4Z6XA

The 1.68-angstrom crystal structure of acitive-site metal-free pqqb from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures of PqqB reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z6xA00
2M5CA 3I14A 4Z5YA 3SW3A 2GFKA 4RL0A 2BG7A 4EXSA 4O98A 2Y8AA 4YSBA 1A8TA 4C09A 4Z6XA 2Q0JA 3DHCA 3S0ZA 1X8IA 4P62A 4GYQA 5EHTA 3G1PA 5FQCA 1L9YA 3RKJA 4D1VA 4UWOB 4RM5A 3I11A 3L6NA 5ACQA 1WUPA 2OHHA 3X2YA 5EH9A 4Z5ZA 2ZZIA 4RBSA 3TP9A 1XM8A 3ZWFA 3WXCA 4D1WA 2CBNA 1BC2A 2NYPA 4NQ4A 4EFZA 5AHRA 3IDZA 2P4ZA 3BV6A 4CHLA 3KNRA 2Y87A 1YCHA 2ZNBA 5HISA 3DHAA 1VJNA 2P18A 5HIPA 2FU9A 5EVKA 4J5HA 3R2UA 5K4KA 2R2DA 3SRXA 4ZEJA 3Q6VA 1X8GA 4J5FA 3KNSA 4NQ5A 2BG8B 2BFZB 4EYLA 2P97A 2DOOA 2YNTA 5B1UA 3AF6A 3DH8A 4DIKA 4ZO3A 4BP0A 3IEMA 4Z60A 4PVOA 2YNUA 3PY6A 2WRSA 2I7TA 2OHJA 5EW0A 3F9OA 2YNWA 3I0VA 4H0DA 2BG8A 5B3RA 3QH8A 3IE1A 4DILA 3T3OA 5HH6A 2UYXA 4KEPA 4ZO2A 4HKYA 4NQ6A 5LCFA 1WW1A 4HL2A 2AZ4A 3SBLA 5AEBA 3IOGA 4RAMA 5EVDA 4F6HA 3I15A 3ZQ4A 4TZBA 1JJEA 2Q0IA 5DPXA 3X2XA 1HLKA 3KL7A 4AD9A 4AX1B 2P1EA 2YNVB 1BMCA 3T9MA 5AHOA 4AX0B 2YZ3A 4HL1A 2Q42A 2YCBA 2YNTB 5AXRA 5LM6A 2XF4A 4TZEA 5LS3A 3X2ZA 3I13A 1DDKA 5K0WA 5ACWA 3DHBA 5AYAA 3LVZA 1K07A 5LSCA 2I7VA 1ZNBA 4C1FA 1KO3A 3P2UA 5KILA 1QH3A 2YNVA 3PG4A 2Q9UA 2QJSA 4EYBA 2NZFA 3AF5A 4AWYB 3BK1A 5ACSA 4XWTA 2M5DA 2VW8A 1BVTA 2DKFA 5ACVA 3ADRA 1VMEA 5AXOA 2GMNA 4Z7RA 4D02A 2BMIA 4GCWA 2BG6A 2Y8BA 3ZR9A 5HIQA 4BZ3A 4UBQA 2QDTA 5KIKA 1X8HA 5HH5A 5IQKA 4EY2A 3T3NA 5K4MA 4C1DA 3ZNBA 4LE6A 3MD7A 3BC2A 4GYUA 1ZKPA 2FHXA 4FEKA 5FQAA 4UA4A 4PVTA 4D1UA 5ACPA 3RKKA 2WHGA 4EYFA 1P9EA 3IEKA 2OHIA 2GKLA 4C1GA 5LMCA 2WYMA 4AWZA 2GFJA 1WUOA 5A0VA 1XTOA 1ZTCA 1YCGA 4D1TA 5A87A 1WRAA 1DXKA 1Y44A 4XWWA 1VGNA 2QEDA 2FU6A 5ACTA 4KEQA 4RL2A 5LLDA 4UWPB 2NZEA 3VPEA 1DD6A 4V0HA 5LCAA 3SD9A 5EVBA 1QH5A 4NQ2A 3IOFA 4TYFA 2FK6A 2BGAA 5EWAA 3SFPA 2BIBA 3ESHA 1JJTA 3IELA 4UWRB 2ZO4A 1A7TA 3BK2A 4UAMA 4FSBA 3H3EA 5B15A 2XR1A 1E5DA 2ZWRA 2QINA 2BC2A 4RAWA 2QDSA 3X30A 2HB9A 3A4YA 4JO0A 5ACUA 3IE0A 3IE2A 4TZFA 2E7YA 4TZ9A 1KR3A 1SMLA 1MQOA 5HIOA 2FU8A 3RPCA 4B87A 5ACXA 4YSKA 5K4NA 2FHXB 4C1EA 5A0TA 2FU7A 5A5ZA 4EXYA 4F6ZA 2NXAA 4C1CA 1KO2A 2GCUA 2AIOA 2A7MA 4ZNBA 2BFKA 4WD6A 2I7XA 5HH4A 5FQBA 3FCZA 3PY5A 4TYTA 5LCHA 3JXPA 1YCFA 4U4LA 4C1HA 4Z67A 2BFLA 3SPUA 5LE1A 1JT1A 5ACRA 4YSLA 4XUKA 5EV6A 2BTNA 2FM6A 3VQZA 4FR7A 3AJ3A 5EV8A 1M2XA 4UWSB 2BFZA 3FAIA 2H6AA 2WYMC 2WYLA 2BG2A 2BR6A
chains in the Genus database with same CATH superfamily
2M5CA 3I14A 4Z5YA 3SW3A 2GFKA 4RL0A 2BG7A 4EXSA 4O98A 2Y8AA 4YSBA 1A8TA 4C09A 4Z6XA 2Q0JA 3DHCA 3S0ZA 1X8IA 4P62A 4GYQA 5EHTA 3G1PA 5FQCA 1L9YA 3RKJA 4D1VA 4UWOB 4RM5A 4PDXA 3I11A 3L6NA 5ACQA 1WUPA 2OHHA 3X2YA 5EH9A 4Z5ZA 2ZZIA 4RBSA 3TP9A 1XM8A 3ZWFA 3WXCA 4D1WA 2CBNA 1BC2A 2NYPA 4NQ4A 4EFZA 5AHRA 3IDZA 2P4ZA 3BV6A 4CHLA 3KNRA 2Y87A 1YCHA 2ZNBA 5HISA 3DHAA 1VJNA 2P18A 5HIPA 2FU9A 5EVKA 4J5HA 3R2UA 5K4KA 2R2DA 3SRXA 4ZEJA 3Q6VA 1X8GA 4J5FA 3KNSA 4NQ5A 2BG8B 2BFZB 4EYLA 2P97A 2DOOA 2YNTA 5B1UA 3AF6A 3DH8A 4DIKA 4ZO3A 2CFUA 4BP0A 3IEMA 4Z60A 2CG2A 5AJLA 4PVOA 2YNUA 3PY6A 2WRSA 2I7TA 2OHJA 5EW0A 3F9OA 2YNWA 3I0VA 4H0DA 2BG8A 5B3RA 3QH8A 3IE1A 4DILA 3T3OA 5HH6A 2UYXA 4KEPA 4ZO2A 4HKYA 4NQ6A 5LCFA 1WW1A 4HL2A 2AZ4A 3SBLA 5AEBA 3IOGA 4RAMA 5EVDA 4F6HA 3I15A 3ZQ4A 4TZBA 1JJEA 2Q0IA 5DPXA 3X2XA 1HLKA 4NURA 3KL7A 4AD9A 4AX1B 2P1EA 2YNVB 1BMCA 3T9MA 5AHOA 4AX0B 2YZ3A 4HL1A 2Q42A 2YCBA 2YNTB 5AXRA 5LM6A 2XF4A 5A23A 4TZEA 5LS3A 3X2ZA 3I13A 1DDKA 5K0WA 5ACWA 3DHBA 5AYAA 3LVZA 1K07A 5LSCA 2I7VA 1ZNBA 4C1FA 4AXHA 1KO3A 3P2UA 5KILA 1QH3A 2YNVA 3PG4A 2Q9UA 2QJSA 4EYBA 2NZFA 3AF5A 4AWYB 3BK1A 5ACSA 4XWTA 2M5DA 2VW8A 1BVTA 2DKFA 5ACVA 2YHEA 3ADRA 1VMEA 5AXOA 2GMNA 4Z7RA 4D02A 2BMIA 4GCWA 2BG6A 2Y8BA 3ZR9A 5HIQA 4BZ3A 4UBQA 2QDTA 5KIKA 1X8HA 5HH5A 5IQKA 4EY2A 3T3NA 5K4MA 4C1DA 3ZNBA 4LE6A 3MD7A 3BC2A 4GYUA 1ZKPA 2FHXA 4FEKA 5FQAA 4UA4A 4PVTA 4D1UA 5ACPA 3RKKA 2WHGA 4EYFA 1P9EA 3IEKA 2OHIA 2GKLA 4C1GA 5LMCA 2WYMA 4AWZA 2CFZA 2GFJA 1WUOA 5A0VA 1XTOA 1ZTCA 1YCGA 4D1TA 5A87A 1WRAA 1DXKA 1Y44A 4XWWA 1VGNA 2QEDA 2FU6A 5ACTA 4KEQA 4RL2A 5LLDA 4UWPB 2NZEA 3VPEA 1DD6A 4V0HA 5LCAA 3SD9A 5EVBA 1QH5A 4NQ2A 3IOFA 4TYFA 2FK6A 2BGAA 5EWAA 3SFPA 2BIBA 3ESHA 1JJTA 3IELA 4UWRB 2ZO4A 1A7TA 3BK2A 4UAMA 4FSBA 3H3EA 5B15A 2XR1A 1E5DA 2ZWRA 2QINA 2BC2A 4RAWA 2QDSA 3X30A 2HB9A 3A4YA 4JO0A 5ACUA 3IE0A 3IE2A 4TZFA 2E7YA 4TZ9A 5AIJA 1KR3A 1SMLA 1MQOA 5HIOA 2FU8A 3RPCA 4B87A 5ACXA 4YSKA 5K4NA 2FHXB 4C1EA 5A0TA 2FU7A 5A5ZA 4EXYA 4F6ZA 2NXAA 4C1CA 1KO2A 2GCUA 2AIOA 2A7MA 4ZNBA 2BFKA 4WD6A 2I7XA 5HH4A 5FQBA 3FCZA 3PY5A 4TYTA 5LCHA 3JXPA 1YCFA 4U4LA 4C1HA 4AV7A 4Z67A 2BFLA 3SPUA 5LE1A 1JT1A 5ACRA 4YSLA 4XUKA 5EV6A 2BTNA 2FM6A 3VQZA 4FR7A 3AJ3A 5EV8A 1M2XA 4UWSB 2BFZA 3FAIA 2H6AA 2WYMC 2WYLA 2BG2A 2CG3A 2BR6A
chains in the Genus database with same CATH topology
2M5CA 3I14A 4Z5YA 3SW3A 2GFKA 4RL0A 2BG7A 4EXSA 4O98A 2Y8AA 4YSBA 1A8TA 4C09A 4Z6XA 2Q0JA 3DHCA 3S0ZA 1X8IA 4P62A 4GYQA 5EHTA 3G1PA 5FQCA 1L9YA 3RKJA 4D1VA 4UWOB 4RM5A 3I11A 3L6NA 5ACQA 1WUPA 2OHHA 3X2YA 5EH9A 4Z5ZA 2ZZIA 4RBSA 3TP9A 1XM8A 3ZWFA 3WXCA 4D1WA 2CBNA 1BC2A 2NYPA 4NQ4A 4EFZA 5AHRA 3IDZA 2P4ZA 3BV6A 4CHLA 3KNRA 2Y87A 1YCHA 2ZNBA 5HISA 3DHAA 1VJNA 2P18A 5HIPA 2FU9A 5EVKA 4J5HA 3R2UA 5K4KA 2R2DA 3SRXA 4ZEJA 3Q6VA 1X8GA 4J5FA 3KNSA 4NQ5A 2BG8B 2BFZB 4EYLA 2P97A 2DOOA 2YNTA 5B1UA 3AF6A 3DH8A 4DIKA 4ZO3A 4BP0A 3IEMA 4Z60A 4PVOA 2YNUA 3PY6A 2WRSA 2I7TA 2OHJA 5EW0A 3F9OA 2YNWA 3I0VA 4H0DA 2BG8A 5B3RA 3QH8A 3IE1A 4DILA 3T3OA 5HH6A 2UYXA 4KEPA 4ZO2A 4HKYA 4NQ6A 5LCFA 1WW1A 4HL2A 2AZ4A 3SBLA 5AEBA 3IOGA 4RAMA 5EVDA 4F6HA 3I15A 3ZQ4A 4TZBA 1JJEA 2Q0IA 5DPXA 3X2XA 1HLKA 3KL7A 4AD9A 4AX1B 2P1EA 2YNVB 1BMCA 3T9MA 5AHOA 4AX0B 2YZ3A 4HL1A 2Q42A 2YCBA 2YNTB 5AXRA 5LM6A 2XF4A 4TZEA 5LS3A 3X2ZA 3I13A 1DDKA 5K0WA 5ACWA 3DHBA 5AYAA 3LVZA 1K07A 5LSCA 2I7VA 1ZNBA 4C1FA 1KO3A 3P2UA 5KILA 1QH3A 2YNVA 3PG4A 2Q9UA 2QJSA 4EYBA 2NZFA 3AF5A 4AWYB 3BK1A 5ACSA 4XWTA 2M5DA 2VW8A 1BVTA 2DKFA 5ACVA 3ADRA 1VMEA 5AXOA 2GMNA 4Z7RA 4D02A 2BMIA 4GCWA 2BG6A 2Y8BA 3ZR9A 5HIQA 4BZ3A 4UBQA 2QDTA 5KIKA 1X8HA 5HH5A 5IQKA 4EY2A 3T3NA 5K4MA 4C1DA 3ZNBA 4LE6A 3MD7A 3BC2A 4GYUA 1ZKPA 2FHXA 4FEKA 5FQAA 4UA4A 4PVTA 4D1UA 5ACPA 3RKKA 2WHGA 4EYFA 1P9EA 3IEKA 2OHIA 2GKLA 4C1GA 5LMCA 2WYMA 4AWZA 2GFJA 1WUOA 5A0VA 1XTOA 1ZTCA 1YCGA 4D1TA 5A87A 1WRAA 1DXKA 1Y44A 4XWWA 1VGNA 2QEDA 2FU6A 5ACTA 4KEQA 4RL2A 5LLDA 4UWPB 2NZEA 3VPEA 1DD6A 4V0HA 5LCAA 3SD9A 5EVBA 1QH5A 4NQ2A 3IOFA 4TYFA 2FK6A 2BGAA 5EWAA 3SFPA 2BIBA 3ESHA 1JJTA 3IELA 4UWRB 2ZO4A 1A7TA 3BK2A 4UAMA 4FSBA 3H3EA 5B15A 2XR1A 1E5DA 2ZWRA 2QINA 2BC2A 4RAWA 2QDSA 3X30A 2HB9A 3A4YA 4JO0A 5ACUA 3IE0A 3IE2A 4TZFA 2E7YA 4TZ9A 1KR3A 1SMLA 1MQOA 5HIOA 2FU8A 3RPCA 4B87A 5ACXA 4YSKA 5K4NA 2FHXB 4C1EA 5A0TA 2FU7A 5A5ZA 4EXYA 4F6ZA 2NXAA 4C1CA 1KO2A 2GCUA 2AIOA 2A7MA 4ZNBA 2BFKA 4WD6A 2I7XA 5HH4A 5FQBA 3FCZA 3PY5A 4TYTA 5LCHA 3JXPA 1YCFA 4U4LA 4C1HA 4Z67A 2BFLA 3SPUA 5LE1A 1JT1A 5ACRA 4YSLA 4XUKA 5EV6A 2BTNA 2FM6A 3VQZA 4FR7A 3AJ3A 5EV8A 1M2XA 4UWSB 2BFZA 3FAIA 2H6AA 2WYMC 2WYLA 2BG2A 2BR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5C A;  3I14 A;  4Z5Y A;  3SW3 A;  2GFK A;  4RL0 A;  2BG7 A;  4EXS A;  4O98 A;  2Y8A A;  4YSB A;  1A8T A;  4C09 A;  4Z6X A;  2Q0J A;  3DHC A;  3S0Z A;  1X8I A;  4P62 A;  4GYQ A;  5EHT A;  3G1P A;  5FQC A;  1L9Y A;  3RKJ A;  4D1V A;  4UWO B;  4RM5 A;  3I11 A;  3L6N A;  5ACQ A;  1WUP A;  2OHH A;  3X2Y A;  5EH9 A;  4Z5Z A;  2ZZI A;  4RBS A;  3TP9 A;  1XM8 A;  3ZWF A;  3WXC A;  4D1W A;  2CBN A;  1BC2 A;  2NYP A;  4NQ4 A;  4EFZ A;  5AHR A;  3IDZ A;  2P4Z A;  3BV6 A;  4CHL A;  3KNR A;  2Y87 A;  1YCH A;  2ZNB A;  5HIS A;  3DHA A;  1VJN A;  2P18 A;  5HIP A;  2FU9 A;  5EVK A;  4J5H A;  3R2U A;  5K4K A;  2R2D A;  3SRX A;  4ZEJ A;  3Q6V A;  1X8G A;  4J5F A;  3KNS A;  4NQ5 A;  2BG8 B;  2BFZ B;  4EYL A;  2P97 A;  2DOO A;  2YNT A;  5B1U A;  3AF6 A;  3DH8 A;  4DIK A;  4ZO3 A;  4BP0 A;  3IEM A;  4Z60 A;  4PVO A;  2YNU A;  3PY6 A;  2WRS A;  2I7T A;  2OHJ A;  5EW0 A;  3F9O A;  2YNW A;  3I0V A;  4H0D A;  2BG8 A;  5B3R A;  3QH8 A;  3IE1 A;  4DIL A;  3T3O A;  5HH6 A;  2UYX A;  4KEP A;  4ZO2 A;  4HKY A;  4NQ6 A;  5LCF A;  1WW1 A;  4HL2 A;  2AZ4 A;  3SBL A;  5AEB A;  3IOG A;  4RAM A;  5EVD A;  4F6H A;  3I15 A;  3ZQ4 A;  4TZB A;  1JJE A;  2Q0I A;  5DPX A;  3X2X A;  1HLK A;  3KL7 A;  4AD9 A;  4AX1 B;  2P1E A;  2YNV B;  1BMC A;  3T9M A;  5AHO A;  4AX0 B;  2YZ3 A;  4HL1 A;  2Q42 A;  2YCB A;  2YNT B;  5AXR A;  5LM6 A;  2XF4 A;  4TZE A;  5LS3 A;  3X2Z A;  3I13 A;  1DDK A;  5K0W A;  5ACW A;  3DHB A;  5AYA A;  3LVZ A;  1K07 A;  5LSC A;  2I7V A;  1ZNB A;  4C1F A;  1KO3 A;  3P2U A;  5KIL A;  1QH3 A;  2YNV A;  3PG4 A;  2Q9U A;  2QJS A;  4EYB A;  2NZF A;  3AF5 A;  4AWY B;  3BK1 A;  5ACS A;  4XWT A;  2M5D A;  2VW8 A;  1BVT A;  2DKF A;  5ACV A;  3ADR A;  1VME A;  5AXO A;  2GMN A;  4Z7R A;  4D02 A;  2BMI A;  4GCW A;  2BG6 A;  2Y8B A;  3ZR9 A;  5HIQ A;  4BZ3 A;  4UBQ A;  2QDT A;  5KIK A;  1X8H A;  5HH5 A;  5IQK A;  4EY2 A;  3T3N A;  5K4M A;  4C1D A;  3ZNB A;  4LE6 A;  3MD7 A;  3BC2 A;  4GYU A;  1ZKP A;  2FHX A;  4FEK A;  5FQA A;  4UA4 A;  4PVT A;  4D1U A;  5ACP A;  3RKK A;  2WHG A;  4EYF A;  1P9E A;  3IEK A;  2OHI A;  2GKL A;  4C1G A;  5LMC A;  2WYM A;  4AWZ A;  2GFJ A;  1WUO A;  5A0V A;  1XTO A;  1ZTC A;  1YCG A;  4D1T A;  5A87 A;  1WRA A;  1DXK A;  1Y44 A;  4XWW A;  1VGN A;  2QED A;  2FU6 A;  5ACT A;  4KEQ A;  4RL2 A;  5LLD A;  4UWP B;  2NZE A;  3VPE A;  1DD6 A;  4V0H A;  5LCA A;  3SD9 A;  5EVB A;  1QH5 A;  4NQ2 A;  3IOF A;  4TYF A;  2FK6 A;  2BGA A;  5EWA A;  3SFP A;  2BIB A;  3ESH A;  1JJT A;  3IEL A;  4UWR B;  2ZO4 A;  1A7T A;  3BK2 A;  4UAM A;  4FSB A;  3H3E A;  5B15 A;  2XR1 A;  1E5D A;  2ZWR A;  2QIN A;  2BC2 A;  4RAW A;  2QDS A;  3X30 A;  2HB9 A;  3A4Y A;  4JO0 A;  5ACU A;  3IE0 A;  3IE2 A;  4TZF A;  2E7Y A;  4TZ9 A;  1KR3 A;  1SML A;  1MQO A;  5HIO A;  2FU8 A;  3RPC A;  4B87 A;  5ACX A;  4YSK A;  5K4N A;  2FHX B;  4C1E A;  5A0T A;  2FU7 A;  5A5Z A;  4EXY A;  4F6Z A;  2NXA A;  4C1C A;  1KO2 A;  2GCU A;  2AIO A;  2A7M A;  4ZNB A;  2BFK A;  4WD6 A;  2I7X A;  5HH4 A;  5FQB A;  3FCZ A;  3PY5 A;  4TYT A;  5LCH A;  3JXP A;  1YCF A;  4U4L A;  4C1H A;  4Z67 A;  2BFL A;  3SPU A;  5LE1 A;  1JT1 A;  5ACR A;  4YSL A;  4XUK A;  5EV6 A;  2BTN A;  2FM6 A;  3VQZ A;  4FR7 A;  3AJ3 A;  5EV8 A;  1M2X A;  4UWS B;  2BFZ A;  3FAI A;  2H6A A;  2WYM C;  2WYL A;  2BG2 A;  2BR6 A; 
#chains in the Genus database with same CATH topology
 2M5C A;  3I14 A;  4Z5Y A;  3SW3 A;  2GFK A;  4RL0 A;  2BG7 A;  4EXS A;  4O98 A;  2Y8A A;  4YSB A;  1A8T A;  4C09 A;  4Z6X A;  2Q0J A;  3DHC A;  3S0Z A;  1X8I A;  4P62 A;  4GYQ A;  5EHT A;  3G1P A;  5FQC A;  1L9Y A;  3RKJ A;  4D1V A;  4UWO B;  4RM5 A;  4PDX A;  3I11 A;  3L6N A;  5ACQ A;  1WUP A;  2OHH A;  3X2Y A;  5EH9 A;  4Z5Z A;  2ZZI A;  4RBS A;  3TP9 A;  1XM8 A;  3ZWF A;  3WXC A;  4D1W A;  2CBN A;  1BC2 A;  2NYP A;  4NQ4 A;  4EFZ A;  5AHR A;  3IDZ A;  2P4Z A;  3BV6 A;  4CHL A;  3KNR A;  2Y87 A;  1YCH A;  2ZNB A;  5HIS A;  3DHA A;  1VJN A;  2P18 A;  5HIP A;  2FU9 A;  5EVK A;  4J5H A;  3R2U A;  5K4K A;  2R2D A;  3SRX A;  4ZEJ A;  3Q6V A;  1X8G A;  4J5F A;  3KNS A;  4NQ5 A;  2BG8 B;  2BFZ B;  4EYL A;  2P97 A;  2DOO A;  2YNT A;  5B1U A;  3AF6 A;  3DH8 A;  4DIK A;  4ZO3 A;  2CFU A;  4BP0 A;  3IEM A;  4Z60 A;  2CG2 A;  5AJL A;  4PVO A;  2YNU A;  3PY6 A;  2WRS A;  2I7T A;  2OHJ A;  5EW0 A;  3F9O A;  2YNW A;  3I0V A;  4H0D A;  2BG8 A;  5B3R A;  3QH8 A;  3IE1 A;  4DIL A;  3T3O A;  5HH6 A;  2UYX A;  4KEP A;  4ZO2 A;  4HKY A;  4NQ6 A;  5LCF A;  1WW1 A;  4HL2 A;  2AZ4 A;  3SBL A;  5AEB A;  3IOG A;  4RAM A;  5EVD A;  4F6H A;  3I15 A;  3ZQ4 A;  4TZB A;  1JJE A;  2Q0I A;  5DPX A;  3X2X A;  1HLK A;  4NUR A;  3KL7 A;  4AD9 A;  4AX1 B;  2P1E A;  2YNV B;  1BMC A;  3T9M A;  5AHO A;  4AX0 B;  2YZ3 A;  4HL1 A;  2Q42 A;  2YCB A;  2YNT B;  5AXR A;  5LM6 A;  2XF4 A;  5A23 A;  4TZE A;  5LS3 A;  3X2Z A;  3I13 A;  1DDK A;  5K0W A;  5ACW A;  3DHB A;  5AYA A;  3LVZ A;  1K07 A;  5LSC A;  2I7V A;  1ZNB A;  4C1F A;  4AXH A;  1KO3 A;  3P2U A;  5KIL A;  1QH3 A;  2YNV A;  3PG4 A;  2Q9U A;  2QJS A;  4EYB A;  2NZF A;  3AF5 A;  4AWY B;  3BK1 A;  5ACS A;  4XWT A;  2M5D A;  2VW8 A;  1BVT A;  2DKF A;  5ACV A;  2YHE A;  3ADR A;  1VME A;  5AXO A;  2GMN A;  4Z7R A;  4D02 A;  2BMI A;  4GCW A;  2BG6 A;  2Y8B A;  3ZR9 A;  5HIQ A;  4BZ3 A;  4UBQ A;  2QDT A;  5KIK A;  1X8H A;  5HH5 A;  5IQK A;  4EY2 A;  3T3N A;  5K4M A;  4C1D A;  3ZNB A;  4LE6 A;  3MD7 A;  3BC2 A;  4GYU A;  1ZKP A;  2FHX A;  4FEK A;  5FQA A;  4UA4 A;  4PVT A;  4D1U A;  5ACP A;  3RKK A;  2WHG A;  4EYF A;  1P9E A;  3IEK A;  2OHI A;  2GKL A;  4C1G A;  5LMC A;  2WYM A;  4AWZ A;  2CFZ A;  2GFJ A;  1WUO A;  5A0V A;  1XTO A;  1ZTC A;  1YCG A;  4D1T A;  5A87 A;  1WRA A;  1DXK A;  1Y44 A;  4XWW A;  1VGN A;  2QED A;  2FU6 A;  5ACT A;  4KEQ A;  4RL2 A;  5LLD A;  4UWP B;  2NZE A;  3VPE A;  1DD6 A;  4V0H A;  5LCA A;  3SD9 A;  5EVB A;  1QH5 A;  4NQ2 A;  3IOF A;  4TYF A;  2FK6 A;  2BGA A;  5EWA A;  3SFP A;  2BIB A;  3ESH A;  1JJT A;  3IEL A;  4UWR B;  2ZO4 A;  1A7T A;  3BK2 A;  4UAM A;  4FSB A;  3H3E A;  5B15 A;  2XR1 A;  1E5D A;  2ZWR A;  2QIN A;  2BC2 A;  4RAW A;  2QDS A;  3X30 A;  2HB9 A;  3A4Y A;  4JO0 A;  5ACU A;  3IE0 A;  3IE2 A;  4TZF A;  2E7Y A;  4TZ9 A;  5AIJ A;  1KR3 A;  1SML A;  1MQO A;  5HIO A;  2FU8 A;  3RPC A;  4B87 A;  5ACX A;  4YSK A;  5K4N A;  2FHX B;  4C1E A;  5A0T A;  2FU7 A;  5A5Z A;  4EXY A;  4F6Z A;  2NXA A;  4C1C A;  1KO2 A;  2GCU A;  2AIO A;  2A7M A;  4ZNB A;  2BFK A;  4WD6 A;  2I7X A;  5HH4 A;  5FQB A;  3FCZ A;  3PY5 A;  4TYT A;  5LCH A;  3JXP A;  1YCF A;  4U4L A;  4C1H A;  4AV7 A;  4Z67 A;  2BFL A;  3SPU A;  5LE1 A;  1JT1 A;  5ACR A;  4YSL A;  4XUK A;  5EV6 A;  2BTN A;  2FM6 A;  3VQZ A;  4FR7 A;  3AJ3 A;  5EV8 A;  1M2X A;  4UWS B;  2BFZ A;  3FAI A;  2H6A A;  2WYM C;  2WYL A;  2BG2 A;  2CG3 A;  2BR6 A; 
#chains in the Genus database with same CATH homology
 2M5C A;  3I14 A;  4Z5Y A;  3SW3 A;  2GFK A;  4RL0 A;  2BG7 A;  4EXS A;  4O98 A;  2Y8A A;  4YSB A;  1A8T A;  4C09 A;  4Z6X A;  2Q0J A;  3DHC A;  3S0Z A;  1X8I A;  4P62 A;  4GYQ A;  5EHT A;  3G1P A;  5FQC A;  1L9Y A;  3RKJ A;  4D1V A;  4UWO B;  4RM5 A;  3I11 A;  3L6N A;  5ACQ A;  1WUP A;  2OHH A;  3X2Y A;  5EH9 A;  4Z5Z A;  2ZZI A;  4RBS A;  3TP9 A;  1XM8 A;  3ZWF A;  3WXC A;  4D1W A;  2CBN A;  1BC2 A;  2NYP A;  4NQ4 A;  4EFZ A;  5AHR A;  3IDZ A;  2P4Z A;  3BV6 A;  4CHL A;  3KNR A;  2Y87 A;  1YCH A;  2ZNB A;  5HIS A;  3DHA A;  1VJN A;  2P18 A;  5HIP A;  2FU9 A;  5EVK A;  4J5H A;  3R2U A;  5K4K A;  2R2D A;  3SRX A;  4ZEJ A;  3Q6V A;  1X8G A;  4J5F A;  3KNS A;  4NQ5 A;  2BG8 B;  2BFZ B;  4EYL A;  2P97 A;  2DOO A;  2YNT A;  5B1U A;  3AF6 A;  3DH8 A;  4DIK A;  4ZO3 A;  4BP0 A;  3IEM A;  4Z60 A;  4PVO A;  2YNU A;  3PY6 A;  2WRS A;  2I7T A;  2OHJ A;  5EW0 A;  3F9O A;  2YNW A;  3I0V A;  4H0D A;  2BG8 A;  5B3R A;  3QH8 A;  3IE1 A;  4DIL A;  3T3O A;  5HH6 A;  2UYX A;  4KEP A;  4ZO2 A;  4HKY A;  4NQ6 A;  5LCF A;  1WW1 A;  4HL2 A;  2AZ4 A;  3SBL A;  5AEB A;  3IOG A;  4RAM A;  5EVD A;  4F6H A;  3I15 A;  3ZQ4 A;  4TZB A;  1JJE A;  2Q0I A;  5DPX A;  3X2X A;  1HLK A;  3KL7 A;  4AD9 A;  4AX1 B;  2P1E A;  2YNV B;  1BMC A;  3T9M A;  5AHO A;  4AX0 B;  2YZ3 A;  4HL1 A;  2Q42 A;  2YCB A;  2YNT B;  5AXR A;  5LM6 A;  2XF4 A;  4TZE A;  5LS3 A;  3X2Z A;  3I13 A;  1DDK A;  5K0W A;  5ACW A;  3DHB A;  5AYA A;  3LVZ A;  1K07 A;  5LSC A;  2I7V A;  1ZNB A;  4C1F A;  1KO3 A;  3P2U A;  5KIL A;  1QH3 A;  2YNV A;  3PG4 A;  2Q9U A;  2QJS A;  4EYB A;  2NZF A;  3AF5 A;  4AWY B;  3BK1 A;  5ACS A;  4XWT A;  2M5D A;  2VW8 A;  1BVT A;  2DKF A;  5ACV A;  3ADR A;  1VME A;  5AXO A;  2GMN A;  4Z7R A;  4D02 A;  2BMI A;  4GCW A;  2BG6 A;  2Y8B A;  3ZR9 A;  5HIQ A;  4BZ3 A;  4UBQ A;  2QDT A;  5KIK A;  1X8H A;  5HH5 A;  5IQK A;  4EY2 A;  3T3N A;  5K4M A;  4C1D A;  3ZNB A;  4LE6 A;  3MD7 A;  3BC2 A;  4GYU A;  1ZKP A;  2FHX A;  4FEK A;  5FQA A;  4UA4 A;  4PVT A;  4D1U A;  5ACP A;  3RKK A;  2WHG A;  4EYF A;  1P9E A;  3IEK A;  2OHI A;  2GKL A;  4C1G A;  5LMC A;  2WYM A;  4AWZ A;  2GFJ A;  1WUO A;  5A0V A;  1XTO A;  1ZTC A;  1YCG A;  4D1T A;  5A87 A;  1WRA A;  1DXK A;  1Y44 A;  4XWW A;  1VGN A;  2QED A;  2FU6 A;  5ACT A;  4KEQ A;  4RL2 A;  5LLD A;  4UWP B;  2NZE A;  3VPE A;  1DD6 A;  4V0H A;  5LCA A;  3SD9 A;  5EVB A;  1QH5 A;  4NQ2 A;  3IOF A;  4TYF A;  2FK6 A;  2BGA A;  5EWA A;  3SFP A;  2BIB A;  3ESH A;  1JJT A;  3IEL A;  4UWR B;  2ZO4 A;  1A7T A;  3BK2 A;  4UAM A;  4FSB A;  3H3E A;  5B15 A;  2XR1 A;  1E5D A;  2ZWR A;  2QIN A;  2BC2 A;  4RAW A;  2QDS A;  3X30 A;  2HB9 A;  3A4Y A;  4JO0 A;  5ACU A;  3IE0 A;  3IE2 A;  4TZF A;  2E7Y A;  4TZ9 A;  1KR3 A;  1SML A;  1MQO A;  5HIO A;  2FU8 A;  3RPC A;  4B87 A;  5ACX A;  4YSK A;  5K4N A;  2FHX B;  4C1E A;  5A0T A;  2FU7 A;  5A5Z A;  4EXY A;  4F6Z A;  2NXA A;  4C1C A;  1KO2 A;  2GCU A;  2AIO A;  2A7M A;  4ZNB A;  2BFK A;  4WD6 A;  2I7X A;  5HH4 A;  5FQB A;  3FCZ A;  3PY5 A;  4TYT A;  5LCH A;  3JXP A;  1YCF A;  4U4L A;  4C1H A;  4Z67 A;  2BFL A;  3SPU A;  5LE1 A;  1JT1 A;  5ACR A;  4YSL A;  4XUK A;  5EV6 A;  2BTN A;  2FM6 A;  3VQZ A;  4FR7 A;  3AJ3 A;  5EV8 A;  1M2X A;  4UWS B;  2BFZ A;  3FAI A;  2H6A A;  2WYM C;  2WYL A;  2BG2 A;  2BR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...