4Z6XA

The 1.68-angstrom crystal structure of acitive-site metal-free pqqb from pseudomonas putida
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
309
structure length
309
Chain Sequence
b'MMYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALSDDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGCPHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRSAAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGTLWEDDEMQRRGVGTRTGREMGHLAQNGPGGTLEVLDGFPRQRKVLIHINNTNPILDENSPERAEVLRRGVEVAFDGMSIELLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coenzyme PQQ synthesis protein B
publication title Crystal structures of PqqB reveal metal-binding plasticity at the active site of PqqB
rcsb
source organism Pseudomonas putida (strain kt2440)
molecule tags Hydrolase
total genus 101
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2015-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4z6xA00
4DILA 5EW0A 4P62A 5B15A 3LVZA 2FHXB 4UWOB 2DKFA 3I13A 4D1WA 4F6HA 4YSLA 4V0HA 1VMEA 3A4YA 3IDZA 2M5DA 2BFZA 5HIPA 4TZ9A 3FAIA 5ACTA 3BK2A 1P9EA 5DPXA 5EH9A 2YNUA 3T3OA 2BFLA 4NQ4A 1YCHA 5ACRA 2BMIA 4GYQA 3ZQ4A 1WW1A 2YCBA 4C1EA 2OHIA 2FHXA 2GKLA 5HH4A 2P18A 3I15A 2NYPA 5HH5A 1WUPA 4O98A 1DD6A 4UA4A 1BMCA 2NZFA 2AIOA 5HISA 3SW3A 5KIKA 2BTNA 5LE1A 4RAMA 2FU6A 5ACVA 4H0DA 4Z5YA 2P4ZA 4AWYB 3BC2A 3ZNBA 1BC2A 2GFKA 1YCFA 2UYXA 2H6AA 4NQ6A 2Y87A 3Q6VA 1XM8A 4BP0A 4J5FA 3SPUA 2OHJA 2GMNA 4NQ5A 1BVTA 2GCUA 2P1EA 5LS3A 5LMCA 2XR1A 2BG7A 5ACQA 3IOFA 2A7MA 1XTOA 4C09A 4JO0A 2FM6A 4AX1B 4EXSA 3SRXA 3VQZA 4ZEJA 4RL2A 2BGAA 4KEQA 3RKJA 1ZKPA 2BFKA 1A7TA 3MD7A 4AD9A 1DDKA 4AWZA 2BG6A 5EVKA 5LCHA 3X2YA 1MQOA 4EYFA 2YNWA 4D1TA 2I7VA 1A8TA 2QINA 2I7TA 4C1GA 5HH6A 2BR6A 1WUOA 5A0TA 4HKYA 4YSBA 4RAWA 5A5ZA 1DXKA 1YCGA 2E7YA 4TYTA 4U4LA 4YSKA 4EFZA 5A87A 5EVDA 4ZO3A 2WYMC 5EWAA 3PG4A 3WXCA 4EYBA 3G1PA 1QH3A 4RM5A 2Q0JA 1JJEA 5ACUA 2WYMA 4TZBA 1VGNA 2QDSA 1L9YA 5B1UA 4HL2A 3BK1A 1VJNA 5FQAA 2HB9A 2P97A 3DHCA 3KL7A 1X8IA 3KNSA 3H3EA 3I0VA 2ZNBA 5FQBA 4Z67A 5EV8A 5IQKA 3FCZA 3JXPA 5LCAA 4RBSA 5ACSA 4HL1A 3SD9A 3S0ZA 2AZ4A 1E5DA 1SMLA 5AHOA 1KO3A 4GCWA 4J5HA 5AHRA 5AYAA 4FR7A 4XUKA 5AXOA 5K4NA 1Y44A 4C1FA 4BZ3A 3DHAA 1JT1A 5EHTA 2YNTB 1HLKA 2WYLA 3R2UA 4PVOA 5KILA 4GYUA 5HIOA 2WHGA 3X2ZA 3IE1A 2GFJA 5K0WA 3IELA 4F6ZA 4B87A 5EV6A 2ZWRA 5ACXA 4CHLA 4EYLA 5B3RA 3ZR9A 4RL0A 1WRAA 3F9OA 4TZEA 3ZWFA 2YNTA 3QH8A 2Y8AA 4NQ2A 5LCFA 2M5CA 3TP9A 4XWWA 3X30A 3ADRA 3L6NA 3PY6A 2Q42A 4TZFA 2Q9UA 2BC2A 2YNVB 4C1DA 1M2XA 4FSBA 5LM6A 3T3NA 4Z60A 2XF4A 3IE2A 3IOGA 3VPEA 2Q0IA 2I7XA 4KEPA 4LE6A 3X2XA 3AJ3A 4UBQA 3DH8A 4D1UA 4C1HA 4Z7RA 4FEKA 1X8HA 4DIKA 2YZ3A 4UWPB 3IE0A 2OHHA 2CBNA 5ACPA 5EVBA 1JJTA 4WD6A 4AX0B 2NZEA 5LSCA 2YNVA 3T9MA 3P2UA 4UWRB 4UWSB 1ZTCA 3IEKA 3I14A 3AF6A 4D02A 4C1CA 2Y8BA 2DOOA 3ESHA 1K07A 2BG8B 5AXRA 2QDTA 5K4MA 3AF5A 4ZNBA 2VW8A 5AEBA 1ZNBA 3BV6A 4ZO2A 2FU9A 4D1VA 3I11A 2R2DA 5ACWA 4EXYA 4Z5ZA 1KR3A 2FU8A 3SFPA 3KNRA 2ZZIA 5HIQA 5K4KA 5FQCA 1X8GA 2BIBA 2BG2A 3DHBA 3IEMA 3RPCA 4TYFA 2BG8A 5LLDA 2QEDA 2QJSA 4EY2A 2BFZB 1QH5A 2FU7A 4Z6XA 2NXAA 4UAMA 5A0VA 2WRSA 4XWTA 2FK6A 1KO2A 2ZO4A 3RKKA 3PY5A 3SBLA 4PVTA
chains in the Genus database with same CATH superfamily
4DILA 5EW0A 4P62A 5B15A 3LVZA 2FHXB 4UWOB 2DKFA 3I13A 4D1WA 2CFUA 4F6HA 4YSLA 4V0HA 1VMEA 3A4YA 3IDZA 2M5DA 2BFZA 5HIPA 4TZ9A 3FAIA 5ACTA 3BK2A 5AIJA 1P9EA 5DPXA 5AJLA 5EH9A 2YNUA 3T3OA 2BFLA 4NQ4A 1YCHA 5ACRA 2BMIA 4GYQA 3ZQ4A 1WW1A 2YCBA 4C1EA 2OHIA 2FHXA 2GKLA 5HH4A 2P18A 3I15A 2NYPA 5HH5A 1WUPA 4O98A 1DD6A 4UA4A 1BMCA 2NZFA 2AIOA 5HISA 3SW3A 5KIKA 2BTNA 5LE1A 4RAMA 2FU6A 5ACVA 4H0DA 4Z5YA 2P4ZA 4AWYB 3BC2A 3ZNBA 1BC2A 2GFKA 1YCFA 2UYXA 2H6AA 4NQ6A 2Y87A 3Q6VA 1XM8A 4BP0A 4J5FA 3SPUA 2OHJA 2GMNA 4NQ5A 1BVTA 2GCUA 2P1EA 2CFZA 5LS3A 5LMCA 2XR1A 2BG7A 5ACQA 3IOFA 2A7MA 1XTOA 4C09A 4JO0A 2FM6A 4AX1B 4EXSA 3SRXA 3VQZA 4ZEJA 4RL2A 2BGAA 4KEQA 3RKJA 1ZKPA 2BFKA 1A7TA 3MD7A 4AD9A 1DDKA 4AWZA 2BG6A 5EVKA 5LCHA 3X2YA 1MQOA 4EYFA 2YNWA 4D1TA 2I7VA 1A8TA 2QINA 2I7TA 4C1GA 5HH6A 2BR6A 1WUOA 5A0TA 4HKYA 4YSBA 4RAWA 5A23A 5A5ZA 1DXKA 1YCGA 2E7YA 4TYTA 2CG3A 4U4LA 4PDXA 4YSKA 4EFZA 5A87A 5EVDA 4ZO3A 2WYMC 5EWAA 3PG4A 3WXCA 4EYBA 3G1PA 1QH3A 4RM5A 2Q0JA 1JJEA 5ACUA 2WYMA 4TZBA 1VGNA 2QDSA 1L9YA 5B1UA 4HL2A 3BK1A 1VJNA 5FQAA 2HB9A 2P97A 3DHCA 3KL7A 1X8IA 3KNSA 3H3EA 3I0VA 2ZNBA 5FQBA 4Z67A 5EV8A 5IQKA 3FCZA 3JXPA 5LCAA 4RBSA 5ACSA 4NURA 4HL1A 3SD9A 3S0ZA 2AZ4A 1E5DA 1SMLA 5AHOA 1KO3A 4GCWA 4J5HA 5AHRA 5AYAA 4FR7A 4XUKA 5AXOA 5K4NA 1Y44A 4C1FA 4BZ3A 3DHAA 1JT1A 5EHTA 2YNTB 1HLKA 2WYLA 3R2UA 4PVOA 5KILA 4GYUA 5HIOA 2WHGA 3X2ZA 3IE1A 2GFJA 5K0WA 3IELA 4F6ZA 4B87A 5EV6A 2ZWRA 5ACXA 4CHLA 4EYLA 5B3RA 3ZR9A 4RL0A 1WRAA 3F9OA 4TZEA 3ZWFA 2YNTA 3QH8A 2Y8AA 4NQ2A 4AV7A 5LCFA 2M5CA 3TP9A 4XWWA 3X30A 3ADRA 3L6NA 3PY6A 2Q42A 4TZFA 4AXHA 2CG2A 2Q9UA 2BC2A 2YNVB 4C1DA 1M2XA 4FSBA 5LM6A 3T3NA 4Z60A 2XF4A 3IE2A 3IOGA 3VPEA 2Q0IA 2I7XA 4KEPA 4LE6A 3X2XA 3AJ3A 4UBQA 3DH8A 4D1UA 4C1HA 4Z7RA 4FEKA 1X8HA 4DIKA 2YZ3A 4UWPB 3IE0A 2OHHA 2CBNA 5ACPA 5EVBA 1JJTA 4WD6A 4AX0B 2NZEA 5LSCA 2YNVA 3T9MA 3P2UA 4UWRB 4UWSB 1ZTCA 3IEKA 3I14A 3AF6A 4D02A 4C1CA 2Y8BA 2DOOA 3ESHA 1K07A 2BG8B 5AXRA 2QDTA 5K4MA 3AF5A 4ZNBA 2VW8A 5AEBA 1ZNBA 2YHEA 3BV6A 4ZO2A 2FU9A 4D1VA 3I11A 2R2DA 5ACWA 4EXYA 4Z5ZA 1KR3A 2FU8A 3SFPA 3KNRA 2ZZIA 5HIQA 5K4KA 5FQCA 1X8GA 2BIBA 2BG2A 3DHBA 3IEMA 3RPCA 4TYFA 2BG8A 5LLDA 2QEDA 2QJSA 4EY2A 2BFZB 1QH5A 2FU7A 4Z6XA 2NXAA 4UAMA 5A0VA 2WRSA 4XWTA 2FK6A 1KO2A 2ZO4A 3RKKA 3PY5A 3SBLA 4PVTA
chains in the Genus database with same CATH topology
4DILA 5EW0A 4P62A 5B15A 3LVZA 2FHXB 4UWOB 2DKFA 3I13A 4D1WA 4F6HA 4YSLA 4V0HA 1VMEA 3A4YA 3IDZA 2M5DA 2BFZA 5HIPA 4TZ9A 3FAIA 5ACTA 3BK2A 1P9EA 5DPXA 5EH9A 2YNUA 3T3OA 2BFLA 4NQ4A 1YCHA 5ACRA 2BMIA 4GYQA 3ZQ4A 1WW1A 2YCBA 4C1EA 2OHIA 2FHXA 2GKLA 5HH4A 2P18A 3I15A 2NYPA 5HH5A 1WUPA 4O98A 1DD6A 4UA4A 1BMCA 2NZFA 2AIOA 5HISA 3SW3A 5KIKA 2BTNA 5LE1A 4RAMA 2FU6A 5ACVA 4H0DA 4Z5YA 2P4ZA 4AWYB 3BC2A 3ZNBA 1BC2A 2GFKA 1YCFA 2UYXA 2H6AA 4NQ6A 2Y87A 3Q6VA 1XM8A 4BP0A 4J5FA 3SPUA 2OHJA 2GMNA 4NQ5A 1BVTA 2GCUA 2P1EA 5LS3A 5LMCA 2XR1A 2BG7A 5ACQA 3IOFA 2A7MA 1XTOA 4C09A 4JO0A 2FM6A 4AX1B 4EXSA 3SRXA 3VQZA 4ZEJA 4RL2A 2BGAA 4KEQA 3RKJA 1ZKPA 2BFKA 1A7TA 3MD7A 4AD9A 1DDKA 4AWZA 2BG6A 5EVKA 5LCHA 3X2YA 1MQOA 4EYFA 2YNWA 4D1TA 2I7VA 1A8TA 2QINA 2I7TA 4C1GA 5HH6A 2BR6A 1WUOA 5A0TA 4HKYA 4YSBA 4RAWA 5A5ZA 1DXKA 1YCGA 2E7YA 4TYTA 4U4LA 4YSKA 4EFZA 5A87A 5EVDA 4ZO3A 2WYMC 5EWAA 3PG4A 3WXCA 4EYBA 3G1PA 1QH3A 4RM5A 2Q0JA 1JJEA 5ACUA 2WYMA 4TZBA 1VGNA 2QDSA 1L9YA 5B1UA 4HL2A 3BK1A 1VJNA 5FQAA 2HB9A 2P97A 3DHCA 3KL7A 1X8IA 3KNSA 3H3EA 3I0VA 2ZNBA 5FQBA 4Z67A 5EV8A 5IQKA 3FCZA 3JXPA 5LCAA 4RBSA 5ACSA 4HL1A 3SD9A 3S0ZA 2AZ4A 1E5DA 1SMLA 5AHOA 1KO3A 4GCWA 4J5HA 5AHRA 5AYAA 4FR7A 4XUKA 5AXOA 5K4NA 1Y44A 4C1FA 4BZ3A 3DHAA 1JT1A 5EHTA 2YNTB 1HLKA 2WYLA 3R2UA 4PVOA 5KILA 4GYUA 5HIOA 2WHGA 3X2ZA 3IE1A 2GFJA 5K0WA 3IELA 4F6ZA 4B87A 5EV6A 2ZWRA 5ACXA 4CHLA 4EYLA 5B3RA 3ZR9A 4RL0A 1WRAA 3F9OA 4TZEA 3ZWFA 2YNTA 3QH8A 2Y8AA 4NQ2A 5LCFA 2M5CA 3TP9A 4XWWA 3X30A 3ADRA 3L6NA 3PY6A 2Q42A 4TZFA 2Q9UA 2BC2A 2YNVB 4C1DA 1M2XA 4FSBA 5LM6A 3T3NA 4Z60A 2XF4A 3IE2A 3IOGA 3VPEA 2Q0IA 2I7XA 4KEPA 4LE6A 3X2XA 3AJ3A 4UBQA 3DH8A 4D1UA 4C1HA 4Z7RA 4FEKA 1X8HA 4DIKA 2YZ3A 4UWPB 3IE0A 2OHHA 2CBNA 5ACPA 5EVBA 1JJTA 4WD6A 4AX0B 2NZEA 5LSCA 2YNVA 3T9MA 3P2UA 4UWRB 4UWSB 1ZTCA 3IEKA 3I14A 3AF6A 4D02A 4C1CA 2Y8BA 2DOOA 3ESHA 1K07A 2BG8B 5AXRA 2QDTA 5K4MA 3AF5A 4ZNBA 2VW8A 5AEBA 1ZNBA 3BV6A 4ZO2A 2FU9A 4D1VA 3I11A 2R2DA 5ACWA 4EXYA 4Z5ZA 1KR3A 2FU8A 3SFPA 3KNRA 2ZZIA 5HIQA 5K4KA 5FQCA 1X8GA 2BIBA 2BG2A 3DHBA 3IEMA 3RPCA 4TYFA 2BG8A 5LLDA 2QEDA 2QJSA 4EY2A 2BFZB 1QH5A 2FU7A 4Z6XA 2NXAA 4UAMA 5A0VA 2WRSA 4XWTA 2FK6A 1KO2A 2ZO4A 3RKKA 3PY5A 3SBLA 4PVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DIL A;  5EW0 A;  4P62 A;  5B15 A;  3LVZ A;  2FHX B;  4UWO B;  2DKF A;  3I13 A;  4D1W A;  4F6H A;  4YSL A;  4V0H A;  1VME A;  3A4Y A;  3IDZ A;  2M5D A;  2BFZ A;  5HIP A;  4TZ9 A;  3FAI A;  5ACT A;  3BK2 A;  1P9E A;  5DPX A;  5EH9 A;  2YNU A;  3T3O A;  2BFL A;  4NQ4 A;  1YCH A;  5ACR A;  2BMI A;  4GYQ A;  3ZQ4 A;  1WW1 A;  2YCB A;  4C1E A;  2OHI A;  2FHX A;  2GKL A;  5HH4 A;  2P18 A;  3I15 A;  2NYP A;  5HH5 A;  1WUP A;  4O98 A;  1DD6 A;  4UA4 A;  1BMC A;  2NZF A;  2AIO A;  5HIS A;  3SW3 A;  5KIK A;  2BTN A;  5LE1 A;  4RAM A;  2FU6 A;  5ACV A;  4H0D A;  4Z5Y A;  2P4Z A;  4AWY B;  3BC2 A;  3ZNB A;  1BC2 A;  2GFK A;  1YCF A;  2UYX A;  2H6A A;  4NQ6 A;  2Y87 A;  3Q6V A;  1XM8 A;  4BP0 A;  4J5F A;  3SPU A;  2OHJ A;  2GMN A;  4NQ5 A;  1BVT A;  2GCU A;  2P1E A;  5LS3 A;  5LMC A;  2XR1 A;  2BG7 A;  5ACQ A;  3IOF A;  2A7M A;  1XTO A;  4C09 A;  4JO0 A;  2FM6 A;  4AX1 B;  4EXS A;  3SRX A;  3VQZ A;  4ZEJ A;  4RL2 A;  2BGA A;  4KEQ A;  3RKJ A;  1ZKP A;  2BFK A;  1A7T A;  3MD7 A;  4AD9 A;  1DDK A;  4AWZ A;  2BG6 A;  5EVK A;  5LCH A;  3X2Y A;  1MQO A;  4EYF A;  2YNW A;  4D1T A;  2I7V A;  1A8T A;  2QIN A;  2I7T A;  4C1G A;  5HH6 A;  2BR6 A;  1WUO A;  5A0T A;  4HKY A;  4YSB A;  4RAW A;  5A5Z A;  1DXK A;  1YCG A;  2E7Y A;  4TYT A;  4U4L A;  4YSK A;  4EFZ A;  5A87 A;  5EVD A;  4ZO3 A;  2WYM C;  5EWA A;  3PG4 A;  3WXC A;  4EYB A;  3G1P A;  1QH3 A;  4RM5 A;  2Q0J A;  1JJE A;  5ACU A;  2WYM A;  4TZB A;  1VGN A;  2QDS A;  1L9Y A;  5B1U A;  4HL2 A;  3BK1 A;  1VJN A;  5FQA A;  2HB9 A;  2P97 A;  3DHC A;  3KL7 A;  1X8I A;  3KNS A;  3H3E A;  3I0V A;  2ZNB A;  5FQB A;  4Z67 A;  5EV8 A;  5IQK A;  3FCZ A;  3JXP A;  5LCA A;  4RBS A;  5ACS A;  4HL1 A;  3SD9 A;  3S0Z A;  2AZ4 A;  1E5D A;  1SML A;  5AHO A;  1KO3 A;  4GCW A;  4J5H A;  5AHR A;  5AYA A;  4FR7 A;  4XUK A;  5AXO A;  5K4N A;  1Y44 A;  4C1F A;  4BZ3 A;  3DHA A;  1JT1 A;  5EHT A;  2YNT B;  1HLK A;  2WYL A;  3R2U A;  4PVO A;  5KIL A;  4GYU A;  5HIO A;  2WHG A;  3X2Z A;  3IE1 A;  2GFJ A;  5K0W A;  3IEL A;  4F6Z A;  4B87 A;  5EV6 A;  2ZWR A;  5ACX A;  4CHL A;  4EYL A;  5B3R A;  3ZR9 A;  4RL0 A;  1WRA A;  3F9O A;  4TZE A;  3ZWF A;  2YNT A;  3QH8 A;  2Y8A A;  4NQ2 A;  5LCF A;  2M5C A;  3TP9 A;  4XWW A;  3X30 A;  3ADR A;  3L6N A;  3PY6 A;  2Q42 A;  4TZF A;  2Q9U A;  2BC2 A;  2YNV B;  4C1D A;  1M2X A;  4FSB A;  5LM6 A;  3T3N A;  4Z60 A;  2XF4 A;  3IE2 A;  3IOG A;  3VPE A;  2Q0I A;  2I7X A;  4KEP A;  4LE6 A;  3X2X A;  3AJ3 A;  4UBQ A;  3DH8 A;  4D1U A;  4C1H A;  4Z7R A;  4FEK A;  1X8H A;  4DIK A;  2YZ3 A;  4UWP B;  3IE0 A;  2OHH A;  2CBN A;  5ACP A;  5EVB A;  1JJT A;  4WD6 A;  4AX0 B;  2NZE A;  5LSC A;  2YNV A;  3T9M A;  3P2U A;  4UWR B;  4UWS B;  1ZTC A;  3IEK A;  3I14 A;  3AF6 A;  4D02 A;  4C1C A;  2Y8B A;  2DOO A;  3ESH A;  1K07 A;  2BG8 B;  5AXR A;  2QDT A;  5K4M A;  3AF5 A;  4ZNB A;  2VW8 A;  5AEB A;  1ZNB A;  3BV6 A;  4ZO2 A;  2FU9 A;  4D1V A;  3I11 A;  2R2D A;  5ACW A;  4EXY A;  4Z5Z A;  1KR3 A;  2FU8 A;  3SFP A;  3KNR A;  2ZZI A;  5HIQ A;  5K4K A;  5FQC A;  1X8G A;  2BIB A;  2BG2 A;  3DHB A;  3IEM A;  3RPC A;  4TYF A;  2BG8 A;  5LLD A;  2QED A;  2QJS A;  4EY2 A;  2BFZ B;  1QH5 A;  2FU7 A;  4Z6X A;  2NXA A;  4UAM A;  5A0V A;  2WRS A;  4XWT A;  2FK6 A;  1KO2 A;  2ZO4 A;  3RKK A;  3PY5 A;  3SBL A;  4PVT A; 
#chains in the Genus database with same CATH topology
 4DIL A;  5EW0 A;  4P62 A;  5B15 A;  3LVZ A;  2FHX B;  4UWO B;  2DKF A;  3I13 A;  4D1W A;  2CFU A;  4F6H A;  4YSL A;  4V0H A;  1VME A;  3A4Y A;  3IDZ A;  2M5D A;  2BFZ A;  5HIP A;  4TZ9 A;  3FAI A;  5ACT A;  3BK2 A;  5AIJ A;  1P9E A;  5DPX A;  5AJL A;  5EH9 A;  2YNU A;  3T3O A;  2BFL A;  4NQ4 A;  1YCH A;  5ACR A;  2BMI A;  4GYQ A;  3ZQ4 A;  1WW1 A;  2YCB A;  4C1E A;  2OHI A;  2FHX A;  2GKL A;  5HH4 A;  2P18 A;  3I15 A;  2NYP A;  5HH5 A;  1WUP A;  4O98 A;  1DD6 A;  4UA4 A;  1BMC A;  2NZF A;  2AIO A;  5HIS A;  3SW3 A;  5KIK A;  2BTN A;  5LE1 A;  4RAM A;  2FU6 A;  5ACV A;  4H0D A;  4Z5Y A;  2P4Z A;  4AWY B;  3BC2 A;  3ZNB A;  1BC2 A;  2GFK A;  1YCF A;  2UYX A;  2H6A A;  4NQ6 A;  2Y87 A;  3Q6V A;  1XM8 A;  4BP0 A;  4J5F A;  3SPU A;  2OHJ A;  2GMN A;  4NQ5 A;  1BVT A;  2GCU A;  2P1E A;  2CFZ A;  5LS3 A;  5LMC A;  2XR1 A;  2BG7 A;  5ACQ A;  3IOF A;  2A7M A;  1XTO A;  4C09 A;  4JO0 A;  2FM6 A;  4AX1 B;  4EXS A;  3SRX A;  3VQZ A;  4ZEJ A;  4RL2 A;  2BGA A;  4KEQ A;  3RKJ A;  1ZKP A;  2BFK A;  1A7T A;  3MD7 A;  4AD9 A;  1DDK A;  4AWZ A;  2BG6 A;  5EVK A;  5LCH A;  3X2Y A;  1MQO A;  4EYF A;  2YNW A;  4D1T A;  2I7V A;  1A8T A;  2QIN A;  2I7T A;  4C1G A;  5HH6 A;  2BR6 A;  1WUO A;  5A0T A;  4HKY A;  4YSB A;  4RAW A;  5A23 A;  5A5Z A;  1DXK A;  1YCG A;  2E7Y A;  4TYT A;  2CG3 A;  4U4L A;  4PDX A;  4YSK A;  4EFZ A;  5A87 A;  5EVD A;  4ZO3 A;  2WYM C;  5EWA A;  3PG4 A;  3WXC A;  4EYB A;  3G1P A;  1QH3 A;  4RM5 A;  2Q0J A;  1JJE A;  5ACU A;  2WYM A;  4TZB A;  1VGN A;  2QDS A;  1L9Y A;  5B1U A;  4HL2 A;  3BK1 A;  1VJN A;  5FQA A;  2HB9 A;  2P97 A;  3DHC A;  3KL7 A;  1X8I A;  3KNS A;  3H3E A;  3I0V A;  2ZNB A;  5FQB A;  4Z67 A;  5EV8 A;  5IQK A;  3FCZ A;  3JXP A;  5LCA A;  4RBS A;  5ACS A;  4NUR A;  4HL1 A;  3SD9 A;  3S0Z A;  2AZ4 A;  1E5D A;  1SML A;  5AHO A;  1KO3 A;  4GCW A;  4J5H A;  5AHR A;  5AYA A;  4FR7 A;  4XUK A;  5AXO A;  5K4N A;  1Y44 A;  4C1F A;  4BZ3 A;  3DHA A;  1JT1 A;  5EHT A;  2YNT B;  1HLK A;  2WYL A;  3R2U A;  4PVO A;  5KIL A;  4GYU A;  5HIO A;  2WHG A;  3X2Z A;  3IE1 A;  2GFJ A;  5K0W A;  3IEL A;  4F6Z A;  4B87 A;  5EV6 A;  2ZWR A;  5ACX A;  4CHL A;  4EYL A;  5B3R A;  3ZR9 A;  4RL0 A;  1WRA A;  3F9O A;  4TZE A;  3ZWF A;  2YNT A;  3QH8 A;  2Y8A A;  4NQ2 A;  4AV7 A;  5LCF A;  2M5C A;  3TP9 A;  4XWW A;  3X30 A;  3ADR A;  3L6N A;  3PY6 A;  2Q42 A;  4TZF A;  4AXH A;  2CG2 A;  2Q9U A;  2BC2 A;  2YNV B;  4C1D A;  1M2X A;  4FSB A;  5LM6 A;  3T3N A;  4Z60 A;  2XF4 A;  3IE2 A;  3IOG A;  3VPE A;  2Q0I A;  2I7X A;  4KEP A;  4LE6 A;  3X2X A;  3AJ3 A;  4UBQ A;  3DH8 A;  4D1U A;  4C1H A;  4Z7R A;  4FEK A;  1X8H A;  4DIK A;  2YZ3 A;  4UWP B;  3IE0 A;  2OHH A;  2CBN A;  5ACP A;  5EVB A;  1JJT A;  4WD6 A;  4AX0 B;  2NZE A;  5LSC A;  2YNV A;  3T9M A;  3P2U A;  4UWR B;  4UWS B;  1ZTC A;  3IEK A;  3I14 A;  3AF6 A;  4D02 A;  4C1C A;  2Y8B A;  2DOO A;  3ESH A;  1K07 A;  2BG8 B;  5AXR A;  2QDT A;  5K4M A;  3AF5 A;  4ZNB A;  2VW8 A;  5AEB A;  1ZNB A;  2YHE A;  3BV6 A;  4ZO2 A;  2FU9 A;  4D1V A;  3I11 A;  2R2D A;  5ACW A;  4EXY A;  4Z5Z A;  1KR3 A;  2FU8 A;  3SFP A;  3KNR A;  2ZZI A;  5HIQ A;  5K4K A;  5FQC A;  1X8G A;  2BIB A;  2BG2 A;  3DHB A;  3IEM A;  3RPC A;  4TYF A;  2BG8 A;  5LLD A;  2QED A;  2QJS A;  4EY2 A;  2BFZ B;  1QH5 A;  2FU7 A;  4Z6X A;  2NXA A;  4UAM A;  5A0V A;  2WRS A;  4XWT A;  2FK6 A;  1KO2 A;  2ZO4 A;  3RKK A;  3PY5 A;  3SBL A;  4PVT A; 
#chains in the Genus database with same CATH homology
 4DIL A;  5EW0 A;  4P62 A;  5B15 A;  3LVZ A;  2FHX B;  4UWO B;  2DKF A;  3I13 A;  4D1W A;  4F6H A;  4YSL A;  4V0H A;  1VME A;  3A4Y A;  3IDZ A;  2M5D A;  2BFZ A;  5HIP A;  4TZ9 A;  3FAI A;  5ACT A;  3BK2 A;  1P9E A;  5DPX A;  5EH9 A;  2YNU A;  3T3O A;  2BFL A;  4NQ4 A;  1YCH A;  5ACR A;  2BMI A;  4GYQ A;  3ZQ4 A;  1WW1 A;  2YCB A;  4C1E A;  2OHI A;  2FHX A;  2GKL A;  5HH4 A;  2P18 A;  3I15 A;  2NYP A;  5HH5 A;  1WUP A;  4O98 A;  1DD6 A;  4UA4 A;  1BMC A;  2NZF A;  2AIO A;  5HIS A;  3SW3 A;  5KIK A;  2BTN A;  5LE1 A;  4RAM A;  2FU6 A;  5ACV A;  4H0D A;  4Z5Y A;  2P4Z A;  4AWY B;  3BC2 A;  3ZNB A;  1BC2 A;  2GFK A;  1YCF A;  2UYX A;  2H6A A;  4NQ6 A;  2Y87 A;  3Q6V A;  1XM8 A;  4BP0 A;  4J5F A;  3SPU A;  2OHJ A;  2GMN A;  4NQ5 A;  1BVT A;  2GCU A;  2P1E A;  5LS3 A;  5LMC A;  2XR1 A;  2BG7 A;  5ACQ A;  3IOF A;  2A7M A;  1XTO A;  4C09 A;  4JO0 A;  2FM6 A;  4AX1 B;  4EXS A;  3SRX A;  3VQZ A;  4ZEJ A;  4RL2 A;  2BGA A;  4KEQ A;  3RKJ A;  1ZKP A;  2BFK A;  1A7T A;  3MD7 A;  4AD9 A;  1DDK A;  4AWZ A;  2BG6 A;  5EVK A;  5LCH A;  3X2Y A;  1MQO A;  4EYF A;  2YNW A;  4D1T A;  2I7V A;  1A8T A;  2QIN A;  2I7T A;  4C1G A;  5HH6 A;  2BR6 A;  1WUO A;  5A0T A;  4HKY A;  4YSB A;  4RAW A;  5A5Z A;  1DXK A;  1YCG A;  2E7Y A;  4TYT A;  4U4L A;  4YSK A;  4EFZ A;  5A87 A;  5EVD A;  4ZO3 A;  2WYM C;  5EWA A;  3PG4 A;  3WXC A;  4EYB A;  3G1P A;  1QH3 A;  4RM5 A;  2Q0J A;  1JJE A;  5ACU A;  2WYM A;  4TZB A;  1VGN A;  2QDS A;  1L9Y A;  5B1U A;  4HL2 A;  3BK1 A;  1VJN A;  5FQA A;  2HB9 A;  2P97 A;  3DHC A;  3KL7 A;  1X8I A;  3KNS A;  3H3E A;  3I0V A;  2ZNB A;  5FQB A;  4Z67 A;  5EV8 A;  5IQK A;  3FCZ A;  3JXP A;  5LCA A;  4RBS A;  5ACS A;  4HL1 A;  3SD9 A;  3S0Z A;  2AZ4 A;  1E5D A;  1SML A;  5AHO A;  1KO3 A;  4GCW A;  4J5H A;  5AHR A;  5AYA A;  4FR7 A;  4XUK A;  5AXO A;  5K4N A;  1Y44 A;  4C1F A;  4BZ3 A;  3DHA A;  1JT1 A;  5EHT A;  2YNT B;  1HLK A;  2WYL A;  3R2U A;  4PVO A;  5KIL A;  4GYU A;  5HIO A;  2WHG A;  3X2Z A;  3IE1 A;  2GFJ A;  5K0W A;  3IEL A;  4F6Z A;  4B87 A;  5EV6 A;  2ZWR A;  5ACX A;  4CHL A;  4EYL A;  5B3R A;  3ZR9 A;  4RL0 A;  1WRA A;  3F9O A;  4TZE A;  3ZWF A;  2YNT A;  3QH8 A;  2Y8A A;  4NQ2 A;  5LCF A;  2M5C A;  3TP9 A;  4XWW A;  3X30 A;  3ADR A;  3L6N A;  3PY6 A;  2Q42 A;  4TZF A;  2Q9U A;  2BC2 A;  2YNV B;  4C1D A;  1M2X A;  4FSB A;  5LM6 A;  3T3N A;  4Z60 A;  2XF4 A;  3IE2 A;  3IOG A;  3VPE A;  2Q0I A;  2I7X A;  4KEP A;  4LE6 A;  3X2X A;  3AJ3 A;  4UBQ A;  3DH8 A;  4D1U A;  4C1H A;  4Z7R A;  4FEK A;  1X8H A;  4DIK A;  2YZ3 A;  4UWP B;  3IE0 A;  2OHH A;  2CBN A;  5ACP A;  5EVB A;  1JJT A;  4WD6 A;  4AX0 B;  2NZE A;  5LSC A;  2YNV A;  3T9M A;  3P2U A;  4UWR B;  4UWS B;  1ZTC A;  3IEK A;  3I14 A;  3AF6 A;  4D02 A;  4C1C A;  2Y8B A;  2DOO A;  3ESH A;  1K07 A;  2BG8 B;  5AXR A;  2QDT A;  5K4M A;  3AF5 A;  4ZNB A;  2VW8 A;  5AEB A;  1ZNB A;  3BV6 A;  4ZO2 A;  2FU9 A;  4D1V A;  3I11 A;  2R2D A;  5ACW A;  4EXY A;  4Z5Z A;  1KR3 A;  2FU8 A;  3SFP A;  3KNR A;  2ZZI A;  5HIQ A;  5K4K A;  5FQC A;  1X8G A;  2BIB A;  2BG2 A;  3DHB A;  3IEM A;  3RPC A;  4TYF A;  2BG8 A;  5LLD A;  2QED A;  2QJS A;  4EY2 A;  2BFZ B;  1QH5 A;  2FU7 A;  4Z6X A;  2NXA A;  4UAM A;  5A0V A;  2WRS A;  4XWT A;  2FK6 A;  1KO2 A;  2ZO4 A;  3RKK A;  3PY5 A;  3SBL A;  4PVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...