4F6HA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
233
structure length
223
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 57
structure length 223
sequence length 233
ec nomenclature
pdb deposition date 2012-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6hA00
1ZTCA 4KEQA 2BG2A 4EFZA 1WRAA 1ZNBA 2BGAA 5LE1A 1BMCA 3H3EA 4FEKA 4DILA 3LVZA 2M5CA 3P2UA 1KO3A 3DH8A 3ZWFA 5ACWA 5HH4A 5LCAA 5EW0A 2BG8A 3PY6A 2I7XA 4FR7A 1YCHA 2YNVA 2YNUA 2ZO4A 5HH6A 5ACTA 4XWTA 5FQCA 3F9OA 4UAMA 2BC2A 2ZNBA 4AX0B 2E7YA 5LSCA 2WYLA 5HIOA 3RKKA 3BV6A 5KILA 3IDZA 4XWWA 4ZEJA 3ZQ4A 2YNWA 4TZ9A 3VQZA 2DOOA 4TZBA 4WD6A 1A8TA 2HB9A 5LS3A 2Q9UA 4U4LA 4C09A 2NYPA 4GYUA 4TYTA 5B3RA 5LCFA 3KNSA 2I7TA 2QDSA 4FSBA 2P4ZA 2YNTA 4JO0A 3Q6VA 3JXPA 2BG7A 3X2XA 4J5FA 3DHAA 5FQBA 2OHHA 5IQKA 1A7TA 1X8IA 1JJEA 3L6NA 4C1CA 4UWOB 2BFZA 4XUKA 4RAWA 2BMIA 4C1HA 1ZKPA 4UWRB 4TYFA 2WRSA 4C1EA 2P18A 2M5DA 3FCZA 4RL2A 1WUOA 3SPUA 4J5HA 3TP9A 2Q0IA 4NQ5A 2BG6A 2Y87A 2BIBA 2GCUA 2NZEA 3IEMA 4YSBA 2AIOA 3S0ZA 3IOGA 4UA4A 2Y8BA 4GCWA 4F6ZA 5EH9A 2GMNA 2BTNA 1P9EA 5LMCA 4NQ2A 1X8GA 4O98A 5EV6A 4RAMA 2R2DA 5HIQA 3ZR9A 2WYMA 4BP0A 2DKFA 4D1VA 1KO2A 4ZO3A 2XF4A 2Q42A 2FU9A 3IOFA 1XTOA 3SBLA 4C1FA 2FK6A 2YCBA 2P97A 5ACPA 4YSKA 5ACVA 1DDKA 4AWYB 3PG4A 3ADRA 4EY2A 2P1EA 2YZ3A 3IEKA 4HKYA 1YCGA 2QEDA 4EYFA 3BC2A 3DHBA 3AJ3A 5DPXA 4Z67A 5EV8A 4RL0A 2CBNA 4NQ4A 1QH5A 4D1UA 4CHLA 3I15A 1L9YA 5AXRA 3T9MA 5ACXA 4ZNBA 3R2UA 2GFKA 3BK1A 1JT1A 1WW1A 4UWSB 4AD9A 2GKLA 5ACSA 1QH3A 4EYBA 5ACQA 3I13A 5EVBA 5KIKA 2FHXB 5LCHA 4KEPA 4EYLA 3SFPA 5ACUA 4EXSA 2QJSA 4NQ6A 2QDTA 1Y44A 3X30A 3KL7A 1VMEA 5K4NA 5ACRA 2I7VA 4TZFA 3IE2A 3IE0A 5K0WA 3MD7A 3X2ZA 1MQOA 1E5DA 3ESHA 5A0TA 2VW8A 3T3OA 3SW3A 4HL2A 4H0DA 3X2YA 3I11A 2Q0JA 4P62A 3SD9A 5AYAA 3SRXA 3A4YA 3I14A 2A7MA 4C1DA 2H6AA 4Z6XA 4DIKA 2BR6A 3G1PA 3IELA 2BFKA 3RPCA 1WUPA 1K07A 4YSLA 3KNRA 4Z5YA 2BFLA 2WHGA 4LE6A 3QH8A 2OHJA 5AHOA 4Z60A 5AHRA 2FU7A 4GYQA 4UBQA 4D1TA 3AF6A 4AWZA 1XM8A 1KR3A 3FAIA 4V0HA 3T3NA 2FM6A 5HH5A 3ZNBA 4RM5A 4BZ3A 1HLKA 3VPEA 2FU6A 3RKJA 5AEBA 5A5ZA 2ZZIA 4PVOA 1DXKA 2BG8B 2WYMC 4C1GA 3WXCA 5B15A 2YNVB 1M2XA 4B87A 4D1WA 5K4KA 1VJNA 2NXAA 2AZ4A 4ZO2A 4TZEA 3DHCA 4UWPB 3BK2A 2XR1A 4F6HA 4RBSA 4D02A 5FQAA 4HL1A 4Z7RA 4PVTA 3IE1A 5HIPA 3I0VA 1BVTA 1SMLA 5A87A 5LLDA 2FHXA 4AX1B 5K4MA 1DD6A 1VGNA 2OHIA 5HISA 5LM6A 5EVDA 2ZWRA 4Z5ZA 2YNTB 1BC2A 5A0VA 2FU8A 2Y8AA 1X8HA 4EXYA 5B1UA 2BFZB 1YCFA 2QINA 5EVKA 2UYXA 3AF5A 5AXOA 1JJTA 2NZFA 5EHTA 2GFJA 5EWAA 3PY5A
chains in the Genus database with same CATH superfamily
1ZTCA 4KEQA 2BG2A 4EFZA 1WRAA 1ZNBA 2BGAA 5LE1A 1BMCA 3H3EA 4FEKA 4DILA 3LVZA 2M5CA 3P2UA 1KO3A 3DH8A 3ZWFA 5ACWA 2YHEA 5HH4A 5LCAA 5EW0A 2BG8A 3PY6A 2I7XA 4FR7A 1YCHA 2YNVA 2YNUA 2ZO4A 5HH6A 4AXHA 5ACTA 4XWTA 5FQCA 3F9OA 5AJLA 4PDXA 4UAMA 2BC2A 2ZNBA 4AX0B 2E7YA 5LSCA 2WYLA 5HIOA 3RKKA 3BV6A 5KILA 3IDZA 4XWWA 4ZEJA 4AV7A 3ZQ4A 2YNWA 4TZ9A 3VQZA 2DOOA 4TZBA 4WD6A 1A8TA 2HB9A 5LS3A 2Q9UA 4U4LA 4C09A 2NYPA 4GYUA 4TYTA 5B3RA 5LCFA 3KNSA 2I7TA 2QDSA 4FSBA 2P4ZA 2YNTA 4JO0A 3Q6VA 3JXPA 2BG7A 3X2XA 4J5FA 3DHAA 5FQBA 2OHHA 5IQKA 1A7TA 1X8IA 1JJEA 3L6NA 4C1CA 4UWOB 2BFZA 4XUKA 4RAWA 2BMIA 4C1HA 1ZKPA 4UWRB 5AIJA 4TYFA 2WRSA 4C1EA 2P18A 2M5DA 3FCZA 4RL2A 1WUOA 3SPUA 4J5HA 3TP9A 2Q0IA 4NQ5A 2BG6A 2Y87A 2BIBA 2GCUA 2NZEA 3IEMA 4YSBA 2AIOA 3S0ZA 3IOGA 4UA4A 2Y8BA 4GCWA 4F6ZA 5EH9A 2GMNA 2BTNA 1P9EA 5LMCA 4NQ2A 2CG2A 1X8GA 4O98A 5EV6A 4RAMA 2R2DA 5HIQA 3ZR9A 2WYMA 4BP0A 2DKFA 4D1VA 1KO2A 4ZO3A 2XF4A 2Q42A 2FU9A 3IOFA 1XTOA 3SBLA 4C1FA 2FK6A 2YCBA 2P97A 5ACPA 4YSKA 5ACVA 1DDKA 4AWYB 3PG4A 3ADRA 4EY2A 2P1EA 2YZ3A 3IEKA 4HKYA 1YCGA 2QEDA 5A23A 4EYFA 3BC2A 3DHBA 3AJ3A 5DPXA 4Z67A 5EV8A 4RL0A 2CBNA 4NQ4A 1QH5A 4D1UA 4CHLA 3I15A 1L9YA 5AXRA 3T9MA 5ACXA 4NURA 4ZNBA 3R2UA 2GFKA 3BK1A 1JT1A 1WW1A 4UWSB 4AD9A 2GKLA 5ACSA 1QH3A 4EYBA 5ACQA 3I13A 5EVBA 5KIKA 2FHXB 5LCHA 4KEPA 4EYLA 3SFPA 5ACUA 4EXSA 2QJSA 4NQ6A 2QDTA 1Y44A 3X30A 3KL7A 1VMEA 5K4NA 5ACRA 2CFZA 2I7VA 4TZFA 3IE2A 3IE0A 5K0WA 3MD7A 3X2ZA 1MQOA 1E5DA 3ESHA 5A0TA 2VW8A 3T3OA 3SW3A 4HL2A 4H0DA 3X2YA 3I11A 2Q0JA 4P62A 3SD9A 5AYAA 3SRXA 3A4YA 3I14A 2A7MA 4C1DA 2H6AA 4Z6XA 2BR6A 3G1PA 3IELA 3RPCA 2BFKA 4DIKA 1WUPA 1K07A 4YSLA 3KNRA 4Z5YA 2BFLA 2WHGA 4LE6A 3QH8A 2OHJA 5AHOA 4Z60A 5AHRA 2FU7A 4GYQA 4UBQA 4D1TA 3AF6A 4AWZA 1XM8A 1KR3A 3FAIA 4V0HA 3T3NA 2FM6A 5HH5A 3ZNBA 4RM5A 4BZ3A 1HLKA 3VPEA 2FU6A 3RKJA 5AEBA 5A5ZA 2ZZIA 4PVOA 1DXKA 2BG8B 2WYMC 4C1GA 3WXCA 5B15A 2YNVB 1M2XA 4B87A 4D1WA 5K4KA 1VJNA 2NXAA 2AZ4A 4ZO2A 4TZEA 3DHCA 4UWPB 3BK2A 2XR1A 4F6HA 4RBSA 4D02A 5FQAA 4HL1A 4Z7RA 4PVTA 3IE1A 5HIPA 3I0VA 1BVTA 1SMLA 5A87A 5LLDA 2FHXA 4AX1B 5K4MA 1DD6A 1VGNA 2OHIA 5HISA 5LM6A 5EVDA 2ZWRA 4Z5ZA 2YNTB 1BC2A 5A0VA 2FU8A 2CG3A 2Y8AA 1X8HA 4EXYA 5B1UA 2BFZB 1YCFA 2QINA 5EVKA 2UYXA 3AF5A 5AXOA 1JJTA 2NZFA 2CFUA 5EHTA 2GFJA 5EWAA 3PY5A
chains in the Genus database with same CATH topology
1ZTCA 4KEQA 2BG2A 4EFZA 1WRAA 1ZNBA 2BGAA 5LE1A 1BMCA 3H3EA 4FEKA 4DILA 3LVZA 2M5CA 3P2UA 1KO3A 3DH8A 3ZWFA 5ACWA 5HH4A 5LCAA 5EW0A 2BG8A 3PY6A 2I7XA 4FR7A 1YCHA 2YNVA 2YNUA 2ZO4A 5HH6A 5ACTA 4XWTA 5FQCA 3F9OA 4UAMA 2BC2A 2ZNBA 4AX0B 2E7YA 5LSCA 2WYLA 5HIOA 3RKKA 3BV6A 5KILA 3IDZA 4XWWA 4ZEJA 3ZQ4A 2YNWA 4TZ9A 3VQZA 2DOOA 4TZBA 4WD6A 1A8TA 2HB9A 5LS3A 2Q9UA 4U4LA 4C09A 2NYPA 4GYUA 4TYTA 5B3RA 5LCFA 3KNSA 2I7TA 2QDSA 4FSBA 2P4ZA 2YNTA 4JO0A 3Q6VA 3JXPA 2BG7A 3X2XA 4J5FA 3DHAA 5FQBA 2OHHA 5IQKA 1A7TA 1X8IA 1JJEA 3L6NA 4C1CA 4UWOB 2BFZA 4XUKA 4RAWA 2BMIA 4C1HA 1ZKPA 4UWRB 4TYFA 2WRSA 4C1EA 2P18A 2M5DA 3FCZA 4RL2A 1WUOA 3SPUA 4J5HA 3TP9A 2Q0IA 4NQ5A 2BG6A 2Y87A 2BIBA 2GCUA 2NZEA 3IEMA 4YSBA 2AIOA 3S0ZA 3IOGA 4UA4A 2Y8BA 4GCWA 4F6ZA 5EH9A 2GMNA 2BTNA 1P9EA 5LMCA 4NQ2A 1X8GA 4O98A 5EV6A 4RAMA 2R2DA 5HIQA 3ZR9A 2WYMA 4BP0A 2DKFA 4D1VA 1KO2A 4ZO3A 2XF4A 2Q42A 2FU9A 3IOFA 1XTOA 3SBLA 4C1FA 2FK6A 2YCBA 2P97A 5ACPA 4YSKA 5ACVA 1DDKA 4AWYB 3PG4A 3ADRA 4EY2A 2P1EA 2YZ3A 3IEKA 4HKYA 1YCGA 2QEDA 4EYFA 3BC2A 3DHBA 3AJ3A 5DPXA 4Z67A 5EV8A 4RL0A 2CBNA 4NQ4A 1QH5A 4D1UA 4CHLA 3I15A 1L9YA 5AXRA 3T9MA 5ACXA 4ZNBA 3R2UA 2GFKA 3BK1A 1JT1A 1WW1A 4UWSB 4AD9A 2GKLA 5ACSA 1QH3A 4EYBA 5ACQA 3I13A 5EVBA 5KIKA 2FHXB 5LCHA 4KEPA 4EYLA 3SFPA 5ACUA 4EXSA 2QJSA 4NQ6A 2QDTA 1Y44A 3X30A 3KL7A 1VMEA 5K4NA 5ACRA 2I7VA 4TZFA 3IE2A 3IE0A 5K0WA 3MD7A 3X2ZA 1MQOA 1E5DA 3ESHA 5A0TA 2VW8A 3T3OA 3SW3A 4HL2A 4H0DA 3X2YA 3I11A 2Q0JA 4P62A 3SD9A 5AYAA 3SRXA 3A4YA 3I14A 2A7MA 4C1DA 2H6AA 4Z6XA 4DIKA 2BR6A 3G1PA 3IELA 2BFKA 3RPCA 1WUPA 1K07A 4YSLA 3KNRA 4Z5YA 2BFLA 2WHGA 4LE6A 3QH8A 2OHJA 5AHOA 4Z60A 5AHRA 2FU7A 4GYQA 4UBQA 4D1TA 3AF6A 4AWZA 1XM8A 1KR3A 3FAIA 4V0HA 3T3NA 2FM6A 5HH5A 3ZNBA 4RM5A 4BZ3A 1HLKA 3VPEA 2FU6A 3RKJA 5AEBA 5A5ZA 2ZZIA 4PVOA 1DXKA 2BG8B 2WYMC 4C1GA 3WXCA 5B15A 2YNVB 1M2XA 4B87A 4D1WA 5K4KA 1VJNA 2NXAA 2AZ4A 4ZO2A 4TZEA 3DHCA 4UWPB 3BK2A 2XR1A 4F6HA 4RBSA 4D02A 5FQAA 4HL1A 4Z7RA 4PVTA 3IE1A 5HIPA 3I0VA 1BVTA 1SMLA 5A87A 5LLDA 2FHXA 4AX1B 5K4MA 1DD6A 1VGNA 2OHIA 5HISA 5LM6A 5EVDA 2ZWRA 4Z5ZA 2YNTB 1BC2A 5A0VA 2FU8A 2Y8AA 1X8HA 4EXYA 5B1UA 2BFZB 1YCFA 2QINA 5EVKA 2UYXA 3AF5A 5AXOA 1JJTA 2NZFA 5EHTA 2GFJA 5EWAA 3PY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTC A;  4KEQ A;  2BG2 A;  4EFZ A;  1WRA A;  1ZNB A;  2BGA A;  5LE1 A;  1BMC A;  3H3E A;  4FEK A;  4DIL A;  3LVZ A;  2M5C A;  3P2U A;  1KO3 A;  3DH8 A;  3ZWF A;  5ACW A;  5HH4 A;  5LCA A;  5EW0 A;  2BG8 A;  3PY6 A;  2I7X A;  4FR7 A;  1YCH A;  2YNV A;  2YNU A;  2ZO4 A;  5HH6 A;  5ACT A;  4XWT A;  5FQC A;  3F9O A;  4UAM A;  2BC2 A;  2ZNB A;  4AX0 B;  2E7Y A;  5LSC A;  2WYL A;  5HIO A;  3RKK A;  3BV6 A;  5KIL A;  3IDZ A;  4XWW A;  4ZEJ A;  3ZQ4 A;  2YNW A;  4TZ9 A;  3VQZ A;  2DOO A;  4TZB A;  4WD6 A;  1A8T A;  2HB9 A;  5LS3 A;  2Q9U A;  4U4L A;  4C09 A;  2NYP A;  4GYU A;  4TYT A;  5B3R A;  5LCF A;  3KNS A;  2I7T A;  2QDS A;  4FSB A;  2P4Z A;  2YNT A;  4JO0 A;  3Q6V A;  3JXP A;  2BG7 A;  3X2X A;  4J5F A;  3DHA A;  5FQB A;  2OHH A;  5IQK A;  1A7T A;  1X8I A;  1JJE A;  3L6N A;  4C1C A;  4UWO B;  2BFZ A;  4XUK A;  4RAW A;  2BMI A;  4C1H A;  1ZKP A;  4UWR B;  4TYF A;  2WRS A;  4C1E A;  2P18 A;  2M5D A;  3FCZ A;  4RL2 A;  1WUO A;  3SPU A;  4J5H A;  3TP9 A;  2Q0I A;  4NQ5 A;  2BG6 A;  2Y87 A;  2BIB A;  2GCU A;  2NZE A;  3IEM A;  4YSB A;  2AIO A;  3S0Z A;  3IOG A;  4UA4 A;  2Y8B A;  4GCW A;  4F6Z A;  5EH9 A;  2GMN A;  2BTN A;  1P9E A;  5LMC A;  4NQ2 A;  1X8G A;  4O98 A;  5EV6 A;  4RAM A;  2R2D A;  5HIQ A;  3ZR9 A;  2WYM A;  4BP0 A;  2DKF A;  4D1V A;  1KO2 A;  4ZO3 A;  2XF4 A;  2Q42 A;  2FU9 A;  3IOF A;  1XTO A;  3SBL A;  4C1F A;  2FK6 A;  2YCB A;  2P97 A;  5ACP A;  4YSK A;  5ACV A;  1DDK A;  4AWY B;  3PG4 A;  3ADR A;  4EY2 A;  2P1E A;  2YZ3 A;  3IEK A;  4HKY A;  1YCG A;  2QED A;  4EYF A;  3BC2 A;  3DHB A;  3AJ3 A;  5DPX A;  4Z67 A;  5EV8 A;  4RL0 A;  2CBN A;  4NQ4 A;  1QH5 A;  4D1U A;  4CHL A;  3I15 A;  1L9Y A;  5AXR A;  3T9M A;  5ACX A;  4ZNB A;  3R2U A;  2GFK A;  3BK1 A;  1JT1 A;  1WW1 A;  4UWS B;  4AD9 A;  2GKL A;  5ACS A;  1QH3 A;  4EYB A;  5ACQ A;  3I13 A;  5EVB A;  5KIK A;  2FHX B;  5LCH A;  4KEP A;  4EYL A;  3SFP A;  5ACU A;  4EXS A;  2QJS A;  4NQ6 A;  2QDT A;  1Y44 A;  3X30 A;  3KL7 A;  1VME A;  5K4N A;  5ACR A;  2I7V A;  4TZF A;  3IE2 A;  3IE0 A;  5K0W A;  3MD7 A;  3X2Z A;  1MQO A;  1E5D A;  3ESH A;  5A0T A;  2VW8 A;  3T3O A;  3SW3 A;  4HL2 A;  4H0D A;  3X2Y A;  3I11 A;  2Q0J A;  4P62 A;  3SD9 A;  5AYA A;  3SRX A;  3A4Y A;  3I14 A;  2A7M A;  4C1D A;  2H6A A;  4Z6X A;  4DIK A;  2BR6 A;  3G1P A;  3IEL A;  2BFK A;  3RPC A;  1WUP A;  1K07 A;  4YSL A;  3KNR A;  4Z5Y A;  2BFL A;  2WHG A;  4LE6 A;  3QH8 A;  2OHJ A;  5AHO A;  4Z60 A;  5AHR A;  2FU7 A;  4GYQ A;  4UBQ A;  4D1T A;  3AF6 A;  4AWZ A;  1XM8 A;  1KR3 A;  3FAI A;  4V0H A;  3T3N A;  2FM6 A;  5HH5 A;  3ZNB A;  4RM5 A;  4BZ3 A;  1HLK A;  3VPE A;  2FU6 A;  3RKJ A;  5AEB A;  5A5Z A;  2ZZI A;  4PVO A;  1DXK A;  2BG8 B;  2WYM C;  4C1G A;  3WXC A;  5B15 A;  2YNV B;  1M2X A;  4B87 A;  4D1W A;  5K4K A;  1VJN A;  2NXA A;  2AZ4 A;  4ZO2 A;  4TZE A;  3DHC A;  4UWP B;  3BK2 A;  2XR1 A;  4F6H A;  4RBS A;  4D02 A;  5FQA A;  4HL1 A;  4Z7R A;  4PVT A;  3IE1 A;  5HIP A;  3I0V A;  1BVT A;  1SML A;  5A87 A;  5LLD A;  2FHX A;  4AX1 B;  5K4M A;  1DD6 A;  1VGN A;  2OHI A;  5HIS A;  5LM6 A;  5EVD A;  2ZWR A;  4Z5Z A;  2YNT B;  1BC2 A;  5A0V A;  2FU8 A;  2Y8A A;  1X8H A;  4EXY A;  5B1U A;  2BFZ B;  1YCF A;  2QIN A;  5EVK A;  2UYX A;  3AF5 A;  5AXO A;  1JJT A;  2NZF A;  5EHT A;  2GFJ A;  5EWA A;  3PY5 A; 
#chains in the Genus database with same CATH topology
 1ZTC A;  4KEQ A;  2BG2 A;  4EFZ A;  1WRA A;  1ZNB A;  2BGA A;  5LE1 A;  1BMC A;  3H3E A;  4FEK A;  4DIL A;  3LVZ A;  2M5C A;  3P2U A;  1KO3 A;  3DH8 A;  3ZWF A;  5ACW A;  2YHE A;  5HH4 A;  5LCA A;  5EW0 A;  2BG8 A;  3PY6 A;  2I7X A;  4FR7 A;  1YCH A;  2YNV A;  2YNU A;  2ZO4 A;  5HH6 A;  4AXH A;  5ACT A;  4XWT A;  5FQC A;  3F9O A;  5AJL A;  4PDX A;  4UAM A;  2BC2 A;  2ZNB A;  4AX0 B;  2E7Y A;  5LSC A;  2WYL A;  5HIO A;  3RKK A;  3BV6 A;  5KIL A;  3IDZ A;  4XWW A;  4ZEJ A;  4AV7 A;  3ZQ4 A;  2YNW A;  4TZ9 A;  3VQZ A;  2DOO A;  4TZB A;  4WD6 A;  1A8T A;  2HB9 A;  5LS3 A;  2Q9U A;  4U4L A;  4C09 A;  2NYP A;  4GYU A;  4TYT A;  5B3R A;  5LCF A;  3KNS A;  2I7T A;  2QDS A;  4FSB A;  2P4Z A;  2YNT A;  4JO0 A;  3Q6V A;  3JXP A;  2BG7 A;  3X2X A;  4J5F A;  3DHA A;  5FQB A;  2OHH A;  5IQK A;  1A7T A;  1X8I A;  1JJE A;  3L6N A;  4C1C A;  4UWO B;  2BFZ A;  4XUK A;  4RAW A;  2BMI A;  4C1H A;  1ZKP A;  4UWR B;  5AIJ A;  4TYF A;  2WRS A;  4C1E A;  2P18 A;  2M5D A;  3FCZ A;  4RL2 A;  1WUO A;  3SPU A;  4J5H A;  3TP9 A;  2Q0I A;  4NQ5 A;  2BG6 A;  2Y87 A;  2BIB A;  2GCU A;  2NZE A;  3IEM A;  4YSB A;  2AIO A;  3S0Z A;  3IOG A;  4UA4 A;  2Y8B A;  4GCW A;  4F6Z A;  5EH9 A;  2GMN A;  2BTN A;  1P9E A;  5LMC A;  4NQ2 A;  2CG2 A;  1X8G A;  4O98 A;  5EV6 A;  4RAM A;  2R2D A;  5HIQ A;  3ZR9 A;  2WYM A;  4BP0 A;  2DKF A;  4D1V A;  1KO2 A;  4ZO3 A;  2XF4 A;  2Q42 A;  2FU9 A;  3IOF A;  1XTO A;  3SBL A;  4C1F A;  2FK6 A;  2YCB A;  2P97 A;  5ACP A;  4YSK A;  5ACV A;  1DDK A;  4AWY B;  3PG4 A;  3ADR A;  4EY2 A;  2P1E A;  2YZ3 A;  3IEK A;  4HKY A;  1YCG A;  2QED A;  5A23 A;  4EYF A;  3BC2 A;  3DHB A;  3AJ3 A;  5DPX A;  4Z67 A;  5EV8 A;  4RL0 A;  2CBN A;  4NQ4 A;  1QH5 A;  4D1U A;  4CHL A;  3I15 A;  1L9Y A;  5AXR A;  3T9M A;  5ACX A;  4NUR A;  4ZNB A;  3R2U A;  2GFK A;  3BK1 A;  1JT1 A;  1WW1 A;  4UWS B;  4AD9 A;  2GKL A;  5ACS A;  1QH3 A;  4EYB A;  5ACQ A;  3I13 A;  5EVB A;  5KIK A;  2FHX B;  5LCH A;  4KEP A;  4EYL A;  3SFP A;  5ACU A;  4EXS A;  2QJS A;  4NQ6 A;  2QDT A;  1Y44 A;  3X30 A;  3KL7 A;  1VME A;  5K4N A;  5ACR A;  2CFZ A;  2I7V A;  4TZF A;  3IE2 A;  3IE0 A;  5K0W A;  3MD7 A;  3X2Z A;  1MQO A;  1E5D A;  3ESH A;  5A0T A;  2VW8 A;  3T3O A;  3SW3 A;  4HL2 A;  4H0D A;  3X2Y A;  3I11 A;  2Q0J A;  4P62 A;  3SD9 A;  5AYA A;  3SRX A;  3A4Y A;  3I14 A;  2A7M A;  4C1D A;  2H6A A;  4Z6X A;  2BR6 A;  3G1P A;  3IEL A;  3RPC A;  2BFK A;  4DIK A;  1WUP A;  1K07 A;  4YSL A;  3KNR A;  4Z5Y A;  2BFL A;  2WHG A;  4LE6 A;  3QH8 A;  2OHJ A;  5AHO A;  4Z60 A;  5AHR A;  2FU7 A;  4GYQ A;  4UBQ A;  4D1T A;  3AF6 A;  4AWZ A;  1XM8 A;  1KR3 A;  3FAI A;  4V0H A;  3T3N A;  2FM6 A;  5HH5 A;  3ZNB A;  4RM5 A;  4BZ3 A;  1HLK A;  3VPE A;  2FU6 A;  3RKJ A;  5AEB A;  5A5Z A;  2ZZI A;  4PVO A;  1DXK A;  2BG8 B;  2WYM C;  4C1G A;  3WXC A;  5B15 A;  2YNV B;  1M2X A;  4B87 A;  4D1W A;  5K4K A;  1VJN A;  2NXA A;  2AZ4 A;  4ZO2 A;  4TZE A;  3DHC A;  4UWP B;  3BK2 A;  2XR1 A;  4F6H A;  4RBS A;  4D02 A;  5FQA A;  4HL1 A;  4Z7R A;  4PVT A;  3IE1 A;  5HIP A;  3I0V A;  1BVT A;  1SML A;  5A87 A;  5LLD A;  2FHX A;  4AX1 B;  5K4M A;  1DD6 A;  1VGN A;  2OHI A;  5HIS A;  5LM6 A;  5EVD A;  2ZWR A;  4Z5Z A;  2YNT B;  1BC2 A;  5A0V A;  2FU8 A;  2CG3 A;  2Y8A A;  1X8H A;  4EXY A;  5B1U A;  2BFZ B;  1YCF A;  2QIN A;  5EVK A;  2UYX A;  3AF5 A;  5AXO A;  1JJT A;  2NZF A;  2CFU A;  5EHT A;  2GFJ A;  5EWA A;  3PY5 A; 
#chains in the Genus database with same CATH homology
 1ZTC A;  4KEQ A;  2BG2 A;  4EFZ A;  1WRA A;  1ZNB A;  2BGA A;  5LE1 A;  1BMC A;  3H3E A;  4FEK A;  4DIL A;  3LVZ A;  2M5C A;  3P2U A;  1KO3 A;  3DH8 A;  3ZWF A;  5ACW A;  5HH4 A;  5LCA A;  5EW0 A;  2BG8 A;  3PY6 A;  2I7X A;  4FR7 A;  1YCH A;  2YNV A;  2YNU A;  2ZO4 A;  5HH6 A;  5ACT A;  4XWT A;  5FQC A;  3F9O A;  4UAM A;  2BC2 A;  2ZNB A;  4AX0 B;  2E7Y A;  5LSC A;  2WYL A;  5HIO A;  3RKK A;  3BV6 A;  5KIL A;  3IDZ A;  4XWW A;  4ZEJ A;  3ZQ4 A;  2YNW A;  4TZ9 A;  3VQZ A;  2DOO A;  4TZB A;  4WD6 A;  1A8T A;  2HB9 A;  5LS3 A;  2Q9U A;  4U4L A;  4C09 A;  2NYP A;  4GYU A;  4TYT A;  5B3R A;  5LCF A;  3KNS A;  2I7T A;  2QDS A;  4FSB A;  2P4Z A;  2YNT A;  4JO0 A;  3Q6V A;  3JXP A;  2BG7 A;  3X2X A;  4J5F A;  3DHA A;  5FQB A;  2OHH A;  5IQK A;  1A7T A;  1X8I A;  1JJE A;  3L6N A;  4C1C A;  4UWO B;  2BFZ A;  4XUK A;  4RAW A;  2BMI A;  4C1H A;  1ZKP A;  4UWR B;  4TYF A;  2WRS A;  4C1E A;  2P18 A;  2M5D A;  3FCZ A;  4RL2 A;  1WUO A;  3SPU A;  4J5H A;  3TP9 A;  2Q0I A;  4NQ5 A;  2BG6 A;  2Y87 A;  2BIB A;  2GCU A;  2NZE A;  3IEM A;  4YSB A;  2AIO A;  3S0Z A;  3IOG A;  4UA4 A;  2Y8B A;  4GCW A;  4F6Z A;  5EH9 A;  2GMN A;  2BTN A;  1P9E A;  5LMC A;  4NQ2 A;  1X8G A;  4O98 A;  5EV6 A;  4RAM A;  2R2D A;  5HIQ A;  3ZR9 A;  2WYM A;  4BP0 A;  2DKF A;  4D1V A;  1KO2 A;  4ZO3 A;  2XF4 A;  2Q42 A;  2FU9 A;  3IOF A;  1XTO A;  3SBL A;  4C1F A;  2FK6 A;  2YCB A;  2P97 A;  5ACP A;  4YSK A;  5ACV A;  1DDK A;  4AWY B;  3PG4 A;  3ADR A;  4EY2 A;  2P1E A;  2YZ3 A;  3IEK A;  4HKY A;  1YCG A;  2QED A;  4EYF A;  3BC2 A;  3DHB A;  3AJ3 A;  5DPX A;  4Z67 A;  5EV8 A;  4RL0 A;  2CBN A;  4NQ4 A;  1QH5 A;  4D1U A;  4CHL A;  3I15 A;  1L9Y A;  5AXR A;  3T9M A;  5ACX A;  4ZNB A;  3R2U A;  2GFK A;  3BK1 A;  1JT1 A;  1WW1 A;  4UWS B;  4AD9 A;  2GKL A;  5ACS A;  1QH3 A;  4EYB A;  5ACQ A;  3I13 A;  5EVB A;  5KIK A;  2FHX B;  5LCH A;  4KEP A;  4EYL A;  3SFP A;  5ACU A;  4EXS A;  2QJS A;  4NQ6 A;  2QDT A;  1Y44 A;  3X30 A;  3KL7 A;  1VME A;  5K4N A;  5ACR A;  2I7V A;  4TZF A;  3IE2 A;  3IE0 A;  5K0W A;  3MD7 A;  3X2Z A;  1MQO A;  1E5D A;  3ESH A;  5A0T A;  2VW8 A;  3T3O A;  3SW3 A;  4HL2 A;  4H0D A;  3X2Y A;  3I11 A;  2Q0J A;  4P62 A;  3SD9 A;  5AYA A;  3SRX A;  3A4Y A;  3I14 A;  2A7M A;  4C1D A;  2H6A A;  4Z6X A;  4DIK A;  2BR6 A;  3G1P A;  3IEL A;  2BFK A;  3RPC A;  1WUP A;  1K07 A;  4YSL A;  3KNR A;  4Z5Y A;  2BFL A;  2WHG A;  4LE6 A;  3QH8 A;  2OHJ A;  5AHO A;  4Z60 A;  5AHR A;  2FU7 A;  4GYQ A;  4UBQ A;  4D1T A;  3AF6 A;  4AWZ A;  1XM8 A;  1KR3 A;  3FAI A;  4V0H A;  3T3N A;  2FM6 A;  5HH5 A;  3ZNB A;  4RM5 A;  4BZ3 A;  1HLK A;  3VPE A;  2FU6 A;  3RKJ A;  5AEB A;  5A5Z A;  2ZZI A;  4PVO A;  1DXK A;  2BG8 B;  2WYM C;  4C1G A;  3WXC A;  5B15 A;  2YNV B;  1M2X A;  4B87 A;  4D1W A;  5K4K A;  1VJN A;  2NXA A;  2AZ4 A;  4ZO2 A;  4TZE A;  3DHC A;  4UWP B;  3BK2 A;  2XR1 A;  4F6H A;  4RBS A;  4D02 A;  5FQA A;  4HL1 A;  4Z7R A;  4PVT A;  3IE1 A;  5HIP A;  3I0V A;  1BVT A;  1SML A;  5A87 A;  5LLD A;  2FHX A;  4AX1 B;  5K4M A;  1DD6 A;  1VGN A;  2OHI A;  5HIS A;  5LM6 A;  5EVD A;  2ZWR A;  4Z5Z A;  2YNT B;  1BC2 A;  5A0V A;  2FU8 A;  2Y8A A;  1X8H A;  4EXY A;  5B1U A;  2BFZ B;  1YCF A;  2QIN A;  5EVK A;  2UYX A;  3AF5 A;  5AXO A;  1JJT A;  2NZF A;  5EHT A;  2GFJ A;  5EWA A;  3PY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...