4Z60A

The 2.5-angstrom of crystal structure of zn(2+)-bound pqqb from pseudomonas putida
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
total genus 100
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z60A00
2AZ4A 3T9MA 2OHHA 2BFLA 2BIBA 2AIOA 5ACWA 3H3EA 1YCFA 1JT1A 2QDSA 1ZTCA 2NXAA 1X8HA 5EVDA 3FAIA 5IQKA 1KO3A 2QINA 3JXPA 2R2DA 3IOFA 5A5ZA 2BGAA 4XWWA 1WUOA 2I7VA 4ZO2A 3RKKA 2YCBA 3R2UA 5AHRA 4GCWA 1YCGA 2YNVA 1DD6A 5HIPA 2BG6A 5ACTA 1XTOA 3MD7A 5LCHA 3KNRA 3S0ZA 4F6HA 2BFZA 4UAMA 5B15A 3I15A 1SMLA 1DXKA 3I13A 4NQ5A 3X30A 4D1TA 4RL0A 1BC2A 2BFKA 2OHJA 3RPCA 4YSLA 1WRAA 4J5HA 1XM8A 1M2XA 3KNSA 5EV8A 2BG7A 2NZFA 4UBQA 4HKYA 5EVKA 2GCUA 4CHLA 3X2ZA 3IDZA 4Z6XA 4NQ2A 4KEPA 4JO0A 3ADRA 4C1GA 5FQAA 5B3RA 4UA4A 3I0VA 2BC2A 5FQBA 5LCAA 4D1VA 3I14A 4EXSA 3VPEA 1BVTA 2QJSA 3T3OA 5B1UA 5DPXA 2FK6A 3QH8A 3AF6A 3WXCA 4RM5A 1JJTA 4FR7A 3KL7A 3IELA 4EYLA 3ESHA 3L6NA 5EWAA 5HIQA 3BK1A 2Q42A 2BTNA 4C1HA 4F6ZA 2ZZIA 4AX1B 3ZNBA 3IOGA 2NZEA 1BMCA 3SD9A 3X2XA 4EY2A 3SPUA 3DH8A 3RKJA 2ZWRA 2P1EA 2Y87A 4Z7RA 4J5FA 5K4NA 1VGNA 4BP0A 4EYBA 5ACSA 2QEDA 5HIOA 2P18A 4D02A 5ACRA 1L9YA 2E7YA 4HL1A 5ACVA 4BZ3A 5A0TA 2ZNBA 4RAWA 5K4MA 4XWTA 2DOOA 5K0WA 4AWZA 3BC2A 3AF5A 2XF4A 4DILA 3ZQ4A 4C1DA 5LMCA 4C1EA 2GMNA 4EFZA 1X8IA 5EHTA 4PVOA 5KILA 4UWRB 5AHOA 4UWPB 2GKLA 2FU9A 2YNUA 3BK2A 5AEBA 4TYTA 5EVBA 3BV6A 4RAMA 2VW8A 5LCFA 5HISA 5ACPA 3PG4A 1HLKA 3SRXA 1X8GA 5LM6A 2I7TA 1ZKPA 2FU8A 1P9EA 4GYQA 3Q6VA 2UYXA 3AJ3A 4UWSB 4Z60A 2XR1A 1WUPA 3FCZA 4LE6A 2HB9A 2WRSA 4Z5YA 2BMIA 4Z67A 1E5DA 4GYUA 5HH6A 5AXOA 2H6AA 5HH4A 2M5DA 2FHXB 4DIKA 3F9OA 2ZO4A 5K4KA 4PVTA 2Q0JA 4YSKA 2A7MA 3SFPA 4RBSA 5LLDA 2WYMA 5AXRA 4ZEJA 2YZ3A 4RL2A 1A8TA 2QDTA 3PY6A 4FSBA 3SW3A 3IEKA 5HH5A 2FU7A 4EYFA 2WYMC 4O98A 2FU6A 5LS3A 2WYLA 4AX0B 1K07A 2NYPA 5AYAA 1Y44A 3IE0A 3PY5A 2OHIA 4TYFA 4C1FA 2BR6A 4XUKA 5FQCA 2P97A 1KO2A 1YCHA 3ZWFA 4TZ9A 4YSBA 4ZNBA 4NQ6A 2P4ZA 1JJEA 3T3NA 4HL2A 4V0HA 5EV6A 2BG2A 2FHXA 2YNTB 3DHBA 4UWOB 4U4LA 2GFKA 2Y8AA 4TZFA 3VQZA 1KR3A 2Y8BA 5LE1A 1DDKA 4C09A 3TP9A 2Q9UA 3G1PA 4D1WA 2BG8B 1QH3A 2CBNA 3X2YA 5EH9A 4H0DA 4EXYA 3ZR9A 4ZO3A 3DHCA 4WD6A 1QH5A 2DKFA 4Z5ZA 5A87A 4C1CA 3IEMA 5ACXA 2Q0IA 3I11A 3DHAA 2FM6A 5A0VA 4D1UA 4TZBA 2WHGA 3SBLA 5ACUA 2YNTA 3A4YA 2GFJA 3P2UA 1ZNBA 5EW0A 3LVZA 3IE2A 1VMEA 2YNWA 1WW1A 4AWYB 4KEQA 5KIKA 1VJNA 5ACQA 2I7XA 4TZEA 2BG8A 2M5CA 4NQ4A 2YNVB 4AD9A 1MQOA 1A7TA 5LSCA 4B87A 2BFZB 4FEKA 4P62A 3IE1A
chains in the Genus database with same CATH superfamily
2AZ4A 3T9MA 2OHHA 2BFLA 2BIBA 2AIOA 5ACWA 3H3EA 1YCFA 1JT1A 2QDSA 1ZTCA 2NXAA 1X8HA 5EVDA 3FAIA 5IQKA 1KO3A 2QINA 3JXPA 2R2DA 3IOFA 5A5ZA 2BGAA 4XWWA 1WUOA 2I7VA 4ZO2A 3RKKA 2YCBA 3R2UA 5AHRA 4GCWA 1YCGA 2YNVA 1DD6A 5HIPA 2BG6A 5ACTA 1XTOA 3MD7A 5LCHA 3KNRA 3S0ZA 4F6HA 2BFZA 4UAMA 5B15A 3I15A 1SMLA 1DXKA 3I13A 4NQ5A 3X30A 4D1TA 4RL0A 1BC2A 2BFKA 2OHJA 3RPCA 4YSLA 1WRAA 4J5HA 1XM8A 1M2XA 3KNSA 5EV8A 2BG7A 2NZFA 4UBQA 4HKYA 5EVKA 2GCUA 4CHLA 4PDXA 3X2ZA 3IDZA 4Z6XA 4NQ2A 4KEPA 4JO0A 3ADRA 4C1GA 5FQAA 5B3RA 4UA4A 3I0VA 2BC2A 5FQBA 5LCAA 4D1VA 3I14A 4EXSA 4AXHA 3VPEA 1BVTA 2QJSA 3T3OA 5B1UA 5DPXA 2FK6A 3QH8A 3AF6A 3WXCA 4RM5A 1JJTA 4FR7A 3KL7A 3IELA 4EYLA 3ESHA 3L6NA 5EWAA 5HIQA 3BK1A 2Q42A 2BTNA 4C1HA 4F6ZA 2ZZIA 4AX1B 3ZNBA 3IOGA 2NZEA 1BMCA 2YHEA 3SD9A 3X2XA 4EY2A 3SPUA 3DH8A 3RKJA 2ZWRA 2P1EA 2Y87A 4Z7RA 4J5FA 5K4NA 1VGNA 4BP0A 4EYBA 5ACSA 2QEDA 5HIOA 2P18A 4D02A 5ACRA 1L9YA 2E7YA 4HL1A 5ACVA 4BZ3A 5A0TA 2ZNBA 4RAWA 5K4MA 4XWTA 2DOOA 5K0WA 4AWZA 3BC2A 3AF5A 2XF4A 4DILA 3ZQ4A 4C1DA 5LMCA 4C1EA 2GMNA 4EFZA 1X8IA 5EHTA 4PVOA 5KILA 4UWRB 5AHOA 4UWPB 2GKLA 2FU9A 2YNUA 3BK2A 5AJLA 5AEBA 4TYTA 5EVBA 3BV6A 4RAMA 2VW8A 5LCFA 5HISA 5ACPA 3PG4A 1HLKA 3SRXA 1X8GA 5LM6A 2I7TA 1ZKPA 2FU8A 1P9EA 4GYQA 3Q6VA 2UYXA 3AJ3A 4UWSB 4Z60A 4AV7A 2XR1A 1WUPA 5AIJA 3FCZA 4LE6A 2HB9A 2WRSA 4Z5YA 2BMIA 5A23A 4Z67A 1E5DA 4GYUA 5HH6A 5AXOA 2H6AA 5HH4A 2M5DA 2FHXB 4DIKA 3F9OA 2ZO4A 5K4KA 4PVTA 2Q0JA 4YSKA 2A7MA 3SFPA 4RBSA 5LLDA 2WYMA 5AXRA 4ZEJA 2CG3A 2YZ3A 4RL2A 1A8TA 2QDTA 3PY6A 4FSBA 3SW3A 3IEKA 5HH5A 2FU7A 2CFZA 4EYFA 2WYMC 4O98A 2FU6A 5LS3A 2WYLA 4AX0B 2CG2A 1K07A 2NYPA 5AYAA 1Y44A 3IE0A 3PY5A 2OHIA 4TYFA 4C1FA 2BR6A 4XUKA 5FQCA 2CFUA 2P97A 1KO2A 1YCHA 3ZWFA 4NURA 4TZ9A 4YSBA 4ZNBA 4NQ6A 2P4ZA 1JJEA 3T3NA 4HL2A 4V0HA 5EV6A 2BG2A 2FHXA 2YNTB 3DHBA 4UWOB 4U4LA 2GFKA 2Y8AA 4TZFA 3VQZA 1KR3A 2Y8BA 5LE1A 1DDKA 4C09A 3TP9A 2Q9UA 3G1PA 4D1WA 2BG8B 1QH3A 2CBNA 3X2YA 5EH9A 4H0DA 4EXYA 3ZR9A 4ZO3A 3DHCA 4WD6A 1QH5A 2DKFA 4Z5ZA 5A87A 4C1CA 3IEMA 5ACXA 2Q0IA 3I11A 3DHAA 2FM6A 5A0VA 4D1UA 4TZBA 2WHGA 3SBLA 5ACUA 2YNTA 3A4YA 2GFJA 3P2UA 1ZNBA 5EW0A 3LVZA 3IE2A 1VMEA 2YNWA 1WW1A 4AWYB 4KEQA 5KIKA 1VJNA 5ACQA 2I7XA 4TZEA 2BG8A 2M5CA 4NQ4A 2YNVB 4AD9A 1MQOA 1A7TA 5LSCA 4B87A 2BFZB 4FEKA 4P62A 3IE1A
chains in the Genus database with same CATH topology
2AZ4A 3T9MA 2OHHA 2BFLA 2BIBA 2AIOA 5ACWA 3H3EA 1YCFA 1JT1A 2QDSA 1ZTCA 2NXAA 1X8HA 5EVDA 3FAIA 5IQKA 1KO3A 2QINA 3JXPA 2R2DA 3IOFA 5A5ZA 2BGAA 4XWWA 1WUOA 2I7VA 4ZO2A 3RKKA 2YCBA 3R2UA 5AHRA 4GCWA 1YCGA 2YNVA 1DD6A 5HIPA 2BG6A 5ACTA 1XTOA 3MD7A 5LCHA 3KNRA 3S0ZA 4F6HA 2BFZA 4UAMA 5B15A 3I15A 1SMLA 1DXKA 3I13A 4NQ5A 3X30A 4D1TA 4RL0A 1BC2A 2BFKA 2OHJA 3RPCA 4YSLA 1WRAA 4J5HA 1XM8A 1M2XA 3KNSA 5EV8A 2BG7A 2NZFA 4UBQA 4HKYA 5EVKA 2GCUA 4CHLA 3X2ZA 3IDZA 4Z6XA 4NQ2A 4KEPA 4JO0A 3ADRA 4C1GA 5FQAA 5B3RA 4UA4A 3I0VA 2BC2A 5FQBA 5LCAA 4D1VA 3I14A 4EXSA 3VPEA 1BVTA 2QJSA 3T3OA 5B1UA 5DPXA 2FK6A 3QH8A 3AF6A 3WXCA 4RM5A 1JJTA 4FR7A 3KL7A 3IELA 4EYLA 3ESHA 3L6NA 5EWAA 5HIQA 3BK1A 2Q42A 2BTNA 4C1HA 4F6ZA 2ZZIA 4AX1B 3ZNBA 3IOGA 2NZEA 1BMCA 3SD9A 3X2XA 4EY2A 3SPUA 3DH8A 3RKJA 2ZWRA 2P1EA 2Y87A 4Z7RA 4J5FA 5K4NA 1VGNA 4BP0A 4EYBA 5ACSA 2QEDA 5HIOA 2P18A 4D02A 5ACRA 1L9YA 2E7YA 4HL1A 5ACVA 4BZ3A 5A0TA 2ZNBA 4RAWA 5K4MA 4XWTA 2DOOA 5K0WA 4AWZA 3BC2A 3AF5A 2XF4A 4DILA 3ZQ4A 4C1DA 5LMCA 4C1EA 2GMNA 4EFZA 1X8IA 5EHTA 4PVOA 5KILA 4UWRB 5AHOA 4UWPB 2GKLA 2FU9A 2YNUA 3BK2A 5AEBA 4TYTA 5EVBA 3BV6A 4RAMA 2VW8A 5LCFA 5HISA 5ACPA 3PG4A 1HLKA 3SRXA 1X8GA 5LM6A 2I7TA 1ZKPA 2FU8A 1P9EA 4GYQA 3Q6VA 2UYXA 3AJ3A 4UWSB 4Z60A 2XR1A 1WUPA 3FCZA 4LE6A 2HB9A 2WRSA 4Z5YA 2BMIA 4Z67A 1E5DA 4GYUA 5HH6A 5AXOA 2H6AA 5HH4A 2M5DA 2FHXB 4DIKA 3F9OA 2ZO4A 5K4KA 4PVTA 2Q0JA 4YSKA 2A7MA 3SFPA 4RBSA 5LLDA 2WYMA 5AXRA 4ZEJA 2YZ3A 4RL2A 1A8TA 2QDTA 3PY6A 4FSBA 3SW3A 3IEKA 5HH5A 2FU7A 4EYFA 2WYMC 4O98A 2FU6A 5LS3A 2WYLA 4AX0B 1K07A 2NYPA 5AYAA 1Y44A 3IE0A 3PY5A 2OHIA 4TYFA 4C1FA 2BR6A 4XUKA 5FQCA 2P97A 1KO2A 1YCHA 3ZWFA 4TZ9A 4YSBA 4ZNBA 4NQ6A 2P4ZA 1JJEA 3T3NA 4HL2A 4V0HA 5EV6A 2BG2A 2FHXA 2YNTB 3DHBA 4UWOB 4U4LA 2GFKA 2Y8AA 4TZFA 3VQZA 1KR3A 2Y8BA 5LE1A 1DDKA 4C09A 3TP9A 2Q9UA 3G1PA 4D1WA 2BG8B 1QH3A 2CBNA 3X2YA 5EH9A 4H0DA 4EXYA 3ZR9A 4ZO3A 3DHCA 4WD6A 1QH5A 2DKFA 4Z5ZA 5A87A 4C1CA 3IEMA 5ACXA 2Q0IA 3I11A 3DHAA 2FM6A 5A0VA 4D1UA 4TZBA 2WHGA 3SBLA 5ACUA 2YNTA 3A4YA 2GFJA 3P2UA 1ZNBA 5EW0A 3LVZA 3IE2A 1VMEA 2YNWA 1WW1A 4AWYB 4KEQA 5KIKA 1VJNA 5ACQA 2I7XA 4TZEA 2BG8A 2M5CA 4NQ4A 2YNVB 4AD9A 1MQOA 1A7TA 5LSCA 4B87A 2BFZB 4FEKA 4P62A 3IE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ4 A;  3T9M A;  2OHH A;  2BFL A;  2BIB A;  2AIO A;  5ACW A;  3H3E A;  1YCF A;  1JT1 A;  2QDS A;  1ZTC A;  2NXA A;  1X8H A;  5EVD A;  3FAI A;  5IQK A;  1KO3 A;  2QIN A;  3JXP A;  2R2D A;  3IOF A;  5A5Z A;  2BGA A;  4XWW A;  1WUO A;  2I7V A;  4ZO2 A;  3RKK A;  2YCB A;  3R2U A;  5AHR A;  4GCW A;  1YCG A;  2YNV A;  1DD6 A;  5HIP A;  2BG6 A;  5ACT A;  1XTO A;  3MD7 A;  5LCH A;  3KNR A;  3S0Z A;  4F6H A;  2BFZ A;  4UAM A;  5B15 A;  3I15 A;  1SML A;  1DXK A;  3I13 A;  4NQ5 A;  3X30 A;  4D1T A;  4RL0 A;  1BC2 A;  2BFK A;  2OHJ A;  3RPC A;  4YSL A;  1WRA A;  4J5H A;  1XM8 A;  1M2X A;  3KNS A;  5EV8 A;  2BG7 A;  2NZF A;  4UBQ A;  4HKY A;  5EVK A;  2GCU A;  4CHL A;  3X2Z A;  3IDZ A;  4Z6X A;  4NQ2 A;  4KEP A;  4JO0 A;  3ADR A;  4C1G A;  5FQA A;  5B3R A;  4UA4 A;  3I0V A;  2BC2 A;  5FQB A;  5LCA A;  4D1V A;  3I14 A;  4EXS A;  3VPE A;  1BVT A;  2QJS A;  3T3O A;  5B1U A;  5DPX A;  2FK6 A;  3QH8 A;  3AF6 A;  3WXC A;  4RM5 A;  1JJT A;  4FR7 A;  3KL7 A;  3IEL A;  4EYL A;  3ESH A;  3L6N A;  5EWA A;  5HIQ A;  3BK1 A;  2Q42 A;  2BTN A;  4C1H A;  4F6Z A;  2ZZI A;  4AX1 B;  3ZNB A;  3IOG A;  2NZE A;  1BMC A;  3SD9 A;  3X2X A;  4EY2 A;  3SPU A;  3DH8 A;  3RKJ A;  2ZWR A;  2P1E A;  2Y87 A;  4Z7R A;  4J5F A;  5K4N A;  1VGN A;  4BP0 A;  4EYB A;  5ACS A;  2QED A;  5HIO A;  2P18 A;  4D02 A;  5ACR A;  1L9Y A;  2E7Y A;  4HL1 A;  5ACV A;  4BZ3 A;  5A0T A;  2ZNB A;  4RAW A;  5K4M A;  4XWT A;  2DOO A;  5K0W A;  4AWZ A;  3BC2 A;  3AF5 A;  2XF4 A;  4DIL A;  3ZQ4 A;  4C1D A;  5LMC A;  4C1E A;  2GMN A;  4EFZ A;  1X8I A;  5EHT A;  4PVO A;  5KIL A;  4UWR B;  5AHO A;  4UWP B;  2GKL A;  2FU9 A;  2YNU A;  3BK2 A;  5AEB A;  4TYT A;  5EVB A;  3BV6 A;  4RAM A;  2VW8 A;  5LCF A;  5HIS A;  5ACP A;  3PG4 A;  1HLK A;  3SRX A;  1X8G A;  5LM6 A;  2I7T A;  1ZKP A;  2FU8 A;  1P9E A;  4GYQ A;  3Q6V A;  2UYX A;  3AJ3 A;  4UWS B;  4Z60 A;  2XR1 A;  1WUP A;  3FCZ A;  4LE6 A;  2HB9 A;  2WRS A;  4Z5Y A;  2BMI A;  4Z67 A;  1E5D A;  4GYU A;  5HH6 A;  5AXO A;  2H6A A;  5HH4 A;  2M5D A;  2FHX B;  4DIK A;  3F9O A;  2ZO4 A;  5K4K A;  4PVT A;  2Q0J A;  4YSK A;  2A7M A;  3SFP A;  4RBS A;  5LLD A;  2WYM A;  5AXR A;  4ZEJ A;  2YZ3 A;  4RL2 A;  1A8T A;  2QDT A;  3PY6 A;  4FSB A;  3SW3 A;  3IEK A;  5HH5 A;  2FU7 A;  4EYF A;  2WYM C;  4O98 A;  2FU6 A;  5LS3 A;  2WYL A;  4AX0 B;  1K07 A;  2NYP A;  5AYA A;  1Y44 A;  3IE0 A;  3PY5 A;  2OHI A;  4TYF A;  4C1F A;  2BR6 A;  4XUK A;  5FQC A;  2P97 A;  1KO2 A;  1YCH A;  3ZWF A;  4TZ9 A;  4YSB A;  4ZNB A;  4NQ6 A;  2P4Z A;  1JJE A;  3T3N A;  4HL2 A;  4V0H A;  5EV6 A;  2BG2 A;  2FHX A;  2YNT B;  3DHB A;  4UWO B;  4U4L A;  2GFK A;  2Y8A A;  4TZF A;  3VQZ A;  1KR3 A;  2Y8B A;  5LE1 A;  1DDK A;  4C09 A;  3TP9 A;  2Q9U A;  3G1P A;  4D1W A;  2BG8 B;  1QH3 A;  2CBN A;  3X2Y A;  5EH9 A;  4H0D A;  4EXY A;  3ZR9 A;  4ZO3 A;  3DHC A;  4WD6 A;  1QH5 A;  2DKF A;  4Z5Z A;  5A87 A;  4C1C A;  3IEM A;  5ACX A;  2Q0I A;  3I11 A;  3DHA A;  2FM6 A;  5A0V A;  4D1U A;  4TZB A;  2WHG A;  3SBL A;  5ACU A;  2YNT A;  3A4Y A;  2GFJ A;  3P2U A;  1ZNB A;  5EW0 A;  3LVZ A;  3IE2 A;  1VME A;  2YNW A;  1WW1 A;  4AWY B;  4KEQ A;  5KIK A;  1VJN A;  5ACQ A;  2I7X A;  4TZE A;  2BG8 A;  2M5C A;  4NQ4 A;  2YNV B;  4AD9 A;  1MQO A;  1A7T A;  5LSC A;  4B87 A;  2BFZ B;  4FEK A;  4P62 A;  3IE1 A; 
#chains in the Genus database with same CATH topology
 2AZ4 A;  3T9M A;  2OHH A;  2BFL A;  2BIB A;  2AIO A;  5ACW A;  3H3E A;  1YCF A;  1JT1 A;  2QDS A;  1ZTC A;  2NXA A;  1X8H A;  5EVD A;  3FAI A;  5IQK A;  1KO3 A;  2QIN A;  3JXP A;  2R2D A;  3IOF A;  5A5Z A;  2BGA A;  4XWW A;  1WUO A;  2I7V A;  4ZO2 A;  3RKK A;  2YCB A;  3R2U A;  5AHR A;  4GCW A;  1YCG A;  2YNV A;  1DD6 A;  5HIP A;  2BG6 A;  5ACT A;  1XTO A;  3MD7 A;  5LCH A;  3KNR A;  3S0Z A;  4F6H A;  2BFZ A;  4UAM A;  5B15 A;  3I15 A;  1SML A;  1DXK A;  3I13 A;  4NQ5 A;  3X30 A;  4D1T A;  4RL0 A;  1BC2 A;  2BFK A;  2OHJ A;  3RPC A;  4YSL A;  1WRA A;  4J5H A;  1XM8 A;  1M2X A;  3KNS A;  5EV8 A;  2BG7 A;  2NZF A;  4UBQ A;  4HKY A;  5EVK A;  2GCU A;  4CHL A;  4PDX A;  3X2Z A;  3IDZ A;  4Z6X A;  4NQ2 A;  4KEP A;  4JO0 A;  3ADR A;  4C1G A;  5FQA A;  5B3R A;  4UA4 A;  3I0V A;  2BC2 A;  5FQB A;  5LCA A;  4D1V A;  3I14 A;  4EXS A;  4AXH A;  3VPE A;  1BVT A;  2QJS A;  3T3O A;  5B1U A;  5DPX A;  2FK6 A;  3QH8 A;  3AF6 A;  3WXC A;  4RM5 A;  1JJT A;  4FR7 A;  3KL7 A;  3IEL A;  4EYL A;  3ESH A;  3L6N A;  5EWA A;  5HIQ A;  3BK1 A;  2Q42 A;  2BTN A;  4C1H A;  4F6Z A;  2ZZI A;  4AX1 B;  3ZNB A;  3IOG A;  2NZE A;  1BMC A;  2YHE A;  3SD9 A;  3X2X A;  4EY2 A;  3SPU A;  3DH8 A;  3RKJ A;  2ZWR A;  2P1E A;  2Y87 A;  4Z7R A;  4J5F A;  5K4N A;  1VGN A;  4BP0 A;  4EYB A;  5ACS A;  2QED A;  5HIO A;  2P18 A;  4D02 A;  5ACR A;  1L9Y A;  2E7Y A;  4HL1 A;  5ACV A;  4BZ3 A;  5A0T A;  2ZNB A;  4RAW A;  5K4M A;  4XWT A;  2DOO A;  5K0W A;  4AWZ A;  3BC2 A;  3AF5 A;  2XF4 A;  4DIL A;  3ZQ4 A;  4C1D A;  5LMC A;  4C1E A;  2GMN A;  4EFZ A;  1X8I A;  5EHT A;  4PVO A;  5KIL A;  4UWR B;  5AHO A;  4UWP B;  2GKL A;  2FU9 A;  2YNU A;  3BK2 A;  5AJL A;  5AEB A;  4TYT A;  5EVB A;  3BV6 A;  4RAM A;  2VW8 A;  5LCF A;  5HIS A;  5ACP A;  3PG4 A;  1HLK A;  3SRX A;  1X8G A;  5LM6 A;  2I7T A;  1ZKP A;  2FU8 A;  1P9E A;  4GYQ A;  3Q6V A;  2UYX A;  3AJ3 A;  4UWS B;  4Z60 A;  4AV7 A;  2XR1 A;  1WUP A;  5AIJ A;  3FCZ A;  4LE6 A;  2HB9 A;  2WRS A;  4Z5Y A;  2BMI A;  5A23 A;  4Z67 A;  1E5D A;  4GYU A;  5HH6 A;  5AXO A;  2H6A A;  5HH4 A;  2M5D A;  2FHX B;  4DIK A;  3F9O A;  2ZO4 A;  5K4K A;  4PVT A;  2Q0J A;  4YSK A;  2A7M A;  3SFP A;  4RBS A;  5LLD A;  2WYM A;  5AXR A;  4ZEJ A;  2CG3 A;  2YZ3 A;  4RL2 A;  1A8T A;  2QDT A;  3PY6 A;  4FSB A;  3SW3 A;  3IEK A;  5HH5 A;  2FU7 A;  2CFZ A;  4EYF A;  2WYM C;  4O98 A;  2FU6 A;  5LS3 A;  2WYL A;  4AX0 B;  2CG2 A;  1K07 A;  2NYP A;  5AYA A;  1Y44 A;  3IE0 A;  3PY5 A;  2OHI A;  4TYF A;  4C1F A;  2BR6 A;  4XUK A;  5FQC A;  2CFU A;  2P97 A;  1KO2 A;  1YCH A;  3ZWF A;  4NUR A;  4TZ9 A;  4YSB A;  4ZNB A;  4NQ6 A;  2P4Z A;  1JJE A;  3T3N A;  4HL2 A;  4V0H A;  5EV6 A;  2BG2 A;  2FHX A;  2YNT B;  3DHB A;  4UWO B;  4U4L A;  2GFK A;  2Y8A A;  4TZF A;  3VQZ A;  1KR3 A;  2Y8B A;  5LE1 A;  1DDK A;  4C09 A;  3TP9 A;  2Q9U A;  3G1P A;  4D1W A;  2BG8 B;  1QH3 A;  2CBN A;  3X2Y A;  5EH9 A;  4H0D A;  4EXY A;  3ZR9 A;  4ZO3 A;  3DHC A;  4WD6 A;  1QH5 A;  2DKF A;  4Z5Z A;  5A87 A;  4C1C A;  3IEM A;  5ACX A;  2Q0I A;  3I11 A;  3DHA A;  2FM6 A;  5A0V A;  4D1U A;  4TZB A;  2WHG A;  3SBL A;  5ACU A;  2YNT A;  3A4Y A;  2GFJ A;  3P2U A;  1ZNB A;  5EW0 A;  3LVZ A;  3IE2 A;  1VME A;  2YNW A;  1WW1 A;  4AWY B;  4KEQ A;  5KIK A;  1VJN A;  5ACQ A;  2I7X A;  4TZE A;  2BG8 A;  2M5C A;  4NQ4 A;  2YNV B;  4AD9 A;  1MQO A;  1A7T A;  5LSC A;  4B87 A;  2BFZ B;  4FEK A;  4P62 A;  3IE1 A; 
#chains in the Genus database with same CATH homology
 2AZ4 A;  3T9M A;  2OHH A;  2BFL A;  2BIB A;  2AIO A;  5ACW A;  3H3E A;  1YCF A;  1JT1 A;  2QDS A;  1ZTC A;  2NXA A;  1X8H A;  5EVD A;  3FAI A;  5IQK A;  1KO3 A;  2QIN A;  3JXP A;  2R2D A;  3IOF A;  5A5Z A;  2BGA A;  4XWW A;  1WUO A;  2I7V A;  4ZO2 A;  3RKK A;  2YCB A;  3R2U A;  5AHR A;  4GCW A;  1YCG A;  2YNV A;  1DD6 A;  5HIP A;  2BG6 A;  5ACT A;  1XTO A;  3MD7 A;  5LCH A;  3KNR A;  3S0Z A;  4F6H A;  2BFZ A;  4UAM A;  5B15 A;  3I15 A;  1SML A;  1DXK A;  3I13 A;  4NQ5 A;  3X30 A;  4D1T A;  4RL0 A;  1BC2 A;  2BFK A;  2OHJ A;  3RPC A;  4YSL A;  1WRA A;  4J5H A;  1XM8 A;  1M2X A;  3KNS A;  5EV8 A;  2BG7 A;  2NZF A;  4UBQ A;  4HKY A;  5EVK A;  2GCU A;  4CHL A;  3X2Z A;  3IDZ A;  4Z6X A;  4NQ2 A;  4KEP A;  4JO0 A;  3ADR A;  4C1G A;  5FQA A;  5B3R A;  4UA4 A;  3I0V A;  2BC2 A;  5FQB A;  5LCA A;  4D1V A;  3I14 A;  4EXS A;  3VPE A;  1BVT A;  2QJS A;  3T3O A;  5B1U A;  5DPX A;  2FK6 A;  3QH8 A;  3AF6 A;  3WXC A;  4RM5 A;  1JJT A;  4FR7 A;  3KL7 A;  3IEL A;  4EYL A;  3ESH A;  3L6N A;  5EWA A;  5HIQ A;  3BK1 A;  2Q42 A;  2BTN A;  4C1H A;  4F6Z A;  2ZZI A;  4AX1 B;  3ZNB A;  3IOG A;  2NZE A;  1BMC A;  3SD9 A;  3X2X A;  4EY2 A;  3SPU A;  3DH8 A;  3RKJ A;  2ZWR A;  2P1E A;  2Y87 A;  4Z7R A;  4J5F A;  5K4N A;  1VGN A;  4BP0 A;  4EYB A;  5ACS A;  2QED A;  5HIO A;  2P18 A;  4D02 A;  5ACR A;  1L9Y A;  2E7Y A;  4HL1 A;  5ACV A;  4BZ3 A;  5A0T A;  2ZNB A;  4RAW A;  5K4M A;  4XWT A;  2DOO A;  5K0W A;  4AWZ A;  3BC2 A;  3AF5 A;  2XF4 A;  4DIL A;  3ZQ4 A;  4C1D A;  5LMC A;  4C1E A;  2GMN A;  4EFZ A;  1X8I A;  5EHT A;  4PVO A;  5KIL A;  4UWR B;  5AHO A;  4UWP B;  2GKL A;  2FU9 A;  2YNU A;  3BK2 A;  5AEB A;  4TYT A;  5EVB A;  3BV6 A;  4RAM A;  2VW8 A;  5LCF A;  5HIS A;  5ACP A;  3PG4 A;  1HLK A;  3SRX A;  1X8G A;  5LM6 A;  2I7T A;  1ZKP A;  2FU8 A;  1P9E A;  4GYQ A;  3Q6V A;  2UYX A;  3AJ3 A;  4UWS B;  4Z60 A;  2XR1 A;  1WUP A;  3FCZ A;  4LE6 A;  2HB9 A;  2WRS A;  4Z5Y A;  2BMI A;  4Z67 A;  1E5D A;  4GYU A;  5HH6 A;  5AXO A;  2H6A A;  5HH4 A;  2M5D A;  2FHX B;  4DIK A;  3F9O A;  2ZO4 A;  5K4K A;  4PVT A;  2Q0J A;  4YSK A;  2A7M A;  3SFP A;  4RBS A;  5LLD A;  2WYM A;  5AXR A;  4ZEJ A;  2YZ3 A;  4RL2 A;  1A8T A;  2QDT A;  3PY6 A;  4FSB A;  3SW3 A;  3IEK A;  5HH5 A;  2FU7 A;  4EYF A;  2WYM C;  4O98 A;  2FU6 A;  5LS3 A;  2WYL A;  4AX0 B;  1K07 A;  2NYP A;  5AYA A;  1Y44 A;  3IE0 A;  3PY5 A;  2OHI A;  4TYF A;  4C1F A;  2BR6 A;  4XUK A;  5FQC A;  2P97 A;  1KO2 A;  1YCH A;  3ZWF A;  4TZ9 A;  4YSB A;  4ZNB A;  4NQ6 A;  2P4Z A;  1JJE A;  3T3N A;  4HL2 A;  4V0H A;  5EV6 A;  2BG2 A;  2FHX A;  2YNT B;  3DHB A;  4UWO B;  4U4L A;  2GFK A;  2Y8A A;  4TZF A;  3VQZ A;  1KR3 A;  2Y8B A;  5LE1 A;  1DDK A;  4C09 A;  3TP9 A;  2Q9U A;  3G1P A;  4D1W A;  2BG8 B;  1QH3 A;  2CBN A;  3X2Y A;  5EH9 A;  4H0D A;  4EXY A;  3ZR9 A;  4ZO3 A;  3DHC A;  4WD6 A;  1QH5 A;  2DKF A;  4Z5Z A;  5A87 A;  4C1C A;  3IEM A;  5ACX A;  2Q0I A;  3I11 A;  3DHA A;  2FM6 A;  5A0V A;  4D1U A;  4TZB A;  2WHG A;  3SBL A;  5ACU A;  2YNT A;  3A4Y A;  2GFJ A;  3P2U A;  1ZNB A;  5EW0 A;  3LVZ A;  3IE2 A;  1VME A;  2YNW A;  1WW1 A;  4AWY B;  4KEQ A;  5KIK A;  1VJN A;  5ACQ A;  2I7X A;  4TZE A;  2BG8 A;  2M5C A;  4NQ4 A;  2YNV B;  4AD9 A;  1MQO A;  1A7T A;  5LSC A;  4B87 A;  2BFZ B;  4FEK A;  4P62 A;  3IE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...