4F6HA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
233
structure length
223
Chain Sequence
b'LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESHPQFEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 57
structure length 223
sequence length 233
ec nomenclature
pdb deposition date 2012-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6hA00
1VJNA 3IE1A 1DD6A 5LCHA 1X8HA 3SPUA 4NQ6A 2ZZIA 4Z60A 2BG2A 3MD7A 2QINA 4BP0A 5EW0A 4UBQA 2P97A 3ZQ4A 1ZNBA 3X2YA 1K07A 5K4KA 4RBSA 5EVDA 5EV6A 4TYTA 4ZNBA 3H3EA 4D02A 4EXYA 5ACSA 4RL2A 5A87A 2QDTA 3ZR9A 2FU8A 3PY6A 1E5DA 4YSLA 5ACVA 5FQAA 3I0VA 4P62A 1SMLA 2FM6A 4BZ3A 2YNUA 4FR7A 2WHGA 5IQKA 3P2UA 1ZTCA 4HL2A 5A0TA 2YNWA 4RAWA 3BK1A 4RL0A 3I14A 1JJEA 4ZO3A 1WUOA 2FU9A 5LS3A 4DIKA 4GYQA 5EH9A 4D1WA 1JJTA 3IEMA 4HKYA 3BV6A 4YSKA 5AHOA 4RM5A 4UWSB 2BFKA 2Y8BA 4UWRB 1WRAA 4UWOB 2ZWRA 2P18A 1P9EA 4RAMA 2Q9UA 4ZEJA 4TZFA 3IEKA 4XWTA 4B87A 3LVZA 4Z5ZA 3BC2A 3SFPA 4EFZA 1A7TA 5HIQA 1BVTA 2Q0JA 3T3OA 4O98A 3DH8A 4FSBA 4J5HA 3AJ3A 4F6ZA 1XM8A 2UYXA 2BFZB 2R2DA 1QH5A 4AWYB 5EVBA 2WYLA 2NYPA 5ACTA 5EHTA 5B3RA 5ACQA 2GFJA 2WYMA 5HIOA 4KEQA 5EV8A 2VW8A 2GCUA 2YNTB 5EWAA 2XF4A 4TYFA 3RKJA 3ADRA 5FQCA 3WXCA 2BG7A 4PVOA 4Z7RA 4LE6A 3DHBA 2NXAA 5K4NA 5A5ZA 1ZKPA 1QH3A 1L9YA 2NZFA 4XWWA 3ZWFA 2BG8A 1Y44A 3S0ZA 4FEKA 4C1DA 3KNRA 5AHRA 4UWPB 3DHAA 4C09A 3RPCA 3ZNBA 1KO3A 5ACXA 5ACRA 3T3NA 1YCFA 1X8IA 5EVKA 3DHCA 2FHXA 5HH4A 2FU6A 5KILA 5AEBA 3R2UA 5A0VA 4C1GA 2Y87A 4U4LA 2FU7A 4CHLA 4EXSA 4D1UA 1WUPA 4NQ5A 4V0HA 3KNSA 3TP9A 2YNVA 1WW1A 2ZNBA 4C1EA 3AF6A 2I7XA 2GMNA 4H0DA 2BMIA 5HH5A 2FK6A 2DOOA 5LCAA 2QJSA 3X30A 3T9MA 4EYBA 5LLDA 2WRSA 3KL7A 4YSBA 4KEPA 4Z67A 4C1HA 5LCFA 2HB9A 4UA4A 1KR3A 5LSCA 2Q42A 5K4MA 2OHHA 4UAMA 2BTNA 3RKKA 1VGNA 4PVTA 5KIKA 1BC2A 3L6NA 3IE0A 3IE2A 3IDZA 2CBNA 4NQ2A 3I15A 2H6AA 5AYAA 2YNVB 1M2XA 2BFLA 1HLKA 2YZ3A 5FQBA 1DDKA 4NQ4A 4JO0A 1YCHA 4TZBA 5AXOA 3I13A 3SRXA 5AXRA 4D1VA 2I7VA 4TZEA 4HL1A 1BMCA 1DXKA 2DKFA 2YCBA 4C1CA 1YCGA 2P1EA 4AWZA 3AF5A 4EYFA 2M5DA 1MQOA 4C1FA 3G1PA 3SBLA 4XUKA 5HH6A 4WD6A 2BIBA 1JT1A 5ACWA 3FAIA 5B1UA 2M5CA 2OHIA 4GYUA 2AZ4A 3IOFA 2AIOA 2QDSA 4EYLA 3F9OA 2BG6A 3X2ZA 2A7MA 2BC2A 5LE1A 2QEDA 1X8GA 4Z6XA 4AD9A 2Q0IA 5ACUA 1KO2A 2BG8B 3PY5A 2BFZA 4EY2A 5LM6A 5ACPA 4J5FA 3FCZA 2XR1A 5HISA 2E7YA 3X2XA 4ZO2A 3SD9A 4Z5YA 5DPXA 2NZEA 2YNTA 2BR6A 2P4ZA 5B15A 2FHXB 3PG4A 1A8TA 3JXPA 4TZ9A 2GFKA 5HIPA 3VQZA 2I7TA 1VMEA 4GCWA 3BK2A 5LMCA 2GKLA 3A4YA 2ZO4A 3QH8A 3SW3A 3ESHA 4AX0B 2BGAA 5K0WA 2Y8AA 2WYMC 4D1TA 3IELA 3I11A 2OHJA 3IOGA 3VPEA 4DILA 4AX1B 1XTOA 3Q6VA 4F6HA
chains in the Genus database with same CATH superfamily
1VJNA 3IE1A 1DD6A 5LCHA 1X8HA 3SPUA 4NQ6A 2ZZIA 4Z60A 2BG2A 3MD7A 2QINA 4BP0A 4AV7A 5EW0A 4UBQA 2P97A 3ZQ4A 1ZNBA 3X2YA 1K07A 5K4KA 4RBSA 5EVDA 5EV6A 4TYTA 4ZNBA 3H3EA 4D02A 4EXYA 5ACSA 4RL2A 5A87A 2QDTA 3ZR9A 5A23A 2FU8A 3PY6A 1E5DA 5AIJA 2CFUA 4YSLA 5ACVA 5FQAA 3I0VA 4P62A 1SMLA 2FM6A 4BZ3A 2YNUA 4FR7A 2WHGA 5IQKA 3P2UA 1ZTCA 4HL2A 5A0TA 2YNWA 4RAWA 3BK1A 4RL0A 3I14A 1JJEA 4ZO3A 1WUOA 2FU9A 5LS3A 4DIKA 4GYQA 5EH9A 4D1WA 1JJTA 3IEMA 4HKYA 3BV6A 4YSKA 5AHOA 4RM5A 4UWSB 2BFKA 2Y8BA 4UWRB 1WRAA 4UWOB 2ZWRA 2P18A 1P9EA 4RAMA 2Q9UA 4ZEJA 4TZFA 3IEKA 4XWTA 4B87A 3LVZA 4Z5ZA 3BC2A 3SFPA 4EFZA 1A7TA 5HIQA 1BVTA 2Q0JA 3T3OA 4O98A 3DH8A 4FSBA 4J5HA 3AJ3A 4F6ZA 1XM8A 2UYXA 2BFZB 2R2DA 1QH5A 4AWYB 5EVBA 2WYLA 2NYPA 5ACTA 5EHTA 5B3RA 5ACQA 2GFJA 2WYMA 4NURA 4KEQA 5HIOA 5EV8A 2VW8A 2GCUA 2YNTB 5EWAA 2XF4A 4TYFA 3RKJA 3ADRA 5FQCA 3WXCA 2BG7A 4PVOA 4Z7RA 4LE6A 3DHBA 2NXAA 5K4NA 5A5ZA 1ZKPA 1QH3A 1L9YA 2NZFA 4XWWA 3ZWFA 2BG8A 1Y44A 3S0ZA 4FEKA 4C1DA 3KNRA 5AHRA 4UWPB 3DHAA 4C09A 3RPCA 3ZNBA 1KO3A 5ACXA 5ACRA 3T3NA 1YCFA 1X8IA 5EVKA 3DHCA 2FHXA 4AXHA 5HH4A 2FU6A 5KILA 5AEBA 3R2UA 5A0VA 4C1GA 2Y87A 4U4LA 2FU7A 4CHLA 4EXSA 4D1UA 1WUPA 4NQ5A 4V0HA 3KNSA 3TP9A 2YNVA 1WW1A 2ZNBA 4C1EA 3AF6A 2I7XA 2GMNA 4H0DA 2BMIA 5HH5A 2FK6A 2DOOA 5LCAA 2QJSA 3X30A 3T9MA 4EYBA 5LLDA 2WRSA 3KL7A 4YSBA 4KEPA 4Z67A 4C1HA 5LCFA 2HB9A 4UA4A 1KR3A 5LSCA 2Q42A 5K4MA 2OHHA 4UAMA 2BTNA 3RKKA 1VGNA 4PVTA 5KIKA 1BC2A 3L6NA 3IE0A 3IE2A 3IDZA 2CBNA 4NQ2A 3I15A 2H6AA 5AYAA 2YNVB 1M2XA 2BFLA 1HLKA 2YZ3A 5FQBA 1DDKA 4NQ4A 4JO0A 1YCHA 4TZBA 5AXOA 3I13A 3SRXA 5AXRA 4D1VA 2I7VA 4TZEA 4HL1A 1BMCA 1DXKA 2DKFA 2YCBA 4C1CA 1YCGA 5AJLA 2CFZA 2P1EA 4AWZA 3AF5A 4EYFA 2M5DA 2CG3A 1MQOA 4C1FA 2YHEA 3G1PA 3SBLA 4XUKA 5HH6A 4WD6A 2BIBA 1JT1A 5ACWA 3FAIA 5B1UA 2M5CA 2OHIA 4GYUA 2AZ4A 3IOFA 2AIOA 2QDSA 4EYLA 3F9OA 2BG6A 3X2ZA 2A7MA 2BC2A 5LE1A 2QEDA 1X8GA 4Z6XA 4AD9A 2Q0IA 5ACUA 1KO2A 2BG8B 3PY5A 2BFZA 4EY2A 5LM6A 4PDXA 5ACPA 4J5FA 3FCZA 2XR1A 5HISA 2E7YA 3X2XA 4ZO2A 3SD9A 4Z5YA 5DPXA 2NZEA 2CG2A 2YNTA 2BR6A 2P4ZA 5B15A 2FHXB 3PG4A 1A8TA 3JXPA 4TZ9A 2GFKA 5HIPA 3VQZA 2I7TA 1VMEA 4GCWA 3BK2A 5LMCA 2GKLA 3A4YA 2ZO4A 3QH8A 3SW3A 3ESHA 4AX0B 2BGAA 5K0WA 2Y8AA 2WYMC 4D1TA 3IELA 3I11A 2OHJA 3IOGA 3VPEA 4DILA 4AX1B 1XTOA 3Q6VA 4F6HA
chains in the Genus database with same CATH topology
1VJNA 3IE1A 1DD6A 5LCHA 1X8HA 3SPUA 4NQ6A 2ZZIA 4Z60A 2BG2A 3MD7A 2QINA 4BP0A 5EW0A 4UBQA 2P97A 3ZQ4A 1ZNBA 3X2YA 1K07A 5K4KA 4RBSA 5EVDA 5EV6A 4TYTA 4ZNBA 3H3EA 4D02A 4EXYA 5ACSA 4RL2A 5A87A 2QDTA 3ZR9A 2FU8A 3PY6A 1E5DA 4YSLA 5ACVA 5FQAA 3I0VA 4P62A 1SMLA 2FM6A 4BZ3A 2YNUA 4FR7A 2WHGA 5IQKA 3P2UA 1ZTCA 4HL2A 5A0TA 2YNWA 4RAWA 3BK1A 4RL0A 3I14A 1JJEA 4ZO3A 1WUOA 2FU9A 5LS3A 4DIKA 4GYQA 5EH9A 4D1WA 1JJTA 3IEMA 4HKYA 3BV6A 4YSKA 5AHOA 4RM5A 4UWSB 2BFKA 2Y8BA 4UWRB 1WRAA 4UWOB 2ZWRA 2P18A 1P9EA 4RAMA 2Q9UA 4ZEJA 4TZFA 3IEKA 4XWTA 4B87A 3LVZA 4Z5ZA 3BC2A 3SFPA 4EFZA 1A7TA 5HIQA 1BVTA 2Q0JA 3T3OA 4O98A 3DH8A 4FSBA 4J5HA 3AJ3A 4F6ZA 1XM8A 2UYXA 2BFZB 2R2DA 1QH5A 4AWYB 5EVBA 2WYLA 2NYPA 5ACTA 5EHTA 5B3RA 5ACQA 2GFJA 2WYMA 5HIOA 4KEQA 5EV8A 2VW8A 2GCUA 2YNTB 5EWAA 2XF4A 4TYFA 3RKJA 3ADRA 5FQCA 3WXCA 2BG7A 4PVOA 4Z7RA 4LE6A 3DHBA 2NXAA 5K4NA 5A5ZA 1ZKPA 1QH3A 1L9YA 2NZFA 4XWWA 3ZWFA 2BG8A 1Y44A 3S0ZA 4FEKA 4C1DA 3KNRA 5AHRA 4UWPB 3DHAA 4C09A 3RPCA 3ZNBA 1KO3A 5ACXA 5ACRA 3T3NA 1YCFA 1X8IA 5EVKA 3DHCA 2FHXA 5HH4A 2FU6A 5KILA 5AEBA 3R2UA 5A0VA 4C1GA 2Y87A 4U4LA 2FU7A 4CHLA 4EXSA 4D1UA 1WUPA 4NQ5A 4V0HA 3KNSA 3TP9A 2YNVA 1WW1A 2ZNBA 4C1EA 3AF6A 2I7XA 2GMNA 4H0DA 2BMIA 5HH5A 2FK6A 2DOOA 5LCAA 2QJSA 3X30A 3T9MA 4EYBA 5LLDA 2WRSA 3KL7A 4YSBA 4KEPA 4Z67A 4C1HA 5LCFA 2HB9A 4UA4A 1KR3A 5LSCA 2Q42A 5K4MA 2OHHA 4UAMA 2BTNA 3RKKA 1VGNA 4PVTA 5KIKA 1BC2A 3L6NA 3IE0A 3IE2A 3IDZA 2CBNA 4NQ2A 3I15A 2H6AA 5AYAA 2YNVB 1M2XA 2BFLA 1HLKA 2YZ3A 5FQBA 1DDKA 4NQ4A 4JO0A 1YCHA 4TZBA 5AXOA 3I13A 3SRXA 5AXRA 4D1VA 2I7VA 4TZEA 4HL1A 1BMCA 1DXKA 2DKFA 2YCBA 4C1CA 1YCGA 2P1EA 4AWZA 3AF5A 4EYFA 2M5DA 1MQOA 4C1FA 3G1PA 3SBLA 4XUKA 5HH6A 4WD6A 2BIBA 1JT1A 5ACWA 3FAIA 5B1UA 2M5CA 2OHIA 4GYUA 2AZ4A 3IOFA 2AIOA 2QDSA 4EYLA 3F9OA 2BG6A 3X2ZA 2A7MA 2BC2A 5LE1A 2QEDA 1X8GA 4Z6XA 4AD9A 2Q0IA 5ACUA 1KO2A 2BG8B 3PY5A 2BFZA 4EY2A 5LM6A 5ACPA 4J5FA 3FCZA 2XR1A 5HISA 2E7YA 3X2XA 4ZO2A 3SD9A 4Z5YA 5DPXA 2NZEA 2YNTA 2BR6A 2P4ZA 5B15A 2FHXB 3PG4A 1A8TA 3JXPA 4TZ9A 2GFKA 5HIPA 3VQZA 2I7TA 1VMEA 4GCWA 3BK2A 5LMCA 2GKLA 3A4YA 2ZO4A 3QH8A 3SW3A 3ESHA 4AX0B 2BGAA 5K0WA 2Y8AA 2WYMC 4D1TA 3IELA 3I11A 2OHJA 3IOGA 3VPEA 4DILA 4AX1B 1XTOA 3Q6VA 4F6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJN A;  3IE1 A;  1DD6 A;  5LCH A;  1X8H A;  3SPU A;  4NQ6 A;  2ZZI A;  4Z60 A;  2BG2 A;  3MD7 A;  2QIN A;  4BP0 A;  5EW0 A;  4UBQ A;  2P97 A;  3ZQ4 A;  1ZNB A;  3X2Y A;  1K07 A;  5K4K A;  4RBS A;  5EVD A;  5EV6 A;  4TYT A;  4ZNB A;  3H3E A;  4D02 A;  4EXY A;  5ACS A;  4RL2 A;  5A87 A;  2QDT A;  3ZR9 A;  2FU8 A;  3PY6 A;  1E5D A;  4YSL A;  5ACV A;  5FQA A;  3I0V A;  4P62 A;  1SML A;  2FM6 A;  4BZ3 A;  2YNU A;  4FR7 A;  2WHG A;  5IQK A;  3P2U A;  1ZTC A;  4HL2 A;  5A0T A;  2YNW A;  4RAW A;  3BK1 A;  4RL0 A;  3I14 A;  1JJE A;  4ZO3 A;  1WUO A;  2FU9 A;  5LS3 A;  4DIK A;  4GYQ A;  5EH9 A;  4D1W A;  1JJT A;  3IEM A;  4HKY A;  3BV6 A;  4YSK A;  5AHO A;  4RM5 A;  4UWS B;  2BFK A;  2Y8B A;  4UWR B;  1WRA A;  4UWO B;  2ZWR A;  2P18 A;  1P9E A;  4RAM A;  2Q9U A;  4ZEJ A;  4TZF A;  3IEK A;  4XWT A;  4B87 A;  3LVZ A;  4Z5Z A;  3BC2 A;  3SFP A;  4EFZ A;  1A7T A;  5HIQ A;  1BVT A;  2Q0J A;  3T3O A;  4O98 A;  3DH8 A;  4FSB A;  4J5H A;  3AJ3 A;  4F6Z A;  1XM8 A;  2UYX A;  2BFZ B;  2R2D A;  1QH5 A;  4AWY B;  5EVB A;  2WYL A;  2NYP A;  5ACT A;  5EHT A;  5B3R A;  5ACQ A;  2GFJ A;  2WYM A;  5HIO A;  4KEQ A;  5EV8 A;  2VW8 A;  2GCU A;  2YNT B;  5EWA A;  2XF4 A;  4TYF A;  3RKJ A;  3ADR A;  5FQC A;  3WXC A;  2BG7 A;  4PVO A;  4Z7R A;  4LE6 A;  3DHB A;  2NXA A;  5K4N A;  5A5Z A;  1ZKP A;  1QH3 A;  1L9Y A;  2NZF A;  4XWW A;  3ZWF A;  2BG8 A;  1Y44 A;  3S0Z A;  4FEK A;  4C1D A;  3KNR A;  5AHR A;  4UWP B;  3DHA A;  4C09 A;  3RPC A;  3ZNB A;  1KO3 A;  5ACX A;  5ACR A;  3T3N A;  1YCF A;  1X8I A;  5EVK A;  3DHC A;  2FHX A;  5HH4 A;  2FU6 A;  5KIL A;  5AEB A;  3R2U A;  5A0V A;  4C1G A;  2Y87 A;  4U4L A;  2FU7 A;  4CHL A;  4EXS A;  4D1U A;  1WUP A;  4NQ5 A;  4V0H A;  3KNS A;  3TP9 A;  2YNV A;  1WW1 A;  2ZNB A;  4C1E A;  3AF6 A;  2I7X A;  2GMN A;  4H0D A;  2BMI A;  5HH5 A;  2FK6 A;  2DOO A;  5LCA A;  2QJS A;  3X30 A;  3T9M A;  4EYB A;  5LLD A;  2WRS A;  3KL7 A;  4YSB A;  4KEP A;  4Z67 A;  4C1H A;  5LCF A;  2HB9 A;  4UA4 A;  1KR3 A;  5LSC A;  2Q42 A;  5K4M A;  2OHH A;  4UAM A;  2BTN A;  3RKK A;  1VGN A;  4PVT A;  5KIK A;  1BC2 A;  3L6N A;  3IE0 A;  3IE2 A;  3IDZ A;  2CBN A;  4NQ2 A;  3I15 A;  2H6A A;  5AYA A;  2YNV B;  1M2X A;  2BFL A;  1HLK A;  2YZ3 A;  5FQB A;  1DDK A;  4NQ4 A;  4JO0 A;  1YCH A;  4TZB A;  5AXO A;  3I13 A;  3SRX A;  5AXR A;  4D1V A;  2I7V A;  4TZE A;  4HL1 A;  1BMC A;  1DXK A;  2DKF A;  2YCB A;  4C1C A;  1YCG A;  2P1E A;  4AWZ A;  3AF5 A;  4EYF A;  2M5D A;  1MQO A;  4C1F A;  3G1P A;  3SBL A;  4XUK A;  5HH6 A;  4WD6 A;  2BIB A;  1JT1 A;  5ACW A;  3FAI A;  5B1U A;  2M5C A;  2OHI A;  4GYU A;  2AZ4 A;  3IOF A;  2AIO A;  2QDS A;  4EYL A;  3F9O A;  2BG6 A;  3X2Z A;  2A7M A;  2BC2 A;  5LE1 A;  2QED A;  1X8G A;  4Z6X A;  4AD9 A;  2Q0I A;  5ACU A;  1KO2 A;  2BG8 B;  3PY5 A;  2BFZ A;  4EY2 A;  5LM6 A;  5ACP A;  4J5F A;  3FCZ A;  2XR1 A;  5HIS A;  2E7Y A;  3X2X A;  4ZO2 A;  3SD9 A;  4Z5Y A;  5DPX A;  2NZE A;  2YNT A;  2BR6 A;  2P4Z A;  5B15 A;  2FHX B;  3PG4 A;  1A8T A;  3JXP A;  4TZ9 A;  2GFK A;  5HIP A;  3VQZ A;  2I7T A;  1VME A;  4GCW A;  3BK2 A;  5LMC A;  2GKL A;  3A4Y A;  2ZO4 A;  3QH8 A;  3SW3 A;  3ESH A;  4AX0 B;  2BGA A;  5K0W A;  2Y8A A;  2WYM C;  4D1T A;  3IEL A;  3I11 A;  2OHJ A;  3IOG A;  3VPE A;  4DIL A;  4AX1 B;  1XTO A;  3Q6V A;  4F6H A; 
#chains in the Genus database with same CATH topology
 1VJN A;  3IE1 A;  1DD6 A;  5LCH A;  1X8H A;  3SPU A;  4NQ6 A;  2ZZI A;  4Z60 A;  2BG2 A;  3MD7 A;  2QIN A;  4BP0 A;  4AV7 A;  5EW0 A;  4UBQ A;  2P97 A;  3ZQ4 A;  1ZNB A;  3X2Y A;  1K07 A;  5K4K A;  4RBS A;  5EVD A;  5EV6 A;  4TYT A;  4ZNB A;  3H3E A;  4D02 A;  4EXY A;  5ACS A;  4RL2 A;  5A87 A;  2QDT A;  3ZR9 A;  5A23 A;  2FU8 A;  3PY6 A;  1E5D A;  5AIJ A;  2CFU A;  4YSL A;  5ACV A;  5FQA A;  3I0V A;  4P62 A;  1SML A;  2FM6 A;  4BZ3 A;  2YNU A;  4FR7 A;  2WHG A;  5IQK A;  3P2U A;  1ZTC A;  4HL2 A;  5A0T A;  2YNW A;  4RAW A;  3BK1 A;  4RL0 A;  3I14 A;  1JJE A;  4ZO3 A;  1WUO A;  2FU9 A;  5LS3 A;  4DIK A;  4GYQ A;  5EH9 A;  4D1W A;  1JJT A;  3IEM A;  4HKY A;  3BV6 A;  4YSK A;  5AHO A;  4RM5 A;  4UWS B;  2BFK A;  2Y8B A;  4UWR B;  1WRA A;  4UWO B;  2ZWR A;  2P18 A;  1P9E A;  4RAM A;  2Q9U A;  4ZEJ A;  4TZF A;  3IEK A;  4XWT A;  4B87 A;  3LVZ A;  4Z5Z A;  3BC2 A;  3SFP A;  4EFZ A;  1A7T A;  5HIQ A;  1BVT A;  2Q0J A;  3T3O A;  4O98 A;  3DH8 A;  4FSB A;  4J5H A;  3AJ3 A;  4F6Z A;  1XM8 A;  2UYX A;  2BFZ B;  2R2D A;  1QH5 A;  4AWY B;  5EVB A;  2WYL A;  2NYP A;  5ACT A;  5EHT A;  5B3R A;  5ACQ A;  2GFJ A;  2WYM A;  4NUR A;  4KEQ A;  5HIO A;  5EV8 A;  2VW8 A;  2GCU A;  2YNT B;  5EWA A;  2XF4 A;  4TYF A;  3RKJ A;  3ADR A;  5FQC A;  3WXC A;  2BG7 A;  4PVO A;  4Z7R A;  4LE6 A;  3DHB A;  2NXA A;  5K4N A;  5A5Z A;  1ZKP A;  1QH3 A;  1L9Y A;  2NZF A;  4XWW A;  3ZWF A;  2BG8 A;  1Y44 A;  3S0Z A;  4FEK A;  4C1D A;  3KNR A;  5AHR A;  4UWP B;  3DHA A;  4C09 A;  3RPC A;  3ZNB A;  1KO3 A;  5ACX A;  5ACR A;  3T3N A;  1YCF A;  1X8I A;  5EVK A;  3DHC A;  2FHX A;  4AXH A;  5HH4 A;  2FU6 A;  5KIL A;  5AEB A;  3R2U A;  5A0V A;  4C1G A;  2Y87 A;  4U4L A;  2FU7 A;  4CHL A;  4EXS A;  4D1U A;  1WUP A;  4NQ5 A;  4V0H A;  3KNS A;  3TP9 A;  2YNV A;  1WW1 A;  2ZNB A;  4C1E A;  3AF6 A;  2I7X A;  2GMN A;  4H0D A;  2BMI A;  5HH5 A;  2FK6 A;  2DOO A;  5LCA A;  2QJS A;  3X30 A;  3T9M A;  4EYB A;  5LLD A;  2WRS A;  3KL7 A;  4YSB A;  4KEP A;  4Z67 A;  4C1H A;  5LCF A;  2HB9 A;  4UA4 A;  1KR3 A;  5LSC A;  2Q42 A;  5K4M A;  2OHH A;  4UAM A;  2BTN A;  3RKK A;  1VGN A;  4PVT A;  5KIK A;  1BC2 A;  3L6N A;  3IE0 A;  3IE2 A;  3IDZ A;  2CBN A;  4NQ2 A;  3I15 A;  2H6A A;  5AYA A;  2YNV B;  1M2X A;  2BFL A;  1HLK A;  2YZ3 A;  5FQB A;  1DDK A;  4NQ4 A;  4JO0 A;  1YCH A;  4TZB A;  5AXO A;  3I13 A;  3SRX A;  5AXR A;  4D1V A;  2I7V A;  4TZE A;  4HL1 A;  1BMC A;  1DXK A;  2DKF A;  2YCB A;  4C1C A;  1YCG A;  5AJL A;  2CFZ A;  2P1E A;  4AWZ A;  3AF5 A;  4EYF A;  2M5D A;  2CG3 A;  1MQO A;  4C1F A;  2YHE A;  3G1P A;  3SBL A;  4XUK A;  5HH6 A;  4WD6 A;  2BIB A;  1JT1 A;  5ACW A;  3FAI A;  5B1U A;  2M5C A;  2OHI A;  4GYU A;  2AZ4 A;  3IOF A;  2AIO A;  2QDS A;  4EYL A;  3F9O A;  2BG6 A;  3X2Z A;  2A7M A;  2BC2 A;  5LE1 A;  2QED A;  1X8G A;  4Z6X A;  4AD9 A;  2Q0I A;  5ACU A;  1KO2 A;  2BG8 B;  3PY5 A;  2BFZ A;  4EY2 A;  5LM6 A;  4PDX A;  5ACP A;  4J5F A;  3FCZ A;  2XR1 A;  5HIS A;  2E7Y A;  3X2X A;  4ZO2 A;  3SD9 A;  4Z5Y A;  5DPX A;  2NZE A;  2CG2 A;  2YNT A;  2BR6 A;  2P4Z A;  5B15 A;  2FHX B;  3PG4 A;  1A8T A;  3JXP A;  4TZ9 A;  2GFK A;  5HIP A;  3VQZ A;  2I7T A;  1VME A;  4GCW A;  3BK2 A;  5LMC A;  2GKL A;  3A4Y A;  2ZO4 A;  3QH8 A;  3SW3 A;  3ESH A;  4AX0 B;  2BGA A;  5K0W A;  2Y8A A;  2WYM C;  4D1T A;  3IEL A;  3I11 A;  2OHJ A;  3IOG A;  3VPE A;  4DIL A;  4AX1 B;  1XTO A;  3Q6V A;  4F6H A; 
#chains in the Genus database with same CATH homology
 1VJN A;  3IE1 A;  1DD6 A;  5LCH A;  1X8H A;  3SPU A;  4NQ6 A;  2ZZI A;  4Z60 A;  2BG2 A;  3MD7 A;  2QIN A;  4BP0 A;  5EW0 A;  4UBQ A;  2P97 A;  3ZQ4 A;  1ZNB A;  3X2Y A;  1K07 A;  5K4K A;  4RBS A;  5EVD A;  5EV6 A;  4TYT A;  4ZNB A;  3H3E A;  4D02 A;  4EXY A;  5ACS A;  4RL2 A;  5A87 A;  2QDT A;  3ZR9 A;  2FU8 A;  3PY6 A;  1E5D A;  4YSL A;  5ACV A;  5FQA A;  3I0V A;  4P62 A;  1SML A;  2FM6 A;  4BZ3 A;  2YNU A;  4FR7 A;  2WHG A;  5IQK A;  3P2U A;  1ZTC A;  4HL2 A;  5A0T A;  2YNW A;  4RAW A;  3BK1 A;  4RL0 A;  3I14 A;  1JJE A;  4ZO3 A;  1WUO A;  2FU9 A;  5LS3 A;  4DIK A;  4GYQ A;  5EH9 A;  4D1W A;  1JJT A;  3IEM A;  4HKY A;  3BV6 A;  4YSK A;  5AHO A;  4RM5 A;  4UWS B;  2BFK A;  2Y8B A;  4UWR B;  1WRA A;  4UWO B;  2ZWR A;  2P18 A;  1P9E A;  4RAM A;  2Q9U A;  4ZEJ A;  4TZF A;  3IEK A;  4XWT A;  4B87 A;  3LVZ A;  4Z5Z A;  3BC2 A;  3SFP A;  4EFZ A;  1A7T A;  5HIQ A;  1BVT A;  2Q0J A;  3T3O A;  4O98 A;  3DH8 A;  4FSB A;  4J5H A;  3AJ3 A;  4F6Z A;  1XM8 A;  2UYX A;  2BFZ B;  2R2D A;  1QH5 A;  4AWY B;  5EVB A;  2WYL A;  2NYP A;  5ACT A;  5EHT A;  5B3R A;  5ACQ A;  2GFJ A;  2WYM A;  5HIO A;  4KEQ A;  5EV8 A;  2VW8 A;  2GCU A;  2YNT B;  5EWA A;  2XF4 A;  4TYF A;  3RKJ A;  3ADR A;  5FQC A;  3WXC A;  2BG7 A;  4PVO A;  4Z7R A;  4LE6 A;  3DHB A;  2NXA A;  5K4N A;  5A5Z A;  1ZKP A;  1QH3 A;  1L9Y A;  2NZF A;  4XWW A;  3ZWF A;  2BG8 A;  1Y44 A;  3S0Z A;  4FEK A;  4C1D A;  3KNR A;  5AHR A;  4UWP B;  3DHA A;  4C09 A;  3RPC A;  3ZNB A;  1KO3 A;  5ACX A;  5ACR A;  3T3N A;  1YCF A;  1X8I A;  5EVK A;  3DHC A;  2FHX A;  5HH4 A;  2FU6 A;  5KIL A;  5AEB A;  3R2U A;  5A0V A;  4C1G A;  2Y87 A;  4U4L A;  2FU7 A;  4CHL A;  4EXS A;  4D1U A;  1WUP A;  4NQ5 A;  4V0H A;  3KNS A;  3TP9 A;  2YNV A;  1WW1 A;  2ZNB A;  4C1E A;  3AF6 A;  2I7X A;  2GMN A;  4H0D A;  2BMI A;  5HH5 A;  2FK6 A;  2DOO A;  5LCA A;  2QJS A;  3X30 A;  3T9M A;  4EYB A;  5LLD A;  2WRS A;  3KL7 A;  4YSB A;  4KEP A;  4Z67 A;  4C1H A;  5LCF A;  2HB9 A;  4UA4 A;  1KR3 A;  5LSC A;  2Q42 A;  5K4M A;  2OHH A;  4UAM A;  2BTN A;  3RKK A;  1VGN A;  4PVT A;  5KIK A;  1BC2 A;  3L6N A;  3IE0 A;  3IE2 A;  3IDZ A;  2CBN A;  4NQ2 A;  3I15 A;  2H6A A;  5AYA A;  2YNV B;  1M2X A;  2BFL A;  1HLK A;  2YZ3 A;  5FQB A;  1DDK A;  4NQ4 A;  4JO0 A;  1YCH A;  4TZB A;  5AXO A;  3I13 A;  3SRX A;  5AXR A;  4D1V A;  2I7V A;  4TZE A;  4HL1 A;  1BMC A;  1DXK A;  2DKF A;  2YCB A;  4C1C A;  1YCG A;  2P1E A;  4AWZ A;  3AF5 A;  4EYF A;  2M5D A;  1MQO A;  4C1F A;  3G1P A;  3SBL A;  4XUK A;  5HH6 A;  4WD6 A;  2BIB A;  1JT1 A;  5ACW A;  3FAI A;  5B1U A;  2M5C A;  2OHI A;  4GYU A;  2AZ4 A;  3IOF A;  2AIO A;  2QDS A;  4EYL A;  3F9O A;  2BG6 A;  3X2Z A;  2A7M A;  2BC2 A;  5LE1 A;  2QED A;  1X8G A;  4Z6X A;  4AD9 A;  2Q0I A;  5ACU A;  1KO2 A;  2BG8 B;  3PY5 A;  2BFZ A;  4EY2 A;  5LM6 A;  5ACP A;  4J5F A;  3FCZ A;  2XR1 A;  5HIS A;  2E7Y A;  3X2X A;  4ZO2 A;  3SD9 A;  4Z5Y A;  5DPX A;  2NZE A;  2YNT A;  2BR6 A;  2P4Z A;  5B15 A;  2FHX B;  3PG4 A;  1A8T A;  3JXP A;  4TZ9 A;  2GFK A;  5HIP A;  3VQZ A;  2I7T A;  1VME A;  4GCW A;  3BK2 A;  5LMC A;  2GKL A;  3A4Y A;  2ZO4 A;  3QH8 A;  3SW3 A;  3ESH A;  4AX0 B;  2BGA A;  5K0W A;  2Y8A A;  2WYM C;  4D1T A;  3IEL A;  3I11 A;  2OHJ A;  3IOG A;  3VPE A;  4DIL A;  4AX1 B;  1XTO A;  3Q6V A;  4F6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...