4Z60A

The 2.5-angstrom of crystal structure of zn(2+)-bound pqqb from pseudomonas putida
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
b'MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z60A00
4FSBA 5FQAA 3DH8A 2BFZB 3X30A 1KO3A 4PVTA 4TYTA 2NZEA 3X2XA 2QDSA 4XWWA 2QEDA 2BFKA 3SFPA 4TZBA 4WD6A 1JT1A 5HH6A 3PY6A 2OHJA 3X2YA 4Z6XA 2VW8A 3R2UA 3SRXA 3IE2A 4UA4A 5LM6A 1DXKA 2I7XA 2OHHA 2Q0IA 4NQ6A 2BC2A 4YSLA 2UYXA 2BG2A 4DIKA 1SMLA 4ZO3A 3RKJA 2DOOA 2XF4A 2YNWA 4YSKA 4AWYB 3IOFA 3AF5A 4AWZA 3FAIA 3H3EA 2R2DA 4NQ5A 2ZWRA 5A5ZA 2NXAA 5HIOA 2OHIA 4Z60A 3BK1A 4AX0B 3PG4A 5LCFA 2FU9A 2FM6A 4Z5YA 3T9MA 1QH5A 4EFZA 4RBSA 3WXCA 1DD6A 2WYMC 1M2XA 4PVOA 4JO0A 2GMNA 5AXOA 3IEMA 5EVBA 3SBLA 4D02A 4O98A 3DHBA 3DHAA 5B15A 5EVDA 1K07A 4C1FA 3I15A 5ACQA 3QH8A 4XUKA 3IE0A 4TYFA 3AF6A 4KEPA 4F6ZA 3SD9A 3SW3A 1VMEA 2Q0JA 4UBQA 1XM8A 2A7MA 5ACWA 3T3OA 2AZ4A 5A87A 4TZ9A 3FCZA 2WYMA 4HKYA 5AHOA 1JJEA 3Q6VA 4GCWA 4ZNBA 5K4KA 4UWSB 2ZO4A 2Q9UA 4Z5ZA 3MD7A 1VGNA 3RKKA 2H6AA 2M5DA 3I14A 2Q42A 2YNUA 1BC2A 2BTNA 3VQZA 1KR3A 1YCFA 4P62A 1A8TA 5DPXA 5K0WA 3KNSA 4TZFA 4U4LA 3A4YA 3RPCA 4D1VA 4Z67A 5ACXA 5LLDA 2FHXA 1KO2A 3VPEA 3IOGA 2QINA 1HLKA 4ZEJA 1XTOA 2ZZIA 4C1EA 3T3NA 1VJNA 4EXYA 1YCGA 5EV8A 5EW0A 4XWTA 5EHTA 2WHGA 2HB9A 4NQ4A 1WUOA 5A0VA 2QJSA 2BGAA 2Y87A 4D1TA 3BV6A 3ADRA 4UWOB 3JXPA 4EXSA 2Y8BA 2FU7A 2Y8AA 4KEQA 2E7YA 3L6NA 2YNTB 4D1UA 5A0TA 2FK6A 1WUPA 3BK2A 4RAWA 3IEKA 4F6HA 2AIOA 3IE1A 4UWPB 5ACSA 3ZNBA 4C1DA 5ACTA 5K4NA 4AX1B 3ZQ4A 1L9YA 2XR1A 2YNVA 4EYLA 5HIQA 2M5CA 1YCHA 4EY2A 1QH3A 2BG8B 2BFZA 1ZTCA 2ZNBA 1WRAA 1ZKPA 5K4MA 3AJ3A 3TP9A 5EH9A 4HL2A 5HH5A 3LVZA 5LS3A 4AD9A 4YSBA 3X2ZA 4CHLA 5LCAA 4B87A 5B1UA 2BFLA 5ACPA 4DILA 4J5FA 1X8IA 4RL2A 1E5DA 4TZEA 5B3RA 2YCBA 4RL0A 4EYFA 3I11A 4FEKA 2BIBA 4BZ3A 4C1CA 4C1GA 4ZO2A 3KNRA 4V0HA 2BG7A 3BC2A 1A7TA 4NQ2A 1BMCA 2CBNA 4C1HA 5KIKA 3ESHA 5FQCA 5LE1A 2P18A 2P97A 3I0VA 5AXRA 5LSCA 2FHXB 3DHCA 2GKLA 4GYQA 4RM5A 5ACVA 2DKFA 2NYPA 2FU6A 5ACUA 4LE6A 5HIPA 5EVKA 5IQKA 2BG6A 4EYBA 3ZWFA 1X8HA 4J5HA 2GCUA 2WYLA 2P1EA 5AHRA 5EV6A 1ZNBA 4UAMA 2FU8A 3KL7A 5LCHA 4UWRB 2GFKA 4RAMA 1MQOA 1X8GA 5HH4A 4GYUA 1JJTA 3PY5A 3SPUA 5KILA 2BR6A 2YNTA 3IELA 3IDZA 3S0ZA 1P9EA 2NZFA 1DDKA 4C09A 5AYAA 4Z7RA 5HISA 3G1PA 5FQBA 1BVTA 2WRSA 3F9OA 5EWAA 3ZR9A 4FR7A 1Y44A 4D1WA 2I7VA 2BMIA 3I13A 2QDTA 2P4ZA 3P2UA 2BG8A 2GFJA 2YNVB 2YZ3A 5AEBA 5ACRA 2I7TA 5LMCA 4H0DA 4HL1A 1WW1A 4BP0A
chains in the Genus database with same CATH superfamily
4FSBA 5FQAA 3DH8A 2BFZB 3X30A 1KO3A 4PVTA 4TYTA 2NZEA 3X2XA 2CG3A 2QDSA 4XWWA 2QEDA 2BFKA 3SFPA 4TZBA 4WD6A 1JT1A 5HH6A 3PY6A 2OHJA 3X2YA 4Z6XA 2VW8A 3R2UA 3SRXA 3IE2A 4UA4A 5LM6A 1DXKA 2I7XA 2OHHA 2Q0IA 4NQ6A 2BC2A 4YSLA 2UYXA 2BG2A 4DIKA 1SMLA 4ZO3A 3RKJA 2DOOA 2XF4A 2YNWA 4YSKA 4AWYB 3IOFA 3AF5A 4AWZA 3FAIA 3H3EA 2R2DA 4NQ5A 2ZWRA 5A5ZA 2NXAA 5HIOA 2OHIA 4Z60A 3BK1A 4AX0B 3PG4A 5LCFA 2FU9A 2FM6A 4Z5YA 3T9MA 4NURA 1QH5A 4AV7A 4EFZA 4RBSA 3WXCA 1DD6A 2WYMC 1M2XA 4PVOA 4JO0A 2GMNA 4AXHA 5AXOA 3IEMA 5EVBA 3SBLA 4D02A 4O98A 3DHBA 3DHAA 5B15A 5EVDA 1K07A 4C1FA 3I15A 5ACQA 3QH8A 4XUKA 2CFZA 3IE0A 4TYFA 3AF6A 4KEPA 4F6ZA 3SD9A 3SW3A 1VMEA 2Q0JA 4UBQA 1XM8A 2A7MA 5ACWA 3T3OA 2AZ4A 5A87A 4PDXA 4TZ9A 3FCZA 2WYMA 4HKYA 5AHOA 5AJLA 1JJEA 3Q6VA 4GCWA 4ZNBA 5K4KA 4UWSB 2ZO4A 2Q9UA 4Z5ZA 3MD7A 1VGNA 3RKKA 2H6AA 2M5DA 3I14A 2CG2A 2Q42A 2YNUA 1BC2A 5A23A 2BTNA 3VQZA 1KR3A 1YCFA 4P62A 1A8TA 5DPXA 5K0WA 3KNSA 4TZFA 4U4LA 3A4YA 3RPCA 4D1VA 4Z67A 5ACXA 5LLDA 2FHXA 1KO2A 3VPEA 3IOGA 2QINA 1HLKA 4ZEJA 1XTOA 2ZZIA 4C1EA 2YHEA 3T3NA 1VJNA 4EXYA 1YCGA 5EV8A 5EW0A 4XWTA 5EHTA 2WHGA 2HB9A 4NQ4A 1WUOA 5A0VA 2QJSA 2BGAA 2Y87A 4D1TA 3BV6A 3ADRA 4UWOB 3JXPA 4EXSA 2Y8BA 2FU7A 2Y8AA 2CFUA 4KEQA 2E7YA 3L6NA 2YNTB 4D1UA 5A0TA 2FK6A 1WUPA 3BK2A 4RAWA 3IEKA 4F6HA 2AIOA 3IE1A 4UWPB 5ACSA 3ZNBA 4C1DA 5ACTA 5K4NA 4AX1B 3ZQ4A 1L9YA 2XR1A 2YNVA 4EYLA 5HIQA 2M5CA 1YCHA 4EY2A 1QH3A 2BG8B 2BFZA 1ZTCA 2ZNBA 1WRAA 1ZKPA 5K4MA 3AJ3A 3TP9A 5EH9A 4HL2A 5HH5A 3LVZA 5LS3A 4AD9A 4YSBA 3X2ZA 4CHLA 5LCAA 4B87A 5B1UA 2BFLA 5ACPA 4DILA 4J5FA 1X8IA 4RL2A 1E5DA 4TZEA 5B3RA 2YCBA 4RL0A 4EYFA 3I11A 4FEKA 2BIBA 4BZ3A 4C1CA 4C1GA 4ZO2A 3KNRA 4V0HA 2BG7A 3BC2A 1A7TA 4NQ2A 1BMCA 2CBNA 4C1HA 5KIKA 3ESHA 5FQCA 5LE1A 2P18A 2P97A 3I0VA 5AXRA 5LSCA 2FHXB 3DHCA 2GKLA 4GYQA 4RM5A 5ACVA 2DKFA 2NYPA 2FU6A 5ACUA 4LE6A 5HIPA 5EVKA 5IQKA 2BG6A 4EYBA 3ZWFA 1X8HA 4J5HA 2GCUA 2WYLA 2P1EA 5AHRA 5EV6A 1ZNBA 4UAMA 2FU8A 3KL7A 5LCHA 4UWRB 2GFKA 4RAMA 1MQOA 1X8GA 5AIJA 5HH4A 4GYUA 1JJTA 3PY5A 3SPUA 5KILA 2BR6A 2YNTA 3IELA 3IDZA 3S0ZA 1P9EA 2NZFA 1DDKA 4C09A 5AYAA 4Z7RA 5HISA 3G1PA 5FQBA 1BVTA 2WRSA 3F9OA 5EWAA 3ZR9A 4FR7A 1Y44A 4D1WA 2I7VA 2BMIA 3I13A 2QDTA 2P4ZA 3P2UA 2BG8A 2GFJA 2YNVB 2YZ3A 5AEBA 5ACRA 2I7TA 5LMCA 4H0DA 4HL1A 1WW1A 4BP0A
chains in the Genus database with same CATH topology
4FSBA 5FQAA 3DH8A 2BFZB 3X30A 1KO3A 4PVTA 4TYTA 2NZEA 3X2XA 2QDSA 4XWWA 2QEDA 2BFKA 3SFPA 4TZBA 4WD6A 1JT1A 5HH6A 3PY6A 2OHJA 3X2YA 4Z6XA 2VW8A 3R2UA 3SRXA 3IE2A 4UA4A 5LM6A 1DXKA 2I7XA 2OHHA 2Q0IA 4NQ6A 2BC2A 4YSLA 2UYXA 2BG2A 4DIKA 1SMLA 4ZO3A 3RKJA 2DOOA 2XF4A 2YNWA 4YSKA 4AWYB 3IOFA 3AF5A 4AWZA 3FAIA 3H3EA 2R2DA 4NQ5A 2ZWRA 5A5ZA 2NXAA 5HIOA 2OHIA 4Z60A 3BK1A 4AX0B 3PG4A 5LCFA 2FU9A 2FM6A 4Z5YA 3T9MA 1QH5A 4EFZA 4RBSA 3WXCA 1DD6A 2WYMC 1M2XA 4PVOA 4JO0A 2GMNA 5AXOA 3IEMA 5EVBA 3SBLA 4D02A 4O98A 3DHBA 3DHAA 5B15A 5EVDA 1K07A 4C1FA 3I15A 5ACQA 3QH8A 4XUKA 3IE0A 4TYFA 3AF6A 4KEPA 4F6ZA 3SD9A 3SW3A 1VMEA 2Q0JA 4UBQA 1XM8A 2A7MA 5ACWA 3T3OA 2AZ4A 5A87A 4TZ9A 3FCZA 2WYMA 4HKYA 5AHOA 1JJEA 3Q6VA 4GCWA 4ZNBA 5K4KA 4UWSB 2ZO4A 2Q9UA 4Z5ZA 3MD7A 1VGNA 3RKKA 2H6AA 2M5DA 3I14A 2Q42A 2YNUA 1BC2A 2BTNA 3VQZA 1KR3A 1YCFA 4P62A 1A8TA 5DPXA 5K0WA 3KNSA 4TZFA 4U4LA 3A4YA 3RPCA 4D1VA 4Z67A 5ACXA 5LLDA 2FHXA 1KO2A 3VPEA 3IOGA 2QINA 1HLKA 4ZEJA 1XTOA 2ZZIA 4C1EA 3T3NA 1VJNA 4EXYA 1YCGA 5EV8A 5EW0A 4XWTA 5EHTA 2WHGA 2HB9A 4NQ4A 1WUOA 5A0VA 2QJSA 2BGAA 2Y87A 4D1TA 3BV6A 3ADRA 4UWOB 3JXPA 4EXSA 2Y8BA 2FU7A 2Y8AA 4KEQA 2E7YA 3L6NA 2YNTB 4D1UA 5A0TA 2FK6A 1WUPA 3BK2A 4RAWA 3IEKA 4F6HA 2AIOA 3IE1A 4UWPB 5ACSA 3ZNBA 4C1DA 5ACTA 5K4NA 4AX1B 3ZQ4A 1L9YA 2XR1A 2YNVA 4EYLA 5HIQA 2M5CA 1YCHA 4EY2A 1QH3A 2BG8B 2BFZA 1ZTCA 2ZNBA 1WRAA 1ZKPA 5K4MA 3AJ3A 3TP9A 5EH9A 4HL2A 5HH5A 3LVZA 5LS3A 4AD9A 4YSBA 3X2ZA 4CHLA 5LCAA 4B87A 5B1UA 2BFLA 5ACPA 4DILA 4J5FA 1X8IA 4RL2A 1E5DA 4TZEA 5B3RA 2YCBA 4RL0A 4EYFA 3I11A 4FEKA 2BIBA 4BZ3A 4C1CA 4C1GA 4ZO2A 3KNRA 4V0HA 2BG7A 3BC2A 1A7TA 4NQ2A 1BMCA 2CBNA 4C1HA 5KIKA 3ESHA 5FQCA 5LE1A 2P18A 2P97A 3I0VA 5AXRA 5LSCA 2FHXB 3DHCA 2GKLA 4GYQA 4RM5A 5ACVA 2DKFA 2NYPA 2FU6A 5ACUA 4LE6A 5HIPA 5EVKA 5IQKA 2BG6A 4EYBA 3ZWFA 1X8HA 4J5HA 2GCUA 2WYLA 2P1EA 5AHRA 5EV6A 1ZNBA 4UAMA 2FU8A 3KL7A 5LCHA 4UWRB 2GFKA 4RAMA 1MQOA 1X8GA 5HH4A 4GYUA 1JJTA 3PY5A 3SPUA 5KILA 2BR6A 2YNTA 3IELA 3IDZA 3S0ZA 1P9EA 2NZFA 1DDKA 4C09A 5AYAA 4Z7RA 5HISA 3G1PA 5FQBA 1BVTA 2WRSA 3F9OA 5EWAA 3ZR9A 4FR7A 1Y44A 4D1WA 2I7VA 2BMIA 3I13A 2QDTA 2P4ZA 3P2UA 2BG8A 2GFJA 2YNVB 2YZ3A 5AEBA 5ACRA 2I7TA 5LMCA 4H0DA 4HL1A 1WW1A 4BP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FSB A;  5FQA A;  3DH8 A;  2BFZ B;  3X30 A;  1KO3 A;  4PVT A;  4TYT A;  2NZE A;  3X2X A;  2QDS A;  4XWW A;  2QED A;  2BFK A;  3SFP A;  4TZB A;  4WD6 A;  1JT1 A;  5HH6 A;  3PY6 A;  2OHJ A;  3X2Y A;  4Z6X A;  2VW8 A;  3R2U A;  3SRX A;  3IE2 A;  4UA4 A;  5LM6 A;  1DXK A;  2I7X A;  2OHH A;  2Q0I A;  4NQ6 A;  2BC2 A;  4YSL A;  2UYX A;  2BG2 A;  4DIK A;  1SML A;  4ZO3 A;  3RKJ A;  2DOO A;  2XF4 A;  2YNW A;  4YSK A;  4AWY B;  3IOF A;  3AF5 A;  4AWZ A;  3FAI A;  3H3E A;  2R2D A;  4NQ5 A;  2ZWR A;  5A5Z A;  2NXA A;  5HIO A;  2OHI A;  4Z60 A;  3BK1 A;  4AX0 B;  3PG4 A;  5LCF A;  2FU9 A;  2FM6 A;  4Z5Y A;  3T9M A;  1QH5 A;  4EFZ A;  4RBS A;  3WXC A;  1DD6 A;  2WYM C;  1M2X A;  4PVO A;  4JO0 A;  2GMN A;  5AXO A;  3IEM A;  5EVB A;  3SBL A;  4D02 A;  4O98 A;  3DHB A;  3DHA A;  5B15 A;  5EVD A;  1K07 A;  4C1F A;  3I15 A;  5ACQ A;  3QH8 A;  4XUK A;  3IE0 A;  4TYF A;  3AF6 A;  4KEP A;  4F6Z A;  3SD9 A;  3SW3 A;  1VME A;  2Q0J A;  4UBQ A;  1XM8 A;  2A7M A;  5ACW A;  3T3O A;  2AZ4 A;  5A87 A;  4TZ9 A;  3FCZ A;  2WYM A;  4HKY A;  5AHO A;  1JJE A;  3Q6V A;  4GCW A;  4ZNB A;  5K4K A;  4UWS B;  2ZO4 A;  2Q9U A;  4Z5Z A;  3MD7 A;  1VGN A;  3RKK A;  2H6A A;  2M5D A;  3I14 A;  2Q42 A;  2YNU A;  1BC2 A;  2BTN A;  3VQZ A;  1KR3 A;  1YCF A;  4P62 A;  1A8T A;  5DPX A;  5K0W A;  3KNS A;  4TZF A;  4U4L A;  3A4Y A;  3RPC A;  4D1V A;  4Z67 A;  5ACX A;  5LLD A;  2FHX A;  1KO2 A;  3VPE A;  3IOG A;  2QIN A;  1HLK A;  4ZEJ A;  1XTO A;  2ZZI A;  4C1E A;  3T3N A;  1VJN A;  4EXY A;  1YCG A;  5EV8 A;  5EW0 A;  4XWT A;  5EHT A;  2WHG A;  2HB9 A;  4NQ4 A;  1WUO A;  5A0V A;  2QJS A;  2BGA A;  2Y87 A;  4D1T A;  3BV6 A;  3ADR A;  4UWO B;  3JXP A;  4EXS A;  2Y8B A;  2FU7 A;  2Y8A A;  4KEQ A;  2E7Y A;  3L6N A;  2YNT B;  4D1U A;  5A0T A;  2FK6 A;  1WUP A;  3BK2 A;  4RAW A;  3IEK A;  4F6H A;  2AIO A;  3IE1 A;  4UWP B;  5ACS A;  3ZNB A;  4C1D A;  5ACT A;  5K4N A;  4AX1 B;  3ZQ4 A;  1L9Y A;  2XR1 A;  2YNV A;  4EYL A;  5HIQ A;  2M5C A;  1YCH A;  4EY2 A;  1QH3 A;  2BG8 B;  2BFZ A;  1ZTC A;  2ZNB A;  1WRA A;  1ZKP A;  5K4M A;  3AJ3 A;  3TP9 A;  5EH9 A;  4HL2 A;  5HH5 A;  3LVZ A;  5LS3 A;  4AD9 A;  4YSB A;  3X2Z A;  4CHL A;  5LCA A;  4B87 A;  5B1U A;  2BFL A;  5ACP A;  4DIL A;  4J5F A;  1X8I A;  4RL2 A;  1E5D A;  4TZE A;  5B3R A;  2YCB A;  4RL0 A;  4EYF A;  3I11 A;  4FEK A;  2BIB A;  4BZ3 A;  4C1C A;  4C1G A;  4ZO2 A;  3KNR A;  4V0H A;  2BG7 A;  3BC2 A;  1A7T A;  4NQ2 A;  1BMC A;  2CBN A;  4C1H A;  5KIK A;  3ESH A;  5FQC A;  5LE1 A;  2P18 A;  2P97 A;  3I0V A;  5AXR A;  5LSC A;  2FHX B;  3DHC A;  2GKL A;  4GYQ A;  4RM5 A;  5ACV A;  2DKF A;  2NYP A;  2FU6 A;  5ACU A;  4LE6 A;  5HIP A;  5EVK A;  5IQK A;  2BG6 A;  4EYB A;  3ZWF A;  1X8H A;  4J5H A;  2GCU A;  2WYL A;  2P1E A;  5AHR A;  5EV6 A;  1ZNB A;  4UAM A;  2FU8 A;  3KL7 A;  5LCH A;  4UWR B;  2GFK A;  4RAM A;  1MQO A;  1X8G A;  5HH4 A;  4GYU A;  1JJT A;  3PY5 A;  3SPU A;  5KIL A;  2BR6 A;  2YNT A;  3IEL A;  3IDZ A;  3S0Z A;  1P9E A;  2NZF A;  1DDK A;  4C09 A;  5AYA A;  4Z7R A;  5HIS A;  3G1P A;  5FQB A;  1BVT A;  2WRS A;  3F9O A;  5EWA A;  3ZR9 A;  4FR7 A;  1Y44 A;  4D1W A;  2I7V A;  2BMI A;  3I13 A;  2QDT A;  2P4Z A;  3P2U A;  2BG8 A;  2GFJ A;  2YNV B;  2YZ3 A;  5AEB A;  5ACR A;  2I7T A;  5LMC A;  4H0D A;  4HL1 A;  1WW1 A;  4BP0 A; 
#chains in the Genus database with same CATH topology
 4FSB A;  5FQA A;  3DH8 A;  2BFZ B;  3X30 A;  1KO3 A;  4PVT A;  4TYT A;  2NZE A;  3X2X A;  2CG3 A;  2QDS A;  4XWW A;  2QED A;  2BFK A;  3SFP A;  4TZB A;  4WD6 A;  1JT1 A;  5HH6 A;  3PY6 A;  2OHJ A;  3X2Y A;  4Z6X A;  2VW8 A;  3R2U A;  3SRX A;  3IE2 A;  4UA4 A;  5LM6 A;  1DXK A;  2I7X A;  2OHH A;  2Q0I A;  4NQ6 A;  2BC2 A;  4YSL A;  2UYX A;  2BG2 A;  4DIK A;  1SML A;  4ZO3 A;  3RKJ A;  2DOO A;  2XF4 A;  2YNW A;  4YSK A;  4AWY B;  3IOF A;  3AF5 A;  4AWZ A;  3FAI A;  3H3E A;  2R2D A;  4NQ5 A;  2ZWR A;  5A5Z A;  2NXA A;  5HIO A;  2OHI A;  4Z60 A;  3BK1 A;  4AX0 B;  3PG4 A;  5LCF A;  2FU9 A;  2FM6 A;  4Z5Y A;  3T9M A;  4NUR A;  1QH5 A;  4AV7 A;  4EFZ A;  4RBS A;  3WXC A;  1DD6 A;  2WYM C;  1M2X A;  4PVO A;  4JO0 A;  2GMN A;  4AXH A;  5AXO A;  3IEM A;  5EVB A;  3SBL A;  4D02 A;  4O98 A;  3DHB A;  3DHA A;  5B15 A;  5EVD A;  1K07 A;  4C1F A;  3I15 A;  5ACQ A;  3QH8 A;  4XUK A;  2CFZ A;  3IE0 A;  4TYF A;  3AF6 A;  4KEP A;  4F6Z A;  3SD9 A;  3SW3 A;  1VME A;  2Q0J A;  4UBQ A;  1XM8 A;  2A7M A;  5ACW A;  3T3O A;  2AZ4 A;  5A87 A;  4PDX A;  4TZ9 A;  3FCZ A;  2WYM A;  4HKY A;  5AHO A;  5AJL A;  1JJE A;  3Q6V A;  4GCW A;  4ZNB A;  5K4K A;  4UWS B;  2ZO4 A;  2Q9U A;  4Z5Z A;  3MD7 A;  1VGN A;  3RKK A;  2H6A A;  2M5D A;  3I14 A;  2CG2 A;  2Q42 A;  2YNU A;  1BC2 A;  5A23 A;  2BTN A;  3VQZ A;  1KR3 A;  1YCF A;  4P62 A;  1A8T A;  5DPX A;  5K0W A;  3KNS A;  4TZF A;  4U4L A;  3A4Y A;  3RPC A;  4D1V A;  4Z67 A;  5ACX A;  5LLD A;  2FHX A;  1KO2 A;  3VPE A;  3IOG A;  2QIN A;  1HLK A;  4ZEJ A;  1XTO A;  2ZZI A;  4C1E A;  2YHE A;  3T3N A;  1VJN A;  4EXY A;  1YCG A;  5EV8 A;  5EW0 A;  4XWT A;  5EHT A;  2WHG A;  2HB9 A;  4NQ4 A;  1WUO A;  5A0V A;  2QJS A;  2BGA A;  2Y87 A;  4D1T A;  3BV6 A;  3ADR A;  4UWO B;  3JXP A;  4EXS A;  2Y8B A;  2FU7 A;  2Y8A A;  2CFU A;  4KEQ A;  2E7Y A;  3L6N A;  2YNT B;  4D1U A;  5A0T A;  2FK6 A;  1WUP A;  3BK2 A;  4RAW A;  3IEK A;  4F6H A;  2AIO A;  3IE1 A;  4UWP B;  5ACS A;  3ZNB A;  4C1D A;  5ACT A;  5K4N A;  4AX1 B;  3ZQ4 A;  1L9Y A;  2XR1 A;  2YNV A;  4EYL A;  5HIQ A;  2M5C A;  1YCH A;  4EY2 A;  1QH3 A;  2BG8 B;  2BFZ A;  1ZTC A;  2ZNB A;  1WRA A;  1ZKP A;  5K4M A;  3AJ3 A;  3TP9 A;  5EH9 A;  4HL2 A;  5HH5 A;  3LVZ A;  5LS3 A;  4AD9 A;  4YSB A;  3X2Z A;  4CHL A;  5LCA A;  4B87 A;  5B1U A;  2BFL A;  5ACP A;  4DIL A;  4J5F A;  1X8I A;  4RL2 A;  1E5D A;  4TZE A;  5B3R A;  2YCB A;  4RL0 A;  4EYF A;  3I11 A;  4FEK A;  2BIB A;  4BZ3 A;  4C1C A;  4C1G A;  4ZO2 A;  3KNR A;  4V0H A;  2BG7 A;  3BC2 A;  1A7T A;  4NQ2 A;  1BMC A;  2CBN A;  4C1H A;  5KIK A;  3ESH A;  5FQC A;  5LE1 A;  2P18 A;  2P97 A;  3I0V A;  5AXR A;  5LSC A;  2FHX B;  3DHC A;  2GKL A;  4GYQ A;  4RM5 A;  5ACV A;  2DKF A;  2NYP A;  2FU6 A;  5ACU A;  4LE6 A;  5HIP A;  5EVK A;  5IQK A;  2BG6 A;  4EYB A;  3ZWF A;  1X8H A;  4J5H A;  2GCU A;  2WYL A;  2P1E A;  5AHR A;  5EV6 A;  1ZNB A;  4UAM A;  2FU8 A;  3KL7 A;  5LCH A;  4UWR B;  2GFK A;  4RAM A;  1MQO A;  1X8G A;  5AIJ A;  5HH4 A;  4GYU A;  1JJT A;  3PY5 A;  3SPU A;  5KIL A;  2BR6 A;  2YNT A;  3IEL A;  3IDZ A;  3S0Z A;  1P9E A;  2NZF A;  1DDK A;  4C09 A;  5AYA A;  4Z7R A;  5HIS A;  3G1P A;  5FQB A;  1BVT A;  2WRS A;  3F9O A;  5EWA A;  3ZR9 A;  4FR7 A;  1Y44 A;  4D1W A;  2I7V A;  2BMI A;  3I13 A;  2QDT A;  2P4Z A;  3P2U A;  2BG8 A;  2GFJ A;  2YNV B;  2YZ3 A;  5AEB A;  5ACR A;  2I7T A;  5LMC A;  4H0D A;  4HL1 A;  1WW1 A;  4BP0 A; 
#chains in the Genus database with same CATH homology
 4FSB A;  5FQA A;  3DH8 A;  2BFZ B;  3X30 A;  1KO3 A;  4PVT A;  4TYT A;  2NZE A;  3X2X A;  2QDS A;  4XWW A;  2QED A;  2BFK A;  3SFP A;  4TZB A;  4WD6 A;  1JT1 A;  5HH6 A;  3PY6 A;  2OHJ A;  3X2Y A;  4Z6X A;  2VW8 A;  3R2U A;  3SRX A;  3IE2 A;  4UA4 A;  5LM6 A;  1DXK A;  2I7X A;  2OHH A;  2Q0I A;  4NQ6 A;  2BC2 A;  4YSL A;  2UYX A;  2BG2 A;  4DIK A;  1SML A;  4ZO3 A;  3RKJ A;  2DOO A;  2XF4 A;  2YNW A;  4YSK A;  4AWY B;  3IOF A;  3AF5 A;  4AWZ A;  3FAI A;  3H3E A;  2R2D A;  4NQ5 A;  2ZWR A;  5A5Z A;  2NXA A;  5HIO A;  2OHI A;  4Z60 A;  3BK1 A;  4AX0 B;  3PG4 A;  5LCF A;  2FU9 A;  2FM6 A;  4Z5Y A;  3T9M A;  1QH5 A;  4EFZ A;  4RBS A;  3WXC A;  1DD6 A;  2WYM C;  1M2X A;  4PVO A;  4JO0 A;  2GMN A;  5AXO A;  3IEM A;  5EVB A;  3SBL A;  4D02 A;  4O98 A;  3DHB A;  3DHA A;  5B15 A;  5EVD A;  1K07 A;  4C1F A;  3I15 A;  5ACQ A;  3QH8 A;  4XUK A;  3IE0 A;  4TYF A;  3AF6 A;  4KEP A;  4F6Z A;  3SD9 A;  3SW3 A;  1VME A;  2Q0J A;  4UBQ A;  1XM8 A;  2A7M A;  5ACW A;  3T3O A;  2AZ4 A;  5A87 A;  4TZ9 A;  3FCZ A;  2WYM A;  4HKY A;  5AHO A;  1JJE A;  3Q6V A;  4GCW A;  4ZNB A;  5K4K A;  4UWS B;  2ZO4 A;  2Q9U A;  4Z5Z A;  3MD7 A;  1VGN A;  3RKK A;  2H6A A;  2M5D A;  3I14 A;  2Q42 A;  2YNU A;  1BC2 A;  2BTN A;  3VQZ A;  1KR3 A;  1YCF A;  4P62 A;  1A8T A;  5DPX A;  5K0W A;  3KNS A;  4TZF A;  4U4L A;  3A4Y A;  3RPC A;  4D1V A;  4Z67 A;  5ACX A;  5LLD A;  2FHX A;  1KO2 A;  3VPE A;  3IOG A;  2QIN A;  1HLK A;  4ZEJ A;  1XTO A;  2ZZI A;  4C1E A;  3T3N A;  1VJN A;  4EXY A;  1YCG A;  5EV8 A;  5EW0 A;  4XWT A;  5EHT A;  2WHG A;  2HB9 A;  4NQ4 A;  1WUO A;  5A0V A;  2QJS A;  2BGA A;  2Y87 A;  4D1T A;  3BV6 A;  3ADR A;  4UWO B;  3JXP A;  4EXS A;  2Y8B A;  2FU7 A;  2Y8A A;  4KEQ A;  2E7Y A;  3L6N A;  2YNT B;  4D1U A;  5A0T A;  2FK6 A;  1WUP A;  3BK2 A;  4RAW A;  3IEK A;  4F6H A;  2AIO A;  3IE1 A;  4UWP B;  5ACS A;  3ZNB A;  4C1D A;  5ACT A;  5K4N A;  4AX1 B;  3ZQ4 A;  1L9Y A;  2XR1 A;  2YNV A;  4EYL A;  5HIQ A;  2M5C A;  1YCH A;  4EY2 A;  1QH3 A;  2BG8 B;  2BFZ A;  1ZTC A;  2ZNB A;  1WRA A;  1ZKP A;  5K4M A;  3AJ3 A;  3TP9 A;  5EH9 A;  4HL2 A;  5HH5 A;  3LVZ A;  5LS3 A;  4AD9 A;  4YSB A;  3X2Z A;  4CHL A;  5LCA A;  4B87 A;  5B1U A;  2BFL A;  5ACP A;  4DIL A;  4J5F A;  1X8I A;  4RL2 A;  1E5D A;  4TZE A;  5B3R A;  2YCB A;  4RL0 A;  4EYF A;  3I11 A;  4FEK A;  2BIB A;  4BZ3 A;  4C1C A;  4C1G A;  4ZO2 A;  3KNR A;  4V0H A;  2BG7 A;  3BC2 A;  1A7T A;  4NQ2 A;  1BMC A;  2CBN A;  4C1H A;  5KIK A;  3ESH A;  5FQC A;  5LE1 A;  2P18 A;  2P97 A;  3I0V A;  5AXR A;  5LSC A;  2FHX B;  3DHC A;  2GKL A;  4GYQ A;  4RM5 A;  5ACV A;  2DKF A;  2NYP A;  2FU6 A;  5ACU A;  4LE6 A;  5HIP A;  5EVK A;  5IQK A;  2BG6 A;  4EYB A;  3ZWF A;  1X8H A;  4J5H A;  2GCU A;  2WYL A;  2P1E A;  5AHR A;  5EV6 A;  1ZNB A;  4UAM A;  2FU8 A;  3KL7 A;  5LCH A;  4UWR B;  2GFK A;  4RAM A;  1MQO A;  1X8G A;  5HH4 A;  4GYU A;  1JJT A;  3PY5 A;  3SPU A;  5KIL A;  2BR6 A;  2YNT A;  3IEL A;  3IDZ A;  3S0Z A;  1P9E A;  2NZF A;  1DDK A;  4C09 A;  5AYA A;  4Z7R A;  5HIS A;  3G1P A;  5FQB A;  1BVT A;  2WRS A;  3F9O A;  5EWA A;  3ZR9 A;  4FR7 A;  1Y44 A;  4D1W A;  2I7V A;  2BMI A;  3I13 A;  2QDT A;  2P4Z A;  3P2U A;  2BG8 A;  2GFJ A;  2YNV B;  2YZ3 A;  5AEB A;  5ACR A;  2I7T A;  5LMC A;  4H0D A;  4HL1 A;  1WW1 A;  4BP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...