5AEBA

Crystal structure of the class b3 di-zinc metallo-beta-lactamase lra- 12 from an alaskan soil metagenome.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
264
Chain Sequence
b'VKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LRA-12
publication title Crystal structure and kinetic analysis of the class B3 di-zinc metallo-beta-lactamase LRA-12 from an Alaskan soil metagenome.
pubmed doi rcsb
molecule tags Hydrolase
total genus 85
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5aebA00
2YNVB 5KILA 2Q42A 5K4KA 2BFZA 4FR7A 4GYUA 2BTNA 3PG4A 4Z60A 5AYAA 2BR6A 4C1HA 3I13A 4D1VA 4EY2A 2P1EA 2FU9A 4C1CA 3T9MA 3QH8A 3KNRA 2BIBA 3S0ZA 2R2DA 3IE1A 5A0VA 4UWSB 3JXPA 3MD7A 2WRSA 1A8TA 2WYLA 2YNTA 4Z5ZA 2I7VA 4AD9A 3X2ZA 4GCWA 3T3OA 2XR1A 2I7TA 5ACQA 3ESHA 3Q6VA 3SRXA 1K07A 2HB9A 4KEQA 3P2UA 4ZO2A 4Z5YA 5EV8A 4F6ZA 1Y44A 1QH3A 2BC2A 3RPCA 4EYBA 3IEMA 3ZQ4A 3IE0A 1YCFA 4YSBA 5K0WA 4AX1B 5ACPA 3PY5A 5ACVA 2DKFA 3A4YA 4LE6A 3ZWFA 4TYTA 5A87A 3RKJA 3AF6A 4Z6XA 2BG6A 4RBSA 5EW0A 2NZEA 2BG8A 1ZKPA 4D1UA 4U4LA 3IELA 2A7MA 2UYXA 2YNVA 4V0HA 1JT1A 4HL1A 2FHXB 5EH9A 3DHBA 5EVKA 3SW3A 5EVDA 1KO3A 4AWYB 1YCGA 5LS3A 2Q9UA 3RKKA 3IEKA 5K4NA 1SMLA 5ACTA 4EYLA 1ZNBA 3SFPA 1E5DA 1VJNA 4FSBA 1WUOA 5HH5A 4BZ3A 2WYMC 4BP0A 4D1TA 5LSCA 2YCBA 5AHRA 2BMIA 5ACSA 1WRAA 3DHAA 1VMEA 5LM6A 2VW8A 4RM5A 2QINA 4AX0B 3SPUA 4YSLA 1XTOA 4DIKA 3SBLA 4GYQA 5EV6A 4C1DA 4ZO3A 3T3NA 4P62A 5ACWA 4D02A 2QDSA 2OHHA 3I0VA 4UWOB 3I14A 4UAMA 5EWAA 4UBQA 1BMCA 5LCFA 4EXYA 3FCZA 4HKYA 4O98A 1P9EA 1DD6A 2FU7A 2OHIA 4JO0A 5HIPA 1DDKA 3VQZA 3F9OA 5FQBA 1A7TA 2CBNA 3TP9A 4WD6A 5LCHA 3SD9A 2Q0IA 2ZWRA 4PVTA 3I11A 2GKLA 3WXCA 3BK2A 3X2YA 1BVTA 2OHJA 1X8HA 2GFJA 2P97A 5HH4A 4RL0A 1QH5A 2QJSA 2BGAA 5IQKA 2Y87A 4H0DA 2BG2A 1KR3A 2NZFA 4Z67A 2Y8AA 5DPXA 4D1WA 5AXOA 2YNTB 2WYMA 2AIOA 2I7XA 2NYPA 2ZNBA 4TZBA 1L9YA 3DH8A 1WUPA 1YCHA 2P4ZA 4NQ2A 5HIOA 2BFLA 5AEBA 2M5DA 2BG7A 4XWWA 3LVZA 4EXSA 1JJEA 1JJTA 2YNUA 3AF5A 5K4MA 2XF4A 3KNSA 2ZZIA 5EHTA 3DHCA 3IOFA 5KIKA 3I15A 4NQ6A 1M2XA 5LCAA 4UWPB 4XUKA 5LMCA 2Y8BA 4CHLA 5FQAA 3PY6A 3FAIA 2YZ3A 3IE2A 5HIQA 3BK1A 4TZEA 4B87A 1DXKA 2P18A 5HISA 3BV6A 4TZ9A 5ACUA 5ACXA 1XM8A 3X30A 1X8IA 3H3EA 4TYFA 5AXRA 1VGNA 4YSKA 5B1UA 4ZEJA 1BC2A 4J5HA 3ZNBA 4RAWA 3BC2A 2FK6A 3AJ3A 2NXAA 4C1EA 4AWZA 4NQ4A 2Q0JA 1HLKA 2BFZB 4C1FA 2M5CA 4F6HA 5B3RA 3VPEA 5LE1A 4XWTA 2FHXA 4EFZA 4TZFA 4C09A 3G1PA 2BFKA 5A0TA 2E7YA 5A5ZA 4RL2A 2YNWA 1ZTCA 4C1GA 3ZR9A 2DOOA 5LLDA 2FM6A 4HL2A 4Z7RA 3L6NA 4FEKA 3IDZA 2FU6A 3ADRA 3KL7A 5ACRA 4KEPA 1KO2A 5B15A 4EYFA 4J5FA 1MQOA 2QEDA 2FU8A 4PVOA 4RAMA 5HH6A 2ZO4A 1X8GA 2H6AA 5EVBA 2AZ4A 5FQCA 1WW1A 2QDTA 2GCUA 4UA4A 2GMNA 2WHGA 3R2UA 4UWRB 4ZNBA 3IOGA 5AHOA 3X2XA 2BG8B 4NQ5A 2GFKA 4DILA
chains in the Genus database with same CATH superfamily
2YNVB 5KILA 2Q42A 5K4KA 2BFZA 4FR7A 4GYUA 4AV7A 2BTNA 3PG4A 4Z60A 5AYAA 2BR6A 4C1HA 3I13A 4D1VA 4EY2A 2P1EA 2FU9A 4C1CA 3T9MA 3QH8A 3KNRA 2BIBA 3S0ZA 2R2DA 3IE1A 5A0VA 4UWSB 3JXPA 3MD7A 2WRSA 1A8TA 2WYLA 2YNTA 4Z5ZA 2I7VA 4AD9A 3X2ZA 4GCWA 3T3OA 2XR1A 2I7TA 5ACQA 3ESHA 3Q6VA 2CG2A 3SRXA 1K07A 2HB9A 4KEQA 3P2UA 4ZO2A 4Z5YA 5EV8A 4F6ZA 1Y44A 1QH3A 2BC2A 3RPCA 4EYBA 3IEMA 2CG3A 3ZQ4A 3IE0A 1YCFA 4YSBA 5K0WA 4AX1B 5ACPA 3PY5A 5ACVA 2DKFA 3A4YA 4LE6A 3ZWFA 4TYTA 5A87A 3RKJA 3AF6A 4Z6XA 2BG6A 4RBSA 5EW0A 2NZEA 2BG8A 1ZKPA 4D1UA 4U4LA 3IELA 2A7MA 2UYXA 2YNVA 4V0HA 1JT1A 4HL1A 2FHXB 5EH9A 3DHBA 5EVKA 3SW3A 5EVDA 1KO3A 4AWYB 1YCGA 5LS3A 2Q9UA 3RKKA 3IEKA 5K4NA 1SMLA 5ACTA 4EYLA 1ZNBA 3SFPA 1E5DA 1VJNA 4FSBA 1WUOA 5HH5A 4BZ3A 2WYMC 4BP0A 4D1TA 5LSCA 2YCBA 5AHRA 2BMIA 5ACSA 1WRAA 3DHAA 1VMEA 5LM6A 2VW8A 4RM5A 2QINA 4AX0B 3SPUA 4YSLA 1XTOA 4DIKA 3SBLA 4GYQA 5EV6A 4C1DA 4ZO3A 3T3NA 4P62A 5ACWA 4D02A 4PDXA 2QDSA 2OHHA 3I0VA 4UWOB 3I14A 4UAMA 5EWAA 4AXHA 4UBQA 1BMCA 5LCFA 4EXYA 3FCZA 5AJLA 4HKYA 4O98A 1P9EA 1DD6A 2FU7A 2OHIA 4JO0A 5HIPA 1DDKA 3VQZA 3F9OA 5FQBA 1A7TA 2CBNA 3TP9A 4WD6A 5LCHA 3SD9A 2Q0IA 2ZWRA 4PVTA 3I11A 2GKLA 3WXCA 3BK2A 3X2YA 1BVTA 2OHJA 1X8HA 2GFJA 2P97A 5HH4A 4RL0A 1QH5A 2QJSA 2BGAA 5IQKA 2Y87A 4H0DA 2BG2A 1KR3A 2NZFA 4Z67A 2Y8AA 5DPXA 4D1WA 5AXOA 2YNTB 2WYMA 2AIOA 2I7XA 2NYPA 2ZNBA 4TZBA 1L9YA 3DH8A 1WUPA 1YCHA 2P4ZA 4NQ2A 5HIOA 2BFLA 5AEBA 2M5DA 2BG7A 4XWWA 3LVZA 4EXSA 1JJEA 1JJTA 2YNUA 3AF5A 5K4MA 2XF4A 3KNSA 2ZZIA 5EHTA 3DHCA 3IOFA 5KIKA 3I15A 4NQ6A 1M2XA 5LCAA 4UWPB 4XUKA 5LMCA 2Y8BA 4CHLA 5FQAA 3PY6A 3FAIA 2YZ3A 3IE2A 5HIQA 3BK1A 4TZEA 2CFUA 4B87A 1DXKA 2P18A 5A23A 5HISA 3BV6A 4TZ9A 5ACUA 5ACXA 1XM8A 3X30A 1X8IA 3H3EA 4TYFA 5AXRA 1VGNA 4YSKA 5B1UA 4ZEJA 1BC2A 4NURA 4J5HA 3ZNBA 4RAWA 3BC2A 2FK6A 3AJ3A 2NXAA 4C1EA 4AWZA 4NQ4A 5AIJA 2Q0JA 1HLKA 2BFZB 4C1FA 2M5CA 4F6HA 5B3RA 3VPEA 5LE1A 4XWTA 2FHXA 4EFZA 4TZFA 4C09A 3G1PA 2BFKA 5A0TA 2E7YA 5A5ZA 4RL2A 2YNWA 1ZTCA 4C1GA 3ZR9A 2DOOA 5LLDA 2FM6A 4HL2A 4Z7RA 3L6NA 4FEKA 3IDZA 2FU6A 3ADRA 3KL7A 5ACRA 4KEPA 1KO2A 2CFZA 5B15A 4EYFA 4J5FA 1MQOA 2QEDA 2FU8A 4PVOA 4RAMA 5HH6A 2ZO4A 1X8GA 2H6AA 5EVBA 2YHEA 2AZ4A 5FQCA 1WW1A 2QDTA 2GCUA 4UA4A 2GMNA 2WHGA 3R2UA 4UWRB 4ZNBA 3IOGA 5AHOA 3X2XA 2BG8B 4NQ5A 2GFKA 4DILA
chains in the Genus database with same CATH topology
2YNVB 5KILA 2Q42A 5K4KA 2BFZA 4FR7A 4GYUA 2BTNA 3PG4A 4Z60A 5AYAA 2BR6A 4C1HA 3I13A 4D1VA 4EY2A 2P1EA 2FU9A 4C1CA 3T9MA 3QH8A 3KNRA 2BIBA 3S0ZA 2R2DA 3IE1A 5A0VA 4UWSB 3JXPA 3MD7A 2WRSA 1A8TA 2WYLA 2YNTA 4Z5ZA 2I7VA 4AD9A 3X2ZA 4GCWA 3T3OA 2XR1A 2I7TA 5ACQA 3ESHA 3Q6VA 3SRXA 1K07A 2HB9A 4KEQA 3P2UA 4ZO2A 4Z5YA 5EV8A 4F6ZA 1Y44A 1QH3A 2BC2A 3RPCA 4EYBA 3IEMA 3ZQ4A 3IE0A 1YCFA 4YSBA 5K0WA 4AX1B 5ACPA 3PY5A 5ACVA 2DKFA 3A4YA 4LE6A 3ZWFA 4TYTA 5A87A 3RKJA 3AF6A 4Z6XA 2BG6A 4RBSA 5EW0A 2NZEA 2BG8A 1ZKPA 4D1UA 4U4LA 3IELA 2A7MA 2UYXA 2YNVA 4V0HA 1JT1A 4HL1A 2FHXB 5EH9A 3DHBA 5EVKA 3SW3A 5EVDA 1KO3A 4AWYB 1YCGA 5LS3A 2Q9UA 3RKKA 3IEKA 5K4NA 1SMLA 5ACTA 4EYLA 1ZNBA 3SFPA 1E5DA 1VJNA 4FSBA 1WUOA 5HH5A 4BZ3A 2WYMC 4BP0A 4D1TA 5LSCA 2YCBA 5AHRA 2BMIA 5ACSA 1WRAA 3DHAA 1VMEA 5LM6A 2VW8A 4RM5A 2QINA 4AX0B 3SPUA 4YSLA 1XTOA 4DIKA 3SBLA 4GYQA 5EV6A 4C1DA 4ZO3A 3T3NA 4P62A 5ACWA 4D02A 2QDSA 2OHHA 3I0VA 4UWOB 3I14A 4UAMA 5EWAA 4UBQA 1BMCA 5LCFA 4EXYA 3FCZA 4HKYA 4O98A 1P9EA 1DD6A 2FU7A 2OHIA 4JO0A 5HIPA 1DDKA 3VQZA 3F9OA 5FQBA 1A7TA 2CBNA 3TP9A 4WD6A 5LCHA 3SD9A 2Q0IA 2ZWRA 4PVTA 3I11A 2GKLA 3WXCA 3BK2A 3X2YA 1BVTA 2OHJA 1X8HA 2GFJA 2P97A 5HH4A 4RL0A 1QH5A 2QJSA 2BGAA 5IQKA 2Y87A 4H0DA 2BG2A 1KR3A 2NZFA 4Z67A 2Y8AA 5DPXA 4D1WA 5AXOA 2YNTB 2WYMA 2AIOA 2I7XA 2NYPA 2ZNBA 4TZBA 1L9YA 3DH8A 1WUPA 1YCHA 2P4ZA 4NQ2A 5HIOA 2BFLA 5AEBA 2M5DA 2BG7A 4XWWA 3LVZA 4EXSA 1JJEA 1JJTA 2YNUA 3AF5A 5K4MA 2XF4A 3KNSA 2ZZIA 5EHTA 3DHCA 3IOFA 5KIKA 3I15A 4NQ6A 1M2XA 5LCAA 4UWPB 4XUKA 5LMCA 2Y8BA 4CHLA 5FQAA 3PY6A 3FAIA 2YZ3A 3IE2A 5HIQA 3BK1A 4TZEA 4B87A 1DXKA 2P18A 5HISA 3BV6A 4TZ9A 5ACUA 5ACXA 1XM8A 3X30A 1X8IA 3H3EA 4TYFA 5AXRA 1VGNA 4YSKA 5B1UA 4ZEJA 1BC2A 4J5HA 3ZNBA 4RAWA 3BC2A 2FK6A 3AJ3A 2NXAA 4C1EA 4AWZA 4NQ4A 2Q0JA 1HLKA 2BFZB 4C1FA 2M5CA 4F6HA 5B3RA 3VPEA 5LE1A 4XWTA 2FHXA 4EFZA 4TZFA 4C09A 3G1PA 2BFKA 5A0TA 2E7YA 5A5ZA 4RL2A 2YNWA 1ZTCA 4C1GA 3ZR9A 2DOOA 5LLDA 2FM6A 4HL2A 4Z7RA 3L6NA 4FEKA 3IDZA 2FU6A 3ADRA 3KL7A 5ACRA 4KEPA 1KO2A 5B15A 4EYFA 4J5FA 1MQOA 2QEDA 2FU8A 4PVOA 4RAMA 5HH6A 2ZO4A 1X8GA 2H6AA 5EVBA 2AZ4A 5FQCA 1WW1A 2QDTA 2GCUA 4UA4A 2GMNA 2WHGA 3R2UA 4UWRB 4ZNBA 3IOGA 5AHOA 3X2XA 2BG8B 4NQ5A 2GFKA 4DILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YNV B;  5KIL A;  2Q42 A;  5K4K A;  2BFZ A;  4FR7 A;  4GYU A;  2BTN A;  3PG4 A;  4Z60 A;  5AYA A;  2BR6 A;  4C1H A;  3I13 A;  4D1V A;  4EY2 A;  2P1E A;  2FU9 A;  4C1C A;  3T9M A;  3QH8 A;  3KNR A;  2BIB A;  3S0Z A;  2R2D A;  3IE1 A;  5A0V A;  4UWS B;  3JXP A;  3MD7 A;  2WRS A;  1A8T A;  2WYL A;  2YNT A;  4Z5Z A;  2I7V A;  4AD9 A;  3X2Z A;  4GCW A;  3T3O A;  2XR1 A;  2I7T A;  5ACQ A;  3ESH A;  3Q6V A;  3SRX A;  1K07 A;  2HB9 A;  4KEQ A;  3P2U A;  4ZO2 A;  4Z5Y A;  5EV8 A;  4F6Z A;  1Y44 A;  1QH3 A;  2BC2 A;  3RPC A;  4EYB A;  3IEM A;  3ZQ4 A;  3IE0 A;  1YCF A;  4YSB A;  5K0W A;  4AX1 B;  5ACP A;  3PY5 A;  5ACV A;  2DKF A;  3A4Y A;  4LE6 A;  3ZWF A;  4TYT A;  5A87 A;  3RKJ A;  3AF6 A;  4Z6X A;  2BG6 A;  4RBS A;  5EW0 A;  2NZE A;  2BG8 A;  1ZKP A;  4D1U A;  4U4L A;  3IEL A;  2A7M A;  2UYX A;  2YNV A;  4V0H A;  1JT1 A;  4HL1 A;  2FHX B;  5EH9 A;  3DHB A;  5EVK A;  3SW3 A;  5EVD A;  1KO3 A;  4AWY B;  1YCG A;  5LS3 A;  2Q9U A;  3RKK A;  3IEK A;  5K4N A;  1SML A;  5ACT A;  4EYL A;  1ZNB A;  3SFP A;  1E5D A;  1VJN A;  4FSB A;  1WUO A;  5HH5 A;  4BZ3 A;  2WYM C;  4BP0 A;  4D1T A;  5LSC A;  2YCB A;  5AHR A;  2BMI A;  5ACS A;  1WRA A;  3DHA A;  1VME A;  5LM6 A;  2VW8 A;  4RM5 A;  2QIN A;  4AX0 B;  3SPU A;  4YSL A;  1XTO A;  4DIK A;  3SBL A;  4GYQ A;  5EV6 A;  4C1D A;  4ZO3 A;  3T3N A;  4P62 A;  5ACW A;  4D02 A;  2QDS A;  2OHH A;  3I0V A;  4UWO B;  3I14 A;  4UAM A;  5EWA A;  4UBQ A;  1BMC A;  5LCF A;  4EXY A;  3FCZ A;  4HKY A;  4O98 A;  1P9E A;  1DD6 A;  2FU7 A;  2OHI A;  4JO0 A;  5HIP A;  1DDK A;  3VQZ A;  3F9O A;  5FQB A;  1A7T A;  2CBN A;  3TP9 A;  4WD6 A;  5LCH A;  3SD9 A;  2Q0I A;  2ZWR A;  4PVT A;  3I11 A;  2GKL A;  3WXC A;  3BK2 A;  3X2Y A;  1BVT A;  2OHJ A;  1X8H A;  2GFJ A;  2P97 A;  5HH4 A;  4RL0 A;  1QH5 A;  2QJS A;  2BGA A;  5IQK A;  2Y87 A;  4H0D A;  2BG2 A;  1KR3 A;  2NZF A;  4Z67 A;  2Y8A A;  5DPX A;  4D1W A;  5AXO A;  2YNT B;  2WYM A;  2AIO A;  2I7X A;  2NYP A;  2ZNB A;  4TZB A;  1L9Y A;  3DH8 A;  1WUP A;  1YCH A;  2P4Z A;  4NQ2 A;  5HIO A;  2BFL A;  5AEB A;  2M5D A;  2BG7 A;  4XWW A;  3LVZ A;  4EXS A;  1JJE A;  1JJT A;  2YNU A;  3AF5 A;  5K4M A;  2XF4 A;  3KNS A;  2ZZI A;  5EHT A;  3DHC A;  3IOF A;  5KIK A;  3I15 A;  4NQ6 A;  1M2X A;  5LCA A;  4UWP B;  4XUK A;  5LMC A;  2Y8B A;  4CHL A;  5FQA A;  3PY6 A;  3FAI A;  2YZ3 A;  3IE2 A;  5HIQ A;  3BK1 A;  4TZE A;  4B87 A;  1DXK A;  2P18 A;  5HIS A;  3BV6 A;  4TZ9 A;  5ACU A;  5ACX A;  1XM8 A;  3X30 A;  1X8I A;  3H3E A;  4TYF A;  5AXR A;  1VGN A;  4YSK A;  5B1U A;  4ZEJ A;  1BC2 A;  4J5H A;  3ZNB A;  4RAW A;  3BC2 A;  2FK6 A;  3AJ3 A;  2NXA A;  4C1E A;  4AWZ A;  4NQ4 A;  2Q0J A;  1HLK A;  2BFZ B;  4C1F A;  2M5C A;  4F6H A;  5B3R A;  3VPE A;  5LE1 A;  4XWT A;  2FHX A;  4EFZ A;  4TZF A;  4C09 A;  3G1P A;  2BFK A;  5A0T A;  2E7Y A;  5A5Z A;  4RL2 A;  2YNW A;  1ZTC A;  4C1G A;  3ZR9 A;  2DOO A;  5LLD A;  2FM6 A;  4HL2 A;  4Z7R A;  3L6N A;  4FEK A;  3IDZ A;  2FU6 A;  3ADR A;  3KL7 A;  5ACR A;  4KEP A;  1KO2 A;  5B15 A;  4EYF A;  4J5F A;  1MQO A;  2QED A;  2FU8 A;  4PVO A;  4RAM A;  5HH6 A;  2ZO4 A;  1X8G A;  2H6A A;  5EVB A;  2AZ4 A;  5FQC A;  1WW1 A;  2QDT A;  2GCU A;  4UA4 A;  2GMN A;  2WHG A;  3R2U A;  4UWR B;  4ZNB A;  3IOG A;  5AHO A;  3X2X A;  2BG8 B;  4NQ5 A;  2GFK A;  4DIL A; 
#chains in the Genus database with same CATH topology
 2YNV B;  5KIL A;  2Q42 A;  5K4K A;  2BFZ A;  4FR7 A;  4GYU A;  4AV7 A;  2BTN A;  3PG4 A;  4Z60 A;  5AYA A;  2BR6 A;  4C1H A;  3I13 A;  4D1V A;  4EY2 A;  2P1E A;  2FU9 A;  4C1C A;  3T9M A;  3QH8 A;  3KNR A;  2BIB A;  3S0Z A;  2R2D A;  3IE1 A;  5A0V A;  4UWS B;  3JXP A;  3MD7 A;  2WRS A;  1A8T A;  2WYL A;  2YNT A;  4Z5Z A;  2I7V A;  4AD9 A;  3X2Z A;  4GCW A;  3T3O A;  2XR1 A;  2I7T A;  5ACQ A;  3ESH A;  3Q6V A;  2CG2 A;  3SRX A;  1K07 A;  2HB9 A;  4KEQ A;  3P2U A;  4ZO2 A;  4Z5Y A;  5EV8 A;  4F6Z A;  1Y44 A;  1QH3 A;  2BC2 A;  3RPC A;  4EYB A;  3IEM A;  2CG3 A;  3ZQ4 A;  3IE0 A;  1YCF A;  4YSB A;  5K0W A;  4AX1 B;  5ACP A;  3PY5 A;  5ACV A;  2DKF A;  3A4Y A;  4LE6 A;  3ZWF A;  4TYT A;  5A87 A;  3RKJ A;  3AF6 A;  4Z6X A;  2BG6 A;  4RBS A;  5EW0 A;  2NZE A;  2BG8 A;  1ZKP A;  4D1U A;  4U4L A;  3IEL A;  2A7M A;  2UYX A;  2YNV A;  4V0H A;  1JT1 A;  4HL1 A;  2FHX B;  5EH9 A;  3DHB A;  5EVK A;  3SW3 A;  5EVD A;  1KO3 A;  4AWY B;  1YCG A;  5LS3 A;  2Q9U A;  3RKK A;  3IEK A;  5K4N A;  1SML A;  5ACT A;  4EYL A;  1ZNB A;  3SFP A;  1E5D A;  1VJN A;  4FSB A;  1WUO A;  5HH5 A;  4BZ3 A;  2WYM C;  4BP0 A;  4D1T A;  5LSC A;  2YCB A;  5AHR A;  2BMI A;  5ACS A;  1WRA A;  3DHA A;  1VME A;  5LM6 A;  2VW8 A;  4RM5 A;  2QIN A;  4AX0 B;  3SPU A;  4YSL A;  1XTO A;  4DIK A;  3SBL A;  4GYQ A;  5EV6 A;  4C1D A;  4ZO3 A;  3T3N A;  4P62 A;  5ACW A;  4D02 A;  4PDX A;  2QDS A;  2OHH A;  3I0V A;  4UWO B;  3I14 A;  4UAM A;  5EWA A;  4AXH A;  4UBQ A;  1BMC A;  5LCF A;  4EXY A;  3FCZ A;  5AJL A;  4HKY A;  4O98 A;  1P9E A;  1DD6 A;  2FU7 A;  2OHI A;  4JO0 A;  5HIP A;  1DDK A;  3VQZ A;  3F9O A;  5FQB A;  1A7T A;  2CBN A;  3TP9 A;  4WD6 A;  5LCH A;  3SD9 A;  2Q0I A;  2ZWR A;  4PVT A;  3I11 A;  2GKL A;  3WXC A;  3BK2 A;  3X2Y A;  1BVT A;  2OHJ A;  1X8H A;  2GFJ A;  2P97 A;  5HH4 A;  4RL0 A;  1QH5 A;  2QJS A;  2BGA A;  5IQK A;  2Y87 A;  4H0D A;  2BG2 A;  1KR3 A;  2NZF A;  4Z67 A;  2Y8A A;  5DPX A;  4D1W A;  5AXO A;  2YNT B;  2WYM A;  2AIO A;  2I7X A;  2NYP A;  2ZNB A;  4TZB A;  1L9Y A;  3DH8 A;  1WUP A;  1YCH A;  2P4Z A;  4NQ2 A;  5HIO A;  2BFL A;  5AEB A;  2M5D A;  2BG7 A;  4XWW A;  3LVZ A;  4EXS A;  1JJE A;  1JJT A;  2YNU A;  3AF5 A;  5K4M A;  2XF4 A;  3KNS A;  2ZZI A;  5EHT A;  3DHC A;  3IOF A;  5KIK A;  3I15 A;  4NQ6 A;  1M2X A;  5LCA A;  4UWP B;  4XUK A;  5LMC A;  2Y8B A;  4CHL A;  5FQA A;  3PY6 A;  3FAI A;  2YZ3 A;  3IE2 A;  5HIQ A;  3BK1 A;  4TZE A;  2CFU A;  4B87 A;  1DXK A;  2P18 A;  5A23 A;  5HIS A;  3BV6 A;  4TZ9 A;  5ACU A;  5ACX A;  1XM8 A;  3X30 A;  1X8I A;  3H3E A;  4TYF A;  5AXR A;  1VGN A;  4YSK A;  5B1U A;  4ZEJ A;  1BC2 A;  4NUR A;  4J5H A;  3ZNB A;  4RAW A;  3BC2 A;  2FK6 A;  3AJ3 A;  2NXA A;  4C1E A;  4AWZ A;  4NQ4 A;  5AIJ A;  2Q0J A;  1HLK A;  2BFZ B;  4C1F A;  2M5C A;  4F6H A;  5B3R A;  3VPE A;  5LE1 A;  4XWT A;  2FHX A;  4EFZ A;  4TZF A;  4C09 A;  3G1P A;  2BFK A;  5A0T A;  2E7Y A;  5A5Z A;  4RL2 A;  2YNW A;  1ZTC A;  4C1G A;  3ZR9 A;  2DOO A;  5LLD A;  2FM6 A;  4HL2 A;  4Z7R A;  3L6N A;  4FEK A;  3IDZ A;  2FU6 A;  3ADR A;  3KL7 A;  5ACR A;  4KEP A;  1KO2 A;  2CFZ A;  5B15 A;  4EYF A;  4J5F A;  1MQO A;  2QED A;  2FU8 A;  4PVO A;  4RAM A;  5HH6 A;  2ZO4 A;  1X8G A;  2H6A A;  5EVB A;  2YHE A;  2AZ4 A;  5FQC A;  1WW1 A;  2QDT A;  2GCU A;  4UA4 A;  2GMN A;  2WHG A;  3R2U A;  4UWR B;  4ZNB A;  3IOG A;  5AHO A;  3X2X A;  2BG8 B;  4NQ5 A;  2GFK A;  4DIL A; 
#chains in the Genus database with same CATH homology
 2YNV B;  5KIL A;  2Q42 A;  5K4K A;  2BFZ A;  4FR7 A;  4GYU A;  2BTN A;  3PG4 A;  4Z60 A;  5AYA A;  2BR6 A;  4C1H A;  3I13 A;  4D1V A;  4EY2 A;  2P1E A;  2FU9 A;  4C1C A;  3T9M A;  3QH8 A;  3KNR A;  2BIB A;  3S0Z A;  2R2D A;  3IE1 A;  5A0V A;  4UWS B;  3JXP A;  3MD7 A;  2WRS A;  1A8T A;  2WYL A;  2YNT A;  4Z5Z A;  2I7V A;  4AD9 A;  3X2Z A;  4GCW A;  3T3O A;  2XR1 A;  2I7T A;  5ACQ A;  3ESH A;  3Q6V A;  3SRX A;  1K07 A;  2HB9 A;  4KEQ A;  3P2U A;  4ZO2 A;  4Z5Y A;  5EV8 A;  4F6Z A;  1Y44 A;  1QH3 A;  2BC2 A;  3RPC A;  4EYB A;  3IEM A;  3ZQ4 A;  3IE0 A;  1YCF A;  4YSB A;  5K0W A;  4AX1 B;  5ACP A;  3PY5 A;  5ACV A;  2DKF A;  3A4Y A;  4LE6 A;  3ZWF A;  4TYT A;  5A87 A;  3RKJ A;  3AF6 A;  4Z6X A;  2BG6 A;  4RBS A;  5EW0 A;  2NZE A;  2BG8 A;  1ZKP A;  4D1U A;  4U4L A;  3IEL A;  2A7M A;  2UYX A;  2YNV A;  4V0H A;  1JT1 A;  4HL1 A;  2FHX B;  5EH9 A;  3DHB A;  5EVK A;  3SW3 A;  5EVD A;  1KO3 A;  4AWY B;  1YCG A;  5LS3 A;  2Q9U A;  3RKK A;  3IEK A;  5K4N A;  1SML A;  5ACT A;  4EYL A;  1ZNB A;  3SFP A;  1E5D A;  1VJN A;  4FSB A;  1WUO A;  5HH5 A;  4BZ3 A;  2WYM C;  4BP0 A;  4D1T A;  5LSC A;  2YCB A;  5AHR A;  2BMI A;  5ACS A;  1WRA A;  3DHA A;  1VME A;  5LM6 A;  2VW8 A;  4RM5 A;  2QIN A;  4AX0 B;  3SPU A;  4YSL A;  1XTO A;  4DIK A;  3SBL A;  4GYQ A;  5EV6 A;  4C1D A;  4ZO3 A;  3T3N A;  4P62 A;  5ACW A;  4D02 A;  2QDS A;  2OHH A;  3I0V A;  4UWO B;  3I14 A;  4UAM A;  5EWA A;  4UBQ A;  1BMC A;  5LCF A;  4EXY A;  3FCZ A;  4HKY A;  4O98 A;  1P9E A;  1DD6 A;  2FU7 A;  2OHI A;  4JO0 A;  5HIP A;  1DDK A;  3VQZ A;  3F9O A;  5FQB A;  1A7T A;  2CBN A;  3TP9 A;  4WD6 A;  5LCH A;  3SD9 A;  2Q0I A;  2ZWR A;  4PVT A;  3I11 A;  2GKL A;  3WXC A;  3BK2 A;  3X2Y A;  1BVT A;  2OHJ A;  1X8H A;  2GFJ A;  2P97 A;  5HH4 A;  4RL0 A;  1QH5 A;  2QJS A;  2BGA A;  5IQK A;  2Y87 A;  4H0D A;  2BG2 A;  1KR3 A;  2NZF A;  4Z67 A;  2Y8A A;  5DPX A;  4D1W A;  5AXO A;  2YNT B;  2WYM A;  2AIO A;  2I7X A;  2NYP A;  2ZNB A;  4TZB A;  1L9Y A;  3DH8 A;  1WUP A;  1YCH A;  2P4Z A;  4NQ2 A;  5HIO A;  2BFL A;  5AEB A;  2M5D A;  2BG7 A;  4XWW A;  3LVZ A;  4EXS A;  1JJE A;  1JJT A;  2YNU A;  3AF5 A;  5K4M A;  2XF4 A;  3KNS A;  2ZZI A;  5EHT A;  3DHC A;  3IOF A;  5KIK A;  3I15 A;  4NQ6 A;  1M2X A;  5LCA A;  4UWP B;  4XUK A;  5LMC A;  2Y8B A;  4CHL A;  5FQA A;  3PY6 A;  3FAI A;  2YZ3 A;  3IE2 A;  5HIQ A;  3BK1 A;  4TZE A;  4B87 A;  1DXK A;  2P18 A;  5HIS A;  3BV6 A;  4TZ9 A;  5ACU A;  5ACX A;  1XM8 A;  3X30 A;  1X8I A;  3H3E A;  4TYF A;  5AXR A;  1VGN A;  4YSK A;  5B1U A;  4ZEJ A;  1BC2 A;  4J5H A;  3ZNB A;  4RAW A;  3BC2 A;  2FK6 A;  3AJ3 A;  2NXA A;  4C1E A;  4AWZ A;  4NQ4 A;  2Q0J A;  1HLK A;  2BFZ B;  4C1F A;  2M5C A;  4F6H A;  5B3R A;  3VPE A;  5LE1 A;  4XWT A;  2FHX A;  4EFZ A;  4TZF A;  4C09 A;  3G1P A;  2BFK A;  5A0T A;  2E7Y A;  5A5Z A;  4RL2 A;  2YNW A;  1ZTC A;  4C1G A;  3ZR9 A;  2DOO A;  5LLD A;  2FM6 A;  4HL2 A;  4Z7R A;  3L6N A;  4FEK A;  3IDZ A;  2FU6 A;  3ADR A;  3KL7 A;  5ACR A;  4KEP A;  1KO2 A;  5B15 A;  4EYF A;  4J5F A;  1MQO A;  2QED A;  2FU8 A;  4PVO A;  4RAM A;  5HH6 A;  2ZO4 A;  1X8G A;  2H6A A;  5EVB A;  2AZ4 A;  5FQC A;  1WW1 A;  2QDT A;  2GCU A;  4UA4 A;  2GMN A;  2WHG A;  3R2U A;  4UWR B;  4ZNB A;  3IOG A;  5AHO A;  3X2X A;  2BG8 B;  4NQ5 A;  2GFK A;  4DIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...