3RKJA 3SFPA 2FU8A 5HIQA 2Y87A 4P62A 5A5ZA 4RL0A 4UWOB 2Y8AA 3SPUA 3IE2A 4NQ6A 3SW3A 5HH6A 4FR7A 3DHBA 3I11A 4Z7RA 5AXOA 5FQCA 2BG2A 5EHTA 2A7MA 2FM6A 1KO3A 3PG4A 3VPEA 3SD9A 1JT1A 3SRXA 4DILA 3R2UA 5ACSA 4ZO2A 5A0TA 5ACQA 3S0ZA 3PY5A 3ESHA 1SMLA 4TZFA 4HL1A 4ZEJA 5LCFA 4AX0B 2BFZA 2GMNA 2YNTB 4AD9A 4TYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D1V A;  2M5C A;  3H3E A;  3BK1 A;  4LE6 A;  2BG6 A;  1DDK A;  1ZKP A;  5EVD A;  4FEK A;  2GFK A;  1Y44 A;  5AYA A;  2NYP A;  5A0V A;  1QH5 A;  5B15 A;  3QH8 A;  1WUP A;  5LCA A;  3FAI A;  2P1E A;  2BC2 A;  4TYF A;  4TZ9 A;  3L6N A;  4O98 A;  4Z6X A;  4EYB A;  5EW0 A;  5LS3 A;  5EVK A;  2DKF A;  2BG8 B;  4GYU A;  4UWS B;  4TZB A;  4RAW A;  2P97 A;  3DH8 A;  3KNR A;  2BG7 A;  4BP0 A;  1WUO A;  4YSK A;  2ZZI A;  2YNV A;  5AXR A;  4XWW A;  3KL7 A;  5AEB A;  1VME A;  2NZE A;  3IOF A;  4Z60 A;  4KEQ A;  2FU6 A;  5ACW A;  2NXA A;  2I7T A;  1E5D A;  1MQO A;  2ZO4 A;  4D1W A;  5KIK A;  4EY2 A;  1WRA A;  4EYL A;  5LM6 A;  3X2X A;  2OHJ A;  3T3N A;  3G1P A;  3ADR A;  4ZO3 A;  1BC2 A;  2WYM C;  4YSL A;  5LMC A;  2WRS A;  1L9Y A;  5ACX A;  1HLK A;  2WYM A;  5ACV A;  5A87 A;  3TP9 A;  4UAM A;  1KR3 A;  1ZTC A;  4C1H A;  2BGA A;  3Q6V A;  4KEP A;  5HIP A;  4DIK A;  2BFK A;  4JO0 A;  3PY6 A;  5HIO A;  2XR1 A;  2BFZ B;  4Z67 A;  4UWP B;  4GYQ A;  1YCF A;  5EVB A;  1JJE A;  1XTO A;  4NQ4 A;  2YNW A;  1VGN A;  2BR6 A;  1P9E A;  5K4M A;  3IE0 A;  4C1D A;  2NZF A;  2Y8B A;  4B87 A;  4EYF A;  3BK2 A;  5FQA A;  2FK6 A;  3I13 A;  1M2X A;  2ZWR A;  2BIB A;  2AZ4 A;  5IQK A;  2FHX A;  4F6Z A;  3IDZ A;  4UA4 A;  5B1U A;  1QH3 A;  4TZE A;  4D1T A;  5LCH A;  4F6H A;  5LLD A;  3RPC A;  4RL2 A;  4WD6 A;  2UYX A;  5ACP A;  1K07 A;  4UBQ A;  3F9O A;  5HH5 A;  2YNV B;  1X8G A;  1VJN A;  4RM5 A;  3P2U A;  2GCU A;  2OHH A;  4GCW A;  5EWA A;  5FQB A;  2I7X A;  3I14 A;  5B3R A;  2YCB A;  5HIS A;  3T3O A;  2QDS A;  4Z5Y A;  3SBL A;  3ZWF A;  4C1E A;  4EXY A;  4UWR B;  4PVT A;  1YCH A;  4J5F A;  2FU7 A;  3T9M A;  1A8T A;  4NQ5 A;  2DOO A;  1YCG A;  3AF5 A;  1JJT A;  4BZ3 A;  4AWY B;  2YZ3 A;  2WYL A;  4J5H A;  2ZNB A;  1KO2 A;  1XM8 A;  2GFJ A;  4YSB A;  4EXS A;  2QDT A;  4HL2 A;  3JXP A;  5HH4 A;  3IOG A;  4C1F A;  5AHR A;  2OHI A;  4AX1 B;  5EV8 A;  3A4Y A;  1WW1 A;  1X8H A;  3RKK A;  5EV6 A;  2HB9 A;  5K4K A;  5K4N A;  3DHA A;  2CBN A;  5DPX A;  3IE1 A;  1ZNB A;  5KIL A;  3AF6 A;  3KNS A;  2BTN A;  4RAM A;  3I15 A;  2YNT A;  2BMI A;  2Q42 A;  3I0V A;  3ZQ4 A;  5K0W A;  2R2D A;  2VW8 A;  5EH9 A;  3ZNB A;  3IEM A;  4XWT A;  2FU9 A;  2XF4 A;  3X2Z A;  4PVO A;  4H0D A;  4RBS A;  2Q0I A;  2E7Y A;  2QJS A;  3IEL A;  3MD7 A;  4NQ2 A;  4HKY A;  4V0H A;  4C09 A;  1X8I A;  3VQZ A;  4C1C A;  3DHC A;  4U4L A;  4Z5Z A;  2AIO A;  3IEK A;  3AJ3 A;  2YNU A;  3BV6 A;  3X30 A;  2Q0J A;  4ZNB A;  1DXK A;  2M5D A;  2QIN A;  3ZR9 A;  2FHX B;  4EFZ A;  3LVZ A;  1A7T A;  4FSB A;  5ACR A;  5LSC A;  5ACT A;  2I7V A;  4D1U A;  2BG8 A;  4D02 A;  3BC2 A;  4C1G A;  2QED A;  5LE1 A;  3FCZ A;  1BVT A;  5AHO A;  2BFL A;  5ACU A;  3X2Y A;  2H6A A;  4CHL A;  2P4Z A;  3WXC A;  2Q9U A;  2WHG A;  1BMC A;  4AWZ A;  2GKL A;  4XUK A;  2P18 A;  1DD6 A;  3RKJ A;  3SFP A;  2FU8 A;  5HIQ A;  2Y87 A;  4P62 A;  5A5Z A;  4RL0 A;  4UWO B;  2Y8A A;  3SPU A;  3IE2 A;  4NQ6 A;  3SW3 A;  5HH6 A;  4FR7 A;  3DHB A;  3I11 A;  4Z7R A;  5AXO A;  5FQC A;  2BG2 A;  5EHT A;  2A7M A;  2FM6 A;  1KO3 A;  3PG4 A;  3VPE A;  3SD9 A;  1JT1 A;  3SRX A;  4DIL A;  3R2U A;  5ACS A;  4ZO2 A;  5A0T A;  5ACQ A;  3S0Z A;  3PY5 A;  3ESH A;  1SML A;  4TZF A;  4HL1 A;  4ZEJ A;  5LCF A;  4AX0 B;  2BFZ A;  2GMN A;  2YNT B;  4AD9 A;  4TYT A; 
#chains in the Genus database with same CATH topology
 4D1V A;  2M5C A;  3H3E A;  3BK1 A;  4LE6 A;  2BG6 A;  1DDK A;  1ZKP A;  5EVD A;  4FEK A;  2GFK A;  1Y44 A;  5AYA A;  2NYP A;  5A0V A;  1QH5 A;  5B15 A;  3QH8 A;  1WUP A;  5LCA A;  3FAI A;  2P1E A;  2BC2 A;  4TYF A;  4TZ9 A;  3L6N A;  4O98 A;  4Z6X A;  4AV7 A;  4EYB A;  5EW0 A;  5LS3 A;  5EVK A;  2DKF A;  2BG8 B;  4GYU A;  4UWS B;  4TZB A;  4RAW A;  2P97 A;  3DH8 A;  2CFU A;  3KNR A;  2BG7 A;  4BP0 A;  1WUO A;  4YSK A;  2ZZI A;  2YNV A;  5AXR A;  4XWW A;  3KL7 A;  5AEB A;  4AXH A;  1VME A;  2NZE A;  3IOF A;  4Z60 A;  4KEQ A;  2FU6 A;  5ACW A;  2NXA A;  2I7T A;  1E5D A;  1MQO A;  2ZO4 A;  4D1W A;  5KIK A;  4EY2 A;  1WRA A;  4EYL A;  5LM6 A;  3X2X A;  2OHJ A;  3T3N A;  3G1P A;  3ADR A;  4ZO3 A;  1BC2 A;  2WYM C;  4YSL A;  5LMC A;  2WRS A;  1L9Y A;  2CFZ A;  5ACX A;  1HLK A;  2WYM A;  5ACV A;  5A87 A;  3TP9 A;  4UAM A;  1KR3 A;  1ZTC A;  4C1H A;  2BGA A;  3Q6V A;  4KEP A;  5HIP A;  4DIK A;  2BFK A;  4JO0 A;  3PY6 A;  5HIO A;  2XR1 A;  2BFZ B;  4Z67 A;  4UWP B;  4GYQ A;  1YCF A;  5EVB A;  1JJE A;  1XTO A;  4NQ4 A;  2YNW A;  1VGN A;  2BR6 A;  1P9E A;  5K4M A;  3IE0 A;  4C1D A;  2NZF A;  2Y8B A;  4B87 A;  4EYF A;  3BK2 A;  5FQA A;  2CG3 A;  2FK6 A;  3I13 A;  1M2X A;  2ZWR A;  2BIB A;  2AZ4 A;  5IQK A;  2FHX A;  4F6Z A;  3IDZ A;  4UA4 A;  5B1U A;  1QH3 A;  4TZE A;  4D1T A;  5LCH A;  4F6H A;  5LLD A;  3RPC A;  4RL2 A;  4WD6 A;  2UYX A;  5ACP A;  1K07 A;  4UBQ A;  3F9O A;  5HH5 A;  2YNV B;  1X8G A;  1VJN A;  4RM5 A;  3P2U A;  2GCU A;  2OHH A;  4GCW A;  5EWA A;  5FQB A;  2I7X A;  3I14 A;  5B3R A;  2YCB A;  5HIS A;  3T3O A;  2QDS A;  4Z5Y A;  3SBL A;  3ZWF A;  4C1E A;  4EXY A;  4UWR B;  4PVT A;  1YCH A;  4J5F A;  2FU7 A;  3T9M A;  1A8T A;  4NQ5 A;  2DOO A;  1YCG A;  2CG2 A;  3AF5 A;  1JJT A;  4BZ3 A;  4AWY B;  2YZ3 A;  2WYL A;  4J5H A;  2ZNB A;  1KO2 A;  1XM8 A;  2GFJ A;  4YSB A;  4EXS A;  2QDT A;  4HL2 A;  3JXP A;  2YHE A;  5HH4 A;  3IOG A;  4C1F A;  5AHR A;  2OHI A;  4AX1 B;  5EV8 A;  5A23 A;  3A4Y A;  1WW1 A;  1X8H A;  3RKK A;  5EV6 A;  2HB9 A;  5K4K A;  5K4N A;  3DHA A;  2CBN A;  5DPX A;  3IE1 A;  1ZNB A;  5KIL A;  3AF6 A;  3KNS A;  2BTN A;  4PDX A;  4RAM A;  2YNT A;  3I15 A;  2BMI A;  2Q42 A;  3I0V A;  3ZQ4 A;  5K0W A;  2R2D A;  2VW8 A;  5EH9 A;  3ZNB A;  3IEM A;  4XWT A;  2FU9 A;  2XF4 A;  3X2Z A;  4PVO A;  4H0D A;  4RBS A;  2Q0I A;  2E7Y A;  2QJS A;  3IEL A;  3MD7 A;  4NQ2 A;  4HKY A;  4V0H A;  4C09 A;  1X8I A;  3VQZ A;  4C1C A;  3DHC A;  4U4L A;  4Z5Z A;  2AIO A;  3IEK A;  3AJ3 A;  2YNU A;  3BV6 A;  3X30 A;  2Q0J A;  4ZNB A;  1DXK A;  2M5D A;  2QIN A;  3ZR9 A;  2FHX B;  4EFZ A;  3LVZ A;  1A7T A;  4FSB A;  5AJL A;  5ACR A;  5LSC A;  5ACT A;  2I7V A;  4D1U A;  2BG8 A;  4D02 A;  3BC2 A;  4C1G A;  2QED A;  5LE1 A;  3FCZ A;  1BVT A;  5AHO A;  2BFL A;  5ACU A;  3X2Y A;  2H6A A;  4CHL A;  2P4Z A;  3WXC A;  2Q9U A;  2WHG A;  1BMC A;  4AWZ A;  2GKL A;  4XUK A;  2P18 A;  1DD6 A;  3RKJ A;  3SFP A;  2FU8 A;  5AIJ A;  5HIQ A;  2Y87 A;  4NUR A;  4P62 A;  5A5Z A;  4RL0 A;  4UWO B;  2Y8A A;  3SPU A;  3IE2 A;  4NQ6 A;  3SW3 A;  5HH6 A;  4FR7 A;  3DHB A;  3I11 A;  4Z7R A;  5AXO A;  5FQC A;  2BG2 A;  5EHT A;  2A7M A;  2FM6 A;  1KO3 A;  3PG4 A;  3VPE A;  3SD9 A;  1JT1 A;  3SRX A;  4DIL A;  3R2U A;  5ACS A;  4ZO2 A;  5A0T A;  5ACQ A;  3S0Z A;  3PY5 A;  3ESH A;  1SML A;  4TZF A;  4HL1 A;  4ZEJ A;  5LCF A;  4AX0 B;  2BFZ A;  2GMN A;  2YNT B;  4AD9 A;  4TYT A; 
#chains in the Genus database with same CATH homology
 4D1V A;  2M5C A;  3H3E A;  3BK1 A;  4LE6 A;  2BG6 A;  1DDK A;  1ZKP A;  5EVD A;  4FEK A;  2GFK A;  1Y44 A;  5AYA A;  2NYP A;  5A0V A;  1QH5 A;  5B15 A;  3QH8 A;  1WUP A;  5LCA A;  3FAI A;  2P1E A;  2BC2 A;  4TYF A;  4TZ9 A;  3L6N A;  4O98 A;  4Z6X A;  4EYB A;  5EW0 A;  5LS3 A;  5EVK A;  2DKF A;  2BG8 B;  4GYU A;  4UWS B;  4TZB A;  4RAW A;  2P97 A;  3DH8 A;  3KNR A;  2BG7 A;  4BP0 A;  1WUO A;  4YSK A;  2ZZI A;  2YNV A;  5AXR A;  4XWW A;  3KL7 A;  5AEB A;  1VME A;  2NZE A;  3IOF A;  4Z60 A;  4KEQ A;  2FU6 A;  5ACW A;  2NXA A;  2I7T A;  1E5D A;  1MQO A;  2ZO4 A;  4D1W A;  5KIK A;  4EY2 A;  1WRA A;  4EYL A;  5LM6 A;  3X2X A;  2OHJ A;  3T3N A;  3G1P A;  3ADR A;  4ZO3 A;  1BC2 A;  2WYM C;  4YSL A;  5LMC A;  2WRS A;  1L9Y A;  5ACX A;  1HLK A;  2WYM A;  5ACV A;  5A87 A;  3TP9 A;  4UAM A;  1KR3 A;  1ZTC A;  4C1H A;  2BGA A;  3Q6V A;  4KEP A;  5HIP A;  4DIK A;  2BFK A;  4JO0 A;  3PY6 A;  5HIO A;  2XR1 A;  2BFZ B;  4Z67 A;  4UWP B;  4GYQ A;  1YCF A;  5EVB A;  1JJE A;  1XTO A;  4NQ4 A;  2YNW A;  1VGN A;  2BR6 A;  1P9E A;  5K4M A;  3IE0 A;  4C1D A;  2NZF A;  2Y8B A;  4B87 A;  4EYF A;  3BK2 A;  5FQA A;  2FK6 A;  3I13 A;  1M2X A;  2ZWR A;  2BIB A;  2AZ4 A;  5IQK A;  2FHX A;  4F6Z A;  3IDZ A;  4UA4 A;  5B1U A;  1QH3 A;  4TZE A;  4D1T A;  5LCH A;  4F6H A;  5LLD A;  3RPC A;  4RL2 A;  4WD6 A;  2UYX A;  5ACP A;  1K07 A;  4UBQ A;  3F9O A;  5HH5 A;  2YNV B;  1X8G A;  1VJN A;  4RM5 A;  3P2U A;  2GCU A;  2OHH A;  4GCW A;  5EWA A;  5FQB A;  2I7X A;  3I14 A;  5B3R A;  2YCB A;  5HIS A;  3T3O A;  2QDS A;  4Z5Y A;  3SBL A;  3ZWF A;  4C1E A;  4EXY A;  4UWR B;  4PVT A;  1YCH A;  4J5F A;  2FU7 A;  3T9M A;  1A8T A;  4NQ5 A;  2DOO A;  1YCG A;  3AF5 A;  1JJT A;  4BZ3 A;  4AWY B;  2YZ3 A;  2WYL A;  4J5H A;  2ZNB A;  1KO2 A;  1XM8 A;  2GFJ A;  4YSB A;  4EXS A;  2QDT A;  4HL2 A;  3JXP A;  5HH4 A;  3IOG A;  4C1F A;  5AHR A;  2OHI A;  4AX1 B;  5EV8 A;  3A4Y A;  1WW1 A;  1X8H A;  3RKK A;  5EV6 A;  2HB9 A;  5K4K A;  5K4N A;  3DHA A;  2CBN A;  5DPX A;  3IE1 A;  1ZNB A;  5KIL A;  3AF6 A;  3KNS A;  2BTN A;  4RAM A;  3I15 A;  2YNT A;  2BMI A;  2Q42 A;  3I0V A;  3ZQ4 A;  5K0W A;  2R2D A;  2VW8 A;  5EH9 A;  3ZNB A;  3IEM A;  4XWT A;  2FU9 A;  2XF4 A;  3X2Z A;  4PVO A;  4H0D A;  4RBS A;  2Q0I A;  2E7Y A;  2QJS A;  3IEL A;  3MD7 A;  4NQ2 A;  4HKY A;  4V0H A;  4C09 A;  1X8I A;  3VQZ A;  4C1C A;  3DHC A;  4U4L A;  4Z5Z A;  2AIO A;  3IEK A;  3AJ3 A;  2YNU A;  3BV6 A;  3X30 A;  2Q0J A;  4ZNB A;  1DXK A;  2M5D A;  2QIN A;  3ZR9 A;  2FHX B;  4EFZ A;  3LVZ A;  1A7T A;  4FSB A;  5ACR A;  5LSC A;  5ACT A;  2I7V A;  4D1U A;  2BG8 A;  4D02 A;  3BC2 A;  4C1G A;  2QED A;  5LE1 A;  3FCZ A;  1BVT A;  5AHO A;  2BFL A;  5ACU A;  3X2Y A;  2H6A A;  4CHL A;  2P4Z A;  3WXC A;  2Q9U A;  2WHG A;  1BMC A;  4AWZ A;  2GKL A;  4XUK A;  2P18 A;  1DD6 A;  3RKJ A;  3SFP A;  2FU8 A;  5HIQ A;  2Y87 A;  4P62 A;  5A5Z A;  4RL0 A;  4UWO B;  2Y8A A;  3SPU A;  3IE2 A;  4NQ6 A;  3SW3 A;  5HH6 A;  4FR7 A;  3DHB A;  3I11 A;  4Z7R A;  5AXO A;  5FQC A;  2BG2 A;  5EHT A;  2A7M A;  2FM6 A;  1KO3 A;  3PG4 A;  3VPE A;  3SD9 A;  1JT1 A;  3SRX A;  4DIL A;  3R2U A;  5ACS A;  4ZO2 A;  5A0T A;  5ACQ A;  3S0Z A;  3PY5 A;  3ESH A;  1SML A;  4TZF A;  4HL1 A;  4ZEJ A;  5LCF A;  4AX0 B;  2BFZ A;  2GMN A;  2YNT B;  4AD9 A;  4TYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...