4F6ZA

Mutagenesis of zinc ligand residue cys221 reveals plasticity in the imp-1 metallo-b-lactamase active site
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
232
structure length
221
Chain Sequence
PDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGGFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNEHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Beta-lactamase
publication title Mutagenesis of zinc ligand residue Cys221 reveals plasticity in the IMP-1 metallo-beta-lactamase active site
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 60
structure length 221
sequence length 232
ec nomenclature
pdb deposition date 2012-05-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4f6zA00
2GFJA 1DD6A 5FQAA 3H3EA 3ZR9A 4TZBA 4GYQA 5EH9A 3JXPA 3R2UA 3RPCA 5KIKA 4RM5A 4BZ3A 3L6NA 4J5HA 3Q6VA 1L9YA 4ZO3A 2CBNA 1Y44A 2YCBA 2QDSA 3KNRA 1A8TA 4U4LA 2H6AA 1VGNA 5A5ZA 2WYLA 2I7XA 1YCHA 4EYBA 2GKLA 3SW3A 4UAMA 2ZNBA 2AZ4A 2OHHA 5LCFA 3I13A 5HH4A 2WYMA 1JJTA 5AXRA 2Q9UA 4DILA 5AHOA 3I0VA 2YZ3A 2E7YA 2BFZB 4JO0A 4EXSA 3BV6A 2BIBA 3I14A 4D1WA 4XWWA 3AF6A 4UWSB 4UWRB 1BMCA 2Q0IA 5IQKA 2FM6A 2NXAA 4KEPA 3SBLA 5B15A 5EV8A 3KNSA 5K4NA 2ZZIA 3BK1A 1XTOA 4NQ6A 2ZWRA 4CHLA 2Y8AA 4C09A 2BFZA 4RAWA 2WYMC 5HISA 3T3NA 5ACPA 2Q42A 4F6ZA 3IEMA 2YNVB 1E5DA 4NQ5A 2FU6A 2XR1A 2I7VA 4HKYA 3DHBA 4FSBA 4BP0A 4PVOA 2A7MA 2OHJA 4Z5YA 2DOOA 3PG4A 4AX0B 5B1UA 3PY6A 2GMNA 4C1DA 3ZWFA 5EVBA 5EWAA 5EW0A 4FR7A 1WUOA 2VW8A 2BG6A 4Z7RA 3ZQ4A 5A0TA 5LCAA 4RBSA 4RL0A 3SFPA 3T3OA 4YSLA 3RKJA 2YNVA 4AWZA 1SMLA 2NZFA 2BG8B 5HIOA 2QJSA 4TYFA 4ZO2A 4D1UA 1WW1A 2NYPA 3F9OA 2BFLA 5EVDA 3ZNBA 3VQZA 4Z67A 4EFZA 1WRAA 1BC2A 2ZO4A 3X2XA 5HH5A 2FHXB 2P97A 2QINA 5EVKA 5AYAA 4UBQA 4TYTA 2XF4A 4TZEA 3TP9A 1QH5A 3RKKA 2NZEA 2BG8A 2Y87A 5HIQA 1X8IA 3MD7A 3P2UA 4GCWA 3I11A 4J5FA 3IE2A 4C1HA 3DHCA 1MQOA 3WXCA 4EY2A 4EYFA 5K0WA 1JJEA 2FHXA 3ADRA 3AJ3A 2UYXA 3IE0A 4C1EA 4XUKA 5LE1A 4ZEJA 3IE1A 3VPEA 5EHTA 5K4KA 2BMIA 2BR6A 3SD9A 4D1TA 1ZKPA 1YCGA 4RAMA 3G1PA 1VMEA 2P4ZA 5LSCA 2M5DA 1VJNA 1DDKA 2FU9A 2DKFA 4D02A 5LM6A 3KL7A 4HL1A 3I15A 2I7TA 2HB9A 2FK6A 4FEKA 3DH8A 4V0HA 4YSBA 4ZNBA 4C1GA 4Z60A 1XM8A 4PVTA 4C1FA 4F6HA 2QDTA 2YNUA 3IOFA 2WHGA 2M5CA 4NQ2A 4TZFA 2BTNA 3PY5A 1WUPA 4YSKA 1A7TA 3AF5A 4KEQA 5ACWA 4HL2A 1X8HA 1DXKA 4B87A 2P18A 1X8GA 1P9EA 4DIKA 4O98A 4P62A 3BC2A 5ACSA 1JT1A 4D1VA 3FCZA 3IDZA 3IEKA 1YCFA 4UWPB 2YNWA 5ACUA 5FQCA 5HIPA 5LCHA 1QH3A 2WRSA 3FAIA 4H0DA 5LS3A 5ACTA 2BGAA 3IELA 4LE6A 4AD9A 2Q0JA 3QH8A 3X2YA 5ACRA 1KO3A 1ZTCA 4C1CA 3DHAA 5B3RA 2GCUA 3A4YA 4TZ9A 4AX1B 5LLDA 3ESHA 4EXYA 2BG2A 4UA4A 2FU8A 3X30A 3SPUA 5AEBA 4AWYB 2FU7A 2BG7A 4EYLA 5AXOA 3X2ZA 1K07A 2AIOA 5EV6A 5ACVA 4RL2A 5HH6A 1HLKA 1KR3A 1BVTA 2GFKA 2QEDA 3IOGA 5AHRA 5DPXA 2OHIA 3S0ZA 3LVZA 2P1EA 2YNTB 1KO2A 2BFKA 3BK2A 5A0VA 1ZNBA 3T9MA 2BC2A 2Y8BA 5FQBA 5ACXA 5KILA 4Z6XA 4GYUA 5K4MA 4NQ4A 4XWTA 2R2DA 3SRXA 4Z5ZA 5LMCA 4WD6A 4UWOB 5ACQA 1M2XA 2YNTA 5A87A
chains in the Genus database with same CATH superfamily
2GFJA 1DD6A 5FQAA 3H3EA 3ZR9A 2YHEA 4TZBA 4GYQA 5EH9A 3JXPA 3R2UA 3RPCA 5KIKA 4RM5A 4BZ3A 3L6NA 4J5HA 3Q6VA 1L9YA 4ZO3A 2CBNA 1Y44A 2YCBA 2QDSA 3KNRA 5AIJA 1A8TA 4U4LA 2H6AA 1VGNA 5A5ZA 2WYLA 2I7XA 1YCHA 4EYBA 2GKLA 3SW3A 4UAMA 2ZNBA 2AZ4A 2OHHA 5LCFA 3I13A 5HH4A 2WYMA 1JJTA 5AXRA 2Q9UA 4DILA 5AHOA 3I0VA 2YZ3A 2E7YA 2BFZB 4JO0A 4EXSA 3BV6A 2BIBA 3I14A 4D1WA 4XWWA 3AF6A 4UWSB 4UWRB 1BMCA 2Q0IA 5IQKA 2FM6A 2NXAA 4KEPA 3SBLA 5B15A 5EV8A 3KNSA 5K4NA 2ZZIA 3BK1A 1XTOA 4NQ6A 4AV7A 2ZWRA 4CHLA 2Y8AA 4C09A 2BFZA 4RAWA 2WYMC 5HISA 3T3NA 5ACPA 2Q42A 4F6ZA 3IEMA 2YNVB 1E5DA 4NQ5A 2FU6A 2XR1A 2I7VA 4HKYA 3DHBA 4FSBA 4BP0A 4PVOA 2A7MA 2OHJA 4Z5YA 2DOOA 3PG4A 4NURA 4AX0B 5B1UA 3PY6A 2GMNA 4C1DA 3ZWFA 2CFZA 5EVBA 5EWAA 5EW0A 4FR7A 1WUOA 2VW8A 2BG6A 4Z7RA 3ZQ4A 5A0TA 5LCAA 4RBSA 4RL0A 3SFPA 3T3OA 4YSLA 3RKJA 2YNVA 4AWZA 1SMLA 2CG2A 2NZFA 2BG8B 5HIOA 2QJSA 4TYFA 4ZO2A 4D1UA 1WW1A 2NYPA 3F9OA 2BFLA 5EVDA 3ZNBA 3VQZA 4Z67A 4EFZA 1WRAA 1BC2A 2ZO4A 3X2XA 5HH5A 2FHXB 2P97A 2QINA 5EVKA 5AYAA 4UBQA 4TYTA 2XF4A 4TZEA 3TP9A 1QH5A 3RKKA 2NZEA 2BG8A 2Y87A 5HIQA 1X8IA 3MD7A 3P2UA 4GCWA 3I11A 4J5FA 3IE2A 4C1HA 3DHCA 1MQOA 3WXCA 4EY2A 4EYFA 5K0WA 2CFUA 1JJEA 2FHXA 3ADRA 3AJ3A 2UYXA 3IE0A 4C1EA 4XUKA 5LE1A 4ZEJA 3IE1A 3VPEA 5EHTA 5K4KA 2BMIA 2BR6A 3SD9A 4D1TA 1ZKPA 1YCGA 4RAMA 3G1PA 1VMEA 2P4ZA 5LSCA 2M5DA 1VJNA 1DDKA 2FU9A 2DKFA 4D02A 5LM6A 3KL7A 4HL1A 3I15A 2I7TA 2HB9A 2FK6A 4FEKA 3DH8A 4V0HA 4YSBA 4ZNBA 4C1GA 4AXHA 4Z60A 1XM8A 4PVTA 4C1FA 4F6HA 2QDTA 2YNUA 3IOFA 2WHGA 2M5CA 4NQ2A 4TZFA 2BTNA 5A23A 3PY5A 1WUPA 4YSKA 1A7TA 3AF5A 4KEQA 5ACWA 4HL2A 1X8HA 1DXKA 4B87A 2P18A 1X8GA 1P9EA 4DIKA 4O98A 4P62A 3BC2A 5ACSA 1JT1A 4D1VA 3FCZA 3IDZA 3IEKA 5AJLA 1YCFA 4UWPB 2YNWA 5ACUA 5FQCA 5HIPA 5LCHA 1QH3A 2WRSA 3FAIA 4H0DA 5LS3A 5ACTA 2BGAA 3IELA 4LE6A 4AD9A 2Q0JA 3QH8A 3X2YA 5ACRA 1KO3A 1ZTCA 4C1CA 3DHAA 5B3RA 2GCUA 3A4YA 4TZ9A 4AX1B 5LLDA 3ESHA 4EXYA 2BG2A 4UA4A 2FU8A 3X30A 3SPUA 5AEBA 4AWYB 2FU7A 2BG7A 4EYLA 5AXOA 3X2ZA 1K07A 2AIOA 5EV6A 5ACVA 4RL2A 5HH6A 1HLKA 1KR3A 1BVTA 2GFKA 2QEDA 3IOGA 5AHRA 5DPXA 2OHIA 3S0ZA 3LVZA 2P1EA 2YNTB 1KO2A 2BFKA 3BK2A 5A0VA 1ZNBA 3T9MA 2BC2A 2Y8BA 5FQBA 5ACXA 5KILA 4Z6XA 4GYUA 5K4MA 4NQ4A 4XWTA 4PDXA 2R2DA 3SRXA 4Z5ZA 5LMCA 4WD6A 4UWOB 2CG3A 5ACQA 1M2XA 2YNTA 5A87A
chains in the Genus database with same CATH topology
2GFJA 1DD6A 5FQAA 3H3EA 3ZR9A 4TZBA 4GYQA 5EH9A 3JXPA 3R2UA 3RPCA 5KIKA 4RM5A 4BZ3A 3L6NA 4J5HA 3Q6VA 1L9YA 4ZO3A 2CBNA 1Y44A 2YCBA 2QDSA 3KNRA 1A8TA 4U4LA 2H6AA 1VGNA 5A5ZA 2WYLA 2I7XA 1YCHA 4EYBA 2GKLA 3SW3A 4UAMA 2ZNBA 2AZ4A 2OHHA 5LCFA 3I13A 5HH4A 2WYMA 1JJTA 5AXRA 2Q9UA 4DILA 5AHOA 3I0VA 2YZ3A 2E7YA 2BFZB 4JO0A 4EXSA 3BV6A 2BIBA 3I14A 4D1WA 4XWWA 3AF6A 4UWSB 4UWRB 1BMCA 2Q0IA 5IQKA 2FM6A 2NXAA 4KEPA 3SBLA 5B15A 5EV8A 3KNSA 5K4NA 2ZZIA 3BK1A 1XTOA 4NQ6A 2ZWRA 4CHLA 2Y8AA 4C09A 2BFZA 4RAWA 2WYMC 5HISA 3T3NA 5ACPA 2Q42A 4F6ZA 3IEMA 2YNVB 1E5DA 4NQ5A 2FU6A 2XR1A 2I7VA 4HKYA 3DHBA 4FSBA 4BP0A 4PVOA 2A7MA 2OHJA 4Z5YA 2DOOA 3PG4A 4AX0B 5B1UA 3PY6A 2GMNA 4C1DA 3ZWFA 5EVBA 5EWAA 5EW0A 4FR7A 1WUOA 2VW8A 2BG6A 4Z7RA 3ZQ4A 5A0TA 5LCAA 4RBSA 4RL0A 3SFPA 3T3OA 4YSLA 3RKJA 2YNVA 4AWZA 1SMLA 2NZFA 2BG8B 5HIOA 2QJSA 4TYFA 4ZO2A 4D1UA 1WW1A 2NYPA 3F9OA 2BFLA 5EVDA 3ZNBA 3VQZA 4Z67A 4EFZA 1WRAA 1BC2A 2ZO4A 3X2XA 5HH5A 2FHXB 2P97A 2QINA 5EVKA 5AYAA 4UBQA 4TYTA 2XF4A 4TZEA 3TP9A 1QH5A 3RKKA 2NZEA 2BG8A 2Y87A 5HIQA 1X8IA 3MD7A 3P2UA 4GCWA 3I11A 4J5FA 3IE2A 4C1HA 3DHCA 1MQOA 3WXCA 4EY2A 4EYFA 5K0WA 1JJEA 2FHXA 3ADRA 3AJ3A 2UYXA 3IE0A 4C1EA 4XUKA 5LE1A 4ZEJA 3IE1A 3VPEA 5EHTA 5K4KA 2BMIA 2BR6A 3SD9A 4D1TA 1ZKPA 1YCGA 4RAMA 3G1PA 1VMEA 2P4ZA 5LSCA 2M5DA 1VJNA 1DDKA 2FU9A 2DKFA 4D02A 5LM6A 3KL7A 4HL1A 3I15A 2I7TA 2HB9A 2FK6A 4FEKA 3DH8A 4V0HA 4YSBA 4ZNBA 4C1GA 4Z60A 1XM8A 4PVTA 4C1FA 4F6HA 2QDTA 2YNUA 3IOFA 2WHGA 2M5CA 4NQ2A 4TZFA 2BTNA 3PY5A 1WUPA 4YSKA 1A7TA 3AF5A 4KEQA 5ACWA 4HL2A 1X8HA 1DXKA 4B87A 2P18A 1X8GA 1P9EA 4DIKA 4O98A 4P62A 3BC2A 5ACSA 1JT1A 4D1VA 3FCZA 3IDZA 3IEKA 1YCFA 4UWPB 2YNWA 5ACUA 5FQCA 5HIPA 5LCHA 1QH3A 2WRSA 3FAIA 4H0DA 5LS3A 5ACTA 2BGAA 3IELA 4LE6A 4AD9A 2Q0JA 3QH8A 3X2YA 5ACRA 1KO3A 1ZTCA 4C1CA 3DHAA 5B3RA 2GCUA 3A4YA 4TZ9A 4AX1B 5LLDA 3ESHA 4EXYA 2BG2A 4UA4A 2FU8A 3X30A 3SPUA 5AEBA 4AWYB 2FU7A 2BG7A 4EYLA 5AXOA 3X2ZA 1K07A 2AIOA 5EV6A 5ACVA 4RL2A 5HH6A 1HLKA 1KR3A 1BVTA 2GFKA 2QEDA 3IOGA 5AHRA 5DPXA 2OHIA 3S0ZA 3LVZA 2P1EA 2YNTB 1KO2A 2BFKA 3BK2A 5A0VA 1ZNBA 3T9MA 2BC2A 2Y8BA 5FQBA 5ACXA 5KILA 4Z6XA 4GYUA 5K4MA 4NQ4A 4XWTA 2R2DA 3SRXA 4Z5ZA 5LMCA 4WD6A 4UWOB 5ACQA 1M2XA 2YNTA 5A87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GFJ A;  1DD6 A;  5FQA A;  3H3E A;  3ZR9 A;  4TZB A;  4GYQ A;  5EH9 A;  3JXP A;  3R2U A;  3RPC A;  5KIK A;  4RM5 A;  4BZ3 A;  3L6N A;  4J5H A;  3Q6V A;  1L9Y A;  4ZO3 A;  2CBN A;  1Y44 A;  2YCB A;  2QDS A;  3KNR A;  1A8T A;  4U4L A;  2H6A A;  1VGN A;  5A5Z A;  2WYL A;  2I7X A;  1YCH A;  4EYB A;  2GKL A;  3SW3 A;  4UAM A;  2ZNB A;  2AZ4 A;  2OHH A;  5LCF A;  3I13 A;  5HH4 A;  2WYM A;  1JJT A;  5AXR A;  2Q9U A;  4DIL A;  5AHO A;  3I0V A;  2YZ3 A;  2E7Y A;  2BFZ B;  4JO0 A;  4EXS A;  3BV6 A;  2BIB A;  3I14 A;  4D1W A;  4XWW A;  3AF6 A;  4UWS B;  4UWR B;  1BMC A;  2Q0I A;  5IQK A;  2FM6 A;  2NXA A;  4KEP A;  3SBL A;  5B15 A;  5EV8 A;  3KNS A;  5K4N A;  2ZZI A;  3BK1 A;  1XTO A;  4NQ6 A;  2ZWR A;  4CHL A;  2Y8A A;  4C09 A;  2BFZ A;  4RAW A;  2WYM C;  5HIS A;  3T3N A;  5ACP A;  2Q42 A;  4F6Z A;  3IEM A;  2YNV B;  1E5D A;  4NQ5 A;  2FU6 A;  2XR1 A;  2I7V A;  4HKY A;  3DHB A;  4FSB A;  4BP0 A;  4PVO A;  2A7M A;  2OHJ A;  4Z5Y A;  2DOO A;  3PG4 A;  4AX0 B;  5B1U A;  3PY6 A;  2GMN A;  4C1D A;  3ZWF A;  5EVB A;  5EWA A;  5EW0 A;  4FR7 A;  1WUO A;  2VW8 A;  2BG6 A;  4Z7R A;  3ZQ4 A;  5A0T A;  5LCA A;  4RBS A;  4RL0 A;  3SFP A;  3T3O A;  4YSL A;  3RKJ A;  2YNV A;  4AWZ A;  1SML A;  2NZF A;  2BG8 B;  5HIO A;  2QJS A;  4TYF A;  4ZO2 A;  4D1U A;  1WW1 A;  2NYP A;  3F9O A;  2BFL A;  5EVD A;  3ZNB A;  3VQZ A;  4Z67 A;  4EFZ A;  1WRA A;  1BC2 A;  2ZO4 A;  3X2X A;  5HH5 A;  2FHX B;  2P97 A;  2QIN A;  5EVK A;  5AYA A;  4UBQ A;  4TYT A;  2XF4 A;  4TZE A;  3TP9 A;  1QH5 A;  3RKK A;  2NZE A;  2BG8 A;  2Y87 A;  5HIQ A;  1X8I A;  3MD7 A;  3P2U A;  4GCW A;  3I11 A;  4J5F A;  3IE2 A;  4C1H A;  3DHC A;  1MQO A;  3WXC A;  4EY2 A;  4EYF A;  5K0W A;  1JJE A;  2FHX A;  3ADR A;  3AJ3 A;  2UYX A;  3IE0 A;  4C1E A;  4XUK A;  5LE1 A;  4ZEJ A;  3IE1 A;  3VPE A;  5EHT A;  5K4K A;  2BMI A;  2BR6 A;  3SD9 A;  4D1T A;  1ZKP A;  1YCG A;  4RAM A;  3G1P A;  1VME A;  2P4Z A;  5LSC A;  2M5D A;  1VJN A;  1DDK A;  2FU9 A;  2DKF A;  4D02 A;  5LM6 A;  3KL7 A;  4HL1 A;  3I15 A;  2I7T A;  2HB9 A;  2FK6 A;  4FEK A;  3DH8 A;  4V0H A;  4YSB A;  4ZNB A;  4C1G A;  4Z60 A;  1XM8 A;  4PVT A;  4C1F A;  4F6H A;  2QDT A;  2YNU A;  3IOF A;  2WHG A;  2M5C A;  4NQ2 A;  4TZF A;  2BTN A;  3PY5 A;  1WUP A;  4YSK A;  1A7T A;  3AF5 A;  4KEQ A;  5ACW A;  4HL2 A;  1X8H A;  1DXK A;  4B87 A;  2P18 A;  1X8G A;  1P9E A;  4DIK A;  4O98 A;  4P62 A;  3BC2 A;  5ACS A;  1JT1 A;  4D1V A;  3FCZ A;  3IDZ A;  3IEK A;  1YCF A;  4UWP B;  2YNW A;  5ACU A;  5FQC A;  5HIP A;  5LCH A;  1QH3 A;  2WRS A;  3FAI A;  4H0D A;  5LS3 A;  5ACT A;  2BGA A;  3IEL A;  4LE6 A;  4AD9 A;  2Q0J A;  3QH8 A;  3X2Y A;  5ACR A;  1KO3 A;  1ZTC A;  4C1C A;  3DHA A;  5B3R A;  2GCU A;  3A4Y A;  4TZ9 A;  4AX1 B;  5LLD A;  3ESH A;  4EXY A;  2BG2 A;  4UA4 A;  2FU8 A;  3X30 A;  3SPU A;  5AEB A;  4AWY B;  2FU7 A;  2BG7 A;  4EYL A;  5AXO A;  3X2Z A;  1K07 A;  2AIO A;  5EV6 A;  5ACV A;  4RL2 A;  5HH6 A;  1HLK A;  1KR3 A;  1BVT A;  2GFK A;  2QED A;  3IOG A;  5AHR A;  5DPX A;  2OHI A;  3S0Z A;  3LVZ A;  2P1E A;  2YNT B;  1KO2 A;  2BFK A;  3BK2 A;  5A0V A;  1ZNB A;  3T9M A;  2BC2 A;  2Y8B A;  5FQB A;  5ACX A;  5KIL A;  4Z6X A;  4GYU A;  5K4M A;  4NQ4 A;  4XWT A;  2R2D A;  3SRX A;  4Z5Z A;  5LMC A;  4WD6 A;  4UWO B;  5ACQ A;  1M2X A;  2YNT A;  5A87 A; 
#chains in the Genus database with same CATH topology
 2GFJ A;  1DD6 A;  5FQA A;  3H3E A;  3ZR9 A;  2YHE A;  4TZB A;  4GYQ A;  5EH9 A;  3JXP A;  3R2U A;  3RPC A;  5KIK A;  4RM5 A;  4BZ3 A;  3L6N A;  4J5H A;  3Q6V A;  1L9Y A;  4ZO3 A;  2CBN A;  1Y44 A;  2YCB A;  2QDS A;  3KNR A;  5AIJ A;  1A8T A;  4U4L A;  2H6A A;  1VGN A;  5A5Z A;  2WYL A;  2I7X A;  1YCH A;  4EYB A;  2GKL A;  3SW3 A;  4UAM A;  2ZNB A;  2AZ4 A;  2OHH A;  5LCF A;  3I13 A;  5HH4 A;  2WYM A;  1JJT A;  5AXR A;  2Q9U A;  4DIL A;  5AHO A;  3I0V A;  2YZ3 A;  2E7Y A;  2BFZ B;  4JO0 A;  4EXS A;  3BV6 A;  2BIB A;  3I14 A;  4D1W A;  4XWW A;  3AF6 A;  4UWS B;  4UWR B;  1BMC A;  2Q0I A;  5IQK A;  2FM6 A;  2NXA A;  4KEP A;  3SBL A;  5B15 A;  5EV8 A;  3KNS A;  5K4N A;  2ZZI A;  3BK1 A;  1XTO A;  4NQ6 A;  4AV7 A;  2ZWR A;  4CHL A;  2Y8A A;  4C09 A;  2BFZ A;  4RAW A;  2WYM C;  5HIS A;  3T3N A;  5ACP A;  2Q42 A;  4F6Z A;  3IEM A;  2YNV B;  1E5D A;  4NQ5 A;  2FU6 A;  2XR1 A;  2I7V A;  4HKY A;  3DHB A;  4FSB A;  4BP0 A;  4PVO A;  2A7M A;  2OHJ A;  4Z5Y A;  2DOO A;  3PG4 A;  4NUR A;  4AX0 B;  5B1U A;  3PY6 A;  2GMN A;  4C1D A;  3ZWF A;  2CFZ A;  5EVB A;  5EWA A;  5EW0 A;  4FR7 A;  1WUO A;  2VW8 A;  2BG6 A;  4Z7R A;  3ZQ4 A;  5A0T A;  5LCA A;  4RBS A;  4RL0 A;  3SFP A;  3T3O A;  4YSL A;  3RKJ A;  2YNV A;  4AWZ A;  1SML A;  2CG2 A;  2NZF A;  2BG8 B;  5HIO A;  2QJS A;  4TYF A;  4ZO2 A;  4D1U A;  1WW1 A;  2NYP A;  3F9O A;  2BFL A;  5EVD A;  3ZNB A;  3VQZ A;  4Z67 A;  4EFZ A;  1WRA A;  1BC2 A;  2ZO4 A;  3X2X A;  5HH5 A;  2FHX B;  2P97 A;  2QIN A;  5EVK A;  5AYA A;  4UBQ A;  4TYT A;  2XF4 A;  4TZE A;  3TP9 A;  1QH5 A;  3RKK A;  2NZE A;  2BG8 A;  2Y87 A;  5HIQ A;  1X8I A;  3MD7 A;  3P2U A;  4GCW A;  3I11 A;  4J5F A;  3IE2 A;  4C1H A;  3DHC A;  1MQO A;  3WXC A;  4EY2 A;  4EYF A;  5K0W A;  2CFU A;  1JJE A;  2FHX A;  3ADR A;  3AJ3 A;  2UYX A;  3IE0 A;  4C1E A;  4XUK A;  5LE1 A;  4ZEJ A;  3IE1 A;  3VPE A;  5EHT A;  5K4K A;  2BMI A;  2BR6 A;  3SD9 A;  4D1T A;  1ZKP A;  1YCG A;  4RAM A;  3G1P A;  1VME A;  2P4Z A;  5LSC A;  2M5D A;  1VJN A;  1DDK A;  2FU9 A;  2DKF A;  4D02 A;  5LM6 A;  3KL7 A;  4HL1 A;  3I15 A;  2I7T A;  2HB9 A;  2FK6 A;  4FEK A;  3DH8 A;  4V0H A;  4YSB A;  4ZNB A;  4C1G A;  4AXH A;  4Z60 A;  1XM8 A;  4PVT A;  4C1F A;  4F6H A;  2QDT A;  2YNU A;  3IOF A;  2WHG A;  2M5C A;  4NQ2 A;  4TZF A;  2BTN A;  5A23 A;  3PY5 A;  1WUP A;  4YSK A;  1A7T A;  3AF5 A;  4KEQ A;  5ACW A;  4HL2 A;  1X8H A;  1DXK A;  4B87 A;  2P18 A;  1X8G A;  1P9E A;  4DIK A;  4O98 A;  4P62 A;  3BC2 A;  5ACS A;  1JT1 A;  4D1V A;  3FCZ A;  3IDZ A;  3IEK A;  5AJL A;  1YCF A;  4UWP B;  2YNW A;  5ACU A;  5FQC A;  5HIP A;  5LCH A;  1QH3 A;  2WRS A;  3FAI A;  4H0D A;  5LS3 A;  5ACT A;  2BGA A;  3IEL A;  4LE6 A;  4AD9 A;  2Q0J A;  3QH8 A;  3X2Y A;  5ACR A;  1KO3 A;  1ZTC A;  4C1C A;  3DHA A;  5B3R A;  2GCU A;  3A4Y A;  4TZ9 A;  4AX1 B;  5LLD A;  3ESH A;  4EXY A;  2BG2 A;  4UA4 A;  2FU8 A;  3X30 A;  3SPU A;  5AEB A;  4AWY B;  2FU7 A;  2BG7 A;  4EYL A;  5AXO A;  3X2Z A;  1K07 A;  2AIO A;  5EV6 A;  5ACV A;  4RL2 A;  5HH6 A;  1HLK A;  1KR3 A;  1BVT A;  2GFK A;  2QED A;  3IOG A;  5AHR A;  5DPX A;  2OHI A;  3S0Z A;  3LVZ A;  2P1E A;  2YNT B;  1KO2 A;  2BFK A;  3BK2 A;  5A0V A;  1ZNB A;  3T9M A;  2BC2 A;  2Y8B A;  5FQB A;  5ACX A;  5KIL A;  4Z6X A;  4GYU A;  5K4M A;  4NQ4 A;  4XWT A;  4PDX A;  2R2D A;  3SRX A;  4Z5Z A;  5LMC A;  4WD6 A;  4UWO B;  2CG3 A;  5ACQ A;  1M2X A;  2YNT A;  5A87 A; 
#chains in the Genus database with same CATH homology
 2GFJ A;  1DD6 A;  5FQA A;  3H3E A;  3ZR9 A;  4TZB A;  4GYQ A;  5EH9 A;  3JXP A;  3R2U A;  3RPC A;  5KIK A;  4RM5 A;  4BZ3 A;  3L6N A;  4J5H A;  3Q6V A;  1L9Y A;  4ZO3 A;  2CBN A;  1Y44 A;  2YCB A;  2QDS A;  3KNR A;  1A8T A;  4U4L A;  2H6A A;  1VGN A;  5A5Z A;  2WYL A;  2I7X A;  1YCH A;  4EYB A;  2GKL A;  3SW3 A;  4UAM A;  2ZNB A;  2AZ4 A;  2OHH A;  5LCF A;  3I13 A;  5HH4 A;  2WYM A;  1JJT A;  5AXR A;  2Q9U A;  4DIL A;  5AHO A;  3I0V A;  2YZ3 A;  2E7Y A;  2BFZ B;  4JO0 A;  4EXS A;  3BV6 A;  2BIB A;  3I14 A;  4D1W A;  4XWW A;  3AF6 A;  4UWS B;  4UWR B;  1BMC A;  2Q0I A;  5IQK A;  2FM6 A;  2NXA A;  4KEP A;  3SBL A;  5B15 A;  5EV8 A;  3KNS A;  5K4N A;  2ZZI A;  3BK1 A;  1XTO A;  4NQ6 A;  2ZWR A;  4CHL A;  2Y8A A;  4C09 A;  2BFZ A;  4RAW A;  2WYM C;  5HIS A;  3T3N A;  5ACP A;  2Q42 A;  4F6Z A;  3IEM A;  2YNV B;  1E5D A;  4NQ5 A;  2FU6 A;  2XR1 A;  2I7V A;  4HKY A;  3DHB A;  4FSB A;  4BP0 A;  4PVO A;  2A7M A;  2OHJ A;  4Z5Y A;  2DOO A;  3PG4 A;  4AX0 B;  5B1U A;  3PY6 A;  2GMN A;  4C1D A;  3ZWF A;  5EVB A;  5EWA A;  5EW0 A;  4FR7 A;  1WUO A;  2VW8 A;  2BG6 A;  4Z7R A;  3ZQ4 A;  5A0T A;  5LCA A;  4RBS A;  4RL0 A;  3SFP A;  3T3O A;  4YSL A;  3RKJ A;  2YNV A;  4AWZ A;  1SML A;  2NZF A;  2BG8 B;  5HIO A;  2QJS A;  4TYF A;  4ZO2 A;  4D1U A;  1WW1 A;  2NYP A;  3F9O A;  2BFL A;  5EVD A;  3ZNB A;  3VQZ A;  4Z67 A;  4EFZ A;  1WRA A;  1BC2 A;  2ZO4 A;  3X2X A;  5HH5 A;  2FHX B;  2P97 A;  2QIN A;  5EVK A;  5AYA A;  4UBQ A;  4TYT A;  2XF4 A;  4TZE A;  3TP9 A;  1QH5 A;  3RKK A;  2NZE A;  2BG8 A;  2Y87 A;  5HIQ A;  1X8I A;  3MD7 A;  3P2U A;  4GCW A;  3I11 A;  4J5F A;  3IE2 A;  4C1H A;  3DHC A;  1MQO A;  3WXC A;  4EY2 A;  4EYF A;  5K0W A;  1JJE A;  2FHX A;  3ADR A;  3AJ3 A;  2UYX A;  3IE0 A;  4C1E A;  4XUK A;  5LE1 A;  4ZEJ A;  3IE1 A;  3VPE A;  5EHT A;  5K4K A;  2BMI A;  2BR6 A;  3SD9 A;  4D1T A;  1ZKP A;  1YCG A;  4RAM A;  3G1P A;  1VME A;  2P4Z A;  5LSC A;  2M5D A;  1VJN A;  1DDK A;  2FU9 A;  2DKF A;  4D02 A;  5LM6 A;  3KL7 A;  4HL1 A;  3I15 A;  2I7T A;  2HB9 A;  2FK6 A;  4FEK A;  3DH8 A;  4V0H A;  4YSB A;  4ZNB A;  4C1G A;  4Z60 A;  1XM8 A;  4PVT A;  4C1F A;  4F6H A;  2QDT A;  2YNU A;  3IOF A;  2WHG A;  2M5C A;  4NQ2 A;  4TZF A;  2BTN A;  3PY5 A;  1WUP A;  4YSK A;  1A7T A;  3AF5 A;  4KEQ A;  5ACW A;  4HL2 A;  1X8H A;  1DXK A;  4B87 A;  2P18 A;  1X8G A;  1P9E A;  4DIK A;  4O98 A;  4P62 A;  3BC2 A;  5ACS A;  1JT1 A;  4D1V A;  3FCZ A;  3IDZ A;  3IEK A;  1YCF A;  4UWP B;  2YNW A;  5ACU A;  5FQC A;  5HIP A;  5LCH A;  1QH3 A;  2WRS A;  3FAI A;  4H0D A;  5LS3 A;  5ACT A;  2BGA A;  3IEL A;  4LE6 A;  4AD9 A;  2Q0J A;  3QH8 A;  3X2Y A;  5ACR A;  1KO3 A;  1ZTC A;  4C1C A;  3DHA A;  5B3R A;  2GCU A;  3A4Y A;  4TZ9 A;  4AX1 B;  5LLD A;  3ESH A;  4EXY A;  2BG2 A;  4UA4 A;  2FU8 A;  3X30 A;  3SPU A;  5AEB A;  4AWY B;  2FU7 A;  2BG7 A;  4EYL A;  5AXO A;  3X2Z A;  1K07 A;  2AIO A;  5EV6 A;  5ACV A;  4RL2 A;  5HH6 A;  1HLK A;  1KR3 A;  1BVT A;  2GFK A;  2QED A;  3IOG A;  5AHR A;  5DPX A;  2OHI A;  3S0Z A;  3LVZ A;  2P1E A;  2YNT B;  1KO2 A;  2BFK A;  3BK2 A;  5A0V A;  1ZNB A;  3T9M A;  2BC2 A;  2Y8B A;  5FQB A;  5ACX A;  5KIL A;  4Z6X A;  4GYU A;  5K4M A;  4NQ4 A;  4XWT A;  2R2D A;  3SRX A;  4Z5Z A;  5LMC A;  4WD6 A;  4UWO B;  5ACQ A;  1M2X A;  2YNT A;  5A87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...