5AEBA

Crystal structure of the class b3 di-zinc metallo-beta-lactamase lra- 12 from an alaskan soil metagenome.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
264
structure length
264
Chain Sequence
VKEPTVSNADWSKPYRPFRIAGNLYYIGTYDLACYLITTKQGNIIVNTGLAASALQIKNNIKALGFKLTDTKILLTTQAHYDHLGAMAEIKKITGAKLMADEGDATVMADGGSSDYAFGGHGSMFEPIIADRLLHDKDTIQLGDTKLVMLHHPGHTKGSCSFLFDTKDEQRSYRILIANMPTIVIEKKFSEVSSYPGIAKDYAYTLQAMKNLSFDIWVASHASQFSMHSKHKPGDGYNPKSFMDRKGYDESLDKLQKEYEKHLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords LRA-12
publication title Crystal structure and kinetic analysis of the class B3 di-zinc metallo-beta-lactamase LRA-12 from an Alaskan soil metagenome.
pubmed doi rcsb
total genus 85
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5aebA00
2I7XA 3H3EA 1DXKA 4RBSA 2DKFA 1A8TA 2BC2A 5LMCA 1XM8A 5ACTA 4RAMA 4TYTA 1WUPA 3VQZA 4ZNBA 3KNRA 3BK2A 3AJ3A 5EV6A 2Q0JA 3IE0A 2BR6A 5HH5A 3AF5A 1BMCA 5ACUA 2BG8A 4V0HA 1VGNA 1E5DA 5EWAA 1JJEA 3X30A 4NQ2A 2ZNBA 4YSLA 3ZWFA 1X8IA 5AHOA 4H0DA 4TZBA 4FSBA 3ADRA 3KNSA 2I7TA 4RL0A 3RKJA 3A4YA 1XTOA 2R2DA 3I15A 1ZNBA 1YCHA 5LCFA 2WHGA 4PVTA 4GYUA 5LE1A 1VMEA 5A0VA 2FU8A 2FU6A 5B3RA 3SRXA 4ZEJA 4Z5YA 3MD7A 4C1DA 4DIKA 5LCAA 2YNTB 2ZZIA 2BFZB 1WRAA 3SD9A 2M5DA 3RKKA 3ZR9A 1P9EA 3X2ZA 3IEKA 5AXRA 4WD6A 2E7YA 4EYBA 4JO0A 1KO3A 5EW0A 3RPCA 2BG6A 3I13A 3I0VA 3PY5A 2ZWRA 2XR1A 1WUOA 1JJTA 3SPUA 4UWSB 2YNUA 1YCFA 4UBQA 5EVBA 4LE6A 3BV6A 4C1GA 3QH8A 4Z7RA 3Q6VA 3P2UA 3IEMA 3TP9A 4Z5ZA 5AEBA 2OHJA 4C1HA 5LM6A 5HIPA 4ZO2A 4PVOA 3I14A 5A87A 4D1WA 5B15A 4F6ZA 5HISA 2P1EA 2QEDA 5HIOA 4ZO3A 3X2XA 2YNTA 3DHAA 2P4ZA 2BFZA 1MQOA 5EHTA 4TZ9A 4EXYA 4BP0A 4YSBA 2FM6A 4Z60A 2A7MA 2AZ4A 4HL1A 5AHRA 2BFKA 3T9MA 2Y87A 5ACVA 3FAIA 4TYFA 2FU9A 2GFKA 4AWZA 1SMLA 3ZNBA 2H6AA 5LSCA 3BK1A 2WYLA 2GCUA 2BMIA 3ESHA 2QJSA 3I11A 2NZEA 3SW3A 1QH3A 4XUKA 2UYXA 5A5ZA 1Y44A 3SBLA 2FU7A 2WRSA 4J5HA 4UWPB 5AYAA 2QDSA 4EFZA 1DDKA 5ACSA 2Q9UA 4UWRB 5EVKA 1KR3A 5ACPA 1HLKA 2YNWA 4FEKA 1K07A 4Z6XA 2BTNA 5EV8A 5B1UA 1BC2A 2WYMA 3G1PA 4RM5A 4F6HA 3KL7A 5A0TA 1ZKPA 2Y8BA 5ACQA 3IOGA 3L6NA 4BZ3A 4EXSA 4NQ4A 4O98A 4UWOB 4GCWA 4C1FA 2BG2A 2XF4A 5KIKA 4D1UA 4B87A 1YCGA 4GYQA 5HH4A 2AIOA 4D1TA 2BG7A 2BGAA 2BFLA 5FQAA 1BVTA 3DH8A 4EYLA 2QINA 2YCBA 3IE1A 1JT1A 5LLDA 3S0ZA 5HIQA 4FR7A 3R2UA 5HH6A 4DILA 3DHBA 5KILA 5K0WA 4C1EA 4UAMA 1L9YA 4AWYB 3JXPA 2YZ3A 4NQ6A 5IQKA 2NZFA 3SFPA 2NXAA 2YNVA 3PY6A 5K4MA 2FHXA 3ZQ4A 4AD9A 2M5CA 2ZO4A 3PG4A 4J5FA 4TZEA 4D02A 4RAWA 2GMNA 3T3NA 4CHLA 2GFJA 3DHCA 4EY2A 3F9OA 1WW1A 4TZFA 4D1VA 4Z67A 4KEQA 2CBNA 2FK6A 2I7VA 4XWTA 4HKYA 5AXOA 5LCHA 4EYFA 5LS3A 2WYMC 4P62A 3IELA 4YSKA 4HL2A 5FQCA 2DOOA 3T3OA 4KEPA 5EH9A 1X8GA 2OHIA 2Q0IA 1VJNA 3X2YA 3IDZA 4NQ5A 3AF6A 5ACWA 5DPXA 2YNVB 2FHXB 5K4NA 1A7TA 1X8HA 5EVDA 2NYPA 2P18A 2OHHA 2Q42A 2HB9A 1QH5A 2BG8B 3LVZA 5K4KA 5FQBA 3IOFA 3FCZA 2QDTA 2GKLA 5ACRA 3VPEA 4U4LA 4RL2A 2VW8A 3WXCA 1M2XA 4C09A 3IE2A 4C1CA 1DD6A 3BC2A 5ACXA 4AX0B 2Y8AA 1KO2A 1ZTCA 2P97A 2BIBA 4AX1B 4UA4A 4XWWA
chains in the Genus database with same CATH superfamily
2I7XA 3H3EA 1DXKA 4RBSA 2DKFA 1A8TA 2BC2A 5LMCA 1XM8A 5ACTA 4RAMA 4TYTA 5AIJA 1WUPA 3VQZA 4ZNBA 3KNRA 3BK2A 3AJ3A 5EV6A 2Q0JA 3IE0A 2BR6A 5HH5A 3AF5A 1BMCA 2CG3A 5ACUA 2BG8A 4V0HA 1VGNA 1E5DA 5EWAA 1JJEA 3X30A 4NQ2A 2ZNBA 4YSLA 5A23A 3ZWFA 1X8IA 5AHOA 4H0DA 4TZBA 4FSBA 3ADRA 3KNSA 2I7TA 4RL0A 3RKJA 3A4YA 1XTOA 2R2DA 3I15A 1ZNBA 1YCHA 5LCFA 2WHGA 4PVTA 4GYUA 5LE1A 1VMEA 5A0VA 2FU8A 5AJLA 2FU6A 5B3RA 3SRXA 4ZEJA 4Z5YA 3MD7A 4C1DA 4DIKA 5LCAA 2YNTB 2ZZIA 4AV7A 2BFZB 1WRAA 3SD9A 2M5DA 3RKKA 3ZR9A 1P9EA 3X2ZA 3IEKA 5AXRA 4WD6A 2E7YA 4EYBA 4JO0A 1KO3A 5EW0A 3RPCA 2CG2A 2BG6A 3I13A 2CFUA 3I0VA 3PY5A 2ZWRA 2XR1A 1WUOA 1JJTA 3SPUA 4UWSB 2YNUA 1YCFA 4UBQA 5EVBA 4LE6A 3BV6A 4C1GA 3QH8A 4Z7RA 3Q6VA 3P2UA 3IEMA 3TP9A 4Z5ZA 5AEBA 2OHJA 4C1HA 5LM6A 5HIPA 4ZO2A 4PVOA 3I14A 5A87A 4D1WA 5B15A 4F6ZA 5HISA 2P1EA 2QEDA 5HIOA 4ZO3A 3X2XA 2YNTA 3DHAA 2P4ZA 2BFZA 1MQOA 5EHTA 4TZ9A 4EXYA 4BP0A 4YSBA 2FM6A 4Z60A 2A7MA 2AZ4A 4HL1A 5AHRA 2BFKA 3T9MA 2Y87A 5ACVA 3FAIA 4TYFA 2FU9A 2GFKA 4AWZA 1SMLA 3ZNBA 2H6AA 5LSCA 3BK1A 2WYLA 2GCUA 2BMIA 3ESHA 2QJSA 3I11A 2NZEA 3SW3A 1QH3A 4XUKA 2UYXA 5A5ZA 1Y44A 3SBLA 2FU7A 2WRSA 4J5HA 4UWPB 5AYAA 2QDSA 4EFZA 1DDKA 5ACSA 2Q9UA 4UWRB 5EVKA 1KR3A 5ACPA 1HLKA 2YNWA 4FEKA 1K07A 4Z6XA 2BTNA 5EV8A 4PDXA 5B1UA 4NURA 1BC2A 2WYMA 3G1PA 4RM5A 4F6HA 3KL7A 2YHEA 5A0TA 1ZKPA 2Y8BA 5ACQA 3IOGA 3L6NA 4BZ3A 4EXSA 4NQ4A 4O98A 4UWOB 4GCWA 4C1FA 2BG2A 2CFZA 2XF4A 5KIKA 4D1UA 4B87A 1YCGA 4GYQA 5HH4A 2AIOA 4D1TA 2BG7A 2BGAA 2BFLA 5FQAA 1BVTA 3DH8A 4EYLA 2QINA 2YCBA 3IE1A 1JT1A 5LLDA 3S0ZA 5HIQA 4FR7A 3R2UA 5HH6A 4DILA 3DHBA 5KILA 5K0WA 4C1EA 4UAMA 1L9YA 4AWYB 3JXPA 2YZ3A 4NQ6A 5IQKA 2NZFA 3SFPA 2NXAA 2YNVA 3PY6A 5K4MA 2FHXA 3ZQ4A 4AD9A 2M5CA 2ZO4A 3PG4A 4J5FA 4TZEA 4D02A 4RAWA 2GMNA 3T3NA 4CHLA 2GFJA 3DHCA 4EY2A 3F9OA 1WW1A 4TZFA 4D1VA 4Z67A 4KEQA 2CBNA 4AXHA 2FK6A 2I7VA 4XWTA 4HKYA 5AXOA 5LCHA 4EYFA 5LS3A 2WYMC 4P62A 3IELA 4YSKA 4HL2A 5FQCA 2DOOA 3T3OA 4KEPA 5EH9A 1X8GA 2OHIA 2Q0IA 1VJNA 3X2YA 3IDZA 4NQ5A 3AF6A 5ACWA 5DPXA 2YNVB 2FHXB 5K4NA 1A7TA 1X8HA 5EVDA 2NYPA 2P18A 2OHHA 2Q42A 2HB9A 1QH5A 2BG8B 3LVZA 5K4KA 5FQBA 3IOFA 3FCZA 2QDTA 2GKLA 5ACRA 3VPEA 4U4LA 4RL2A 2VW8A 3WXCA 1M2XA 4C09A 3IE2A 4C1CA 1DD6A 3BC2A 5ACXA 4AX0B 2Y8AA 1KO2A 1ZTCA 2P97A 2BIBA 4AX1B 4UA4A 4XWWA
chains in the Genus database with same CATH topology
2I7XA 3H3EA 1DXKA 4RBSA 2DKFA 1A8TA 2BC2A 5LMCA 1XM8A 5ACTA 4RAMA 4TYTA 1WUPA 3VQZA 4ZNBA 3KNRA 3BK2A 3AJ3A 5EV6A 2Q0JA 3IE0A 2BR6A 5HH5A 3AF5A 1BMCA 5ACUA 2BG8A 4V0HA 1VGNA 1E5DA 5EWAA 1JJEA 3X30A 4NQ2A 2ZNBA 4YSLA 3ZWFA 1X8IA 5AHOA 4H0DA 4TZBA 4FSBA 3ADRA 3KNSA 2I7TA 4RL0A 3RKJA 3A4YA 1XTOA 2R2DA 3I15A 1ZNBA 1YCHA 5LCFA 2WHGA 4PVTA 4GYUA 5LE1A 1VMEA 5A0VA 2FU8A 2FU6A 5B3RA 3SRXA 4ZEJA 4Z5YA 3MD7A 4C1DA 4DIKA 5LCAA 2YNTB 2ZZIA 2BFZB 1WRAA 3SD9A 2M5DA 3RKKA 3ZR9A 1P9EA 3X2ZA 3IEKA 5AXRA 4WD6A 2E7YA 4EYBA 4JO0A 1KO3A 5EW0A 3RPCA 2BG6A 3I13A 3I0VA 3PY5A 2ZWRA 2XR1A 1WUOA 1JJTA 3SPUA 4UWSB 2YNUA 1YCFA 4UBQA 5EVBA 4LE6A 3BV6A 4C1GA 3QH8A 4Z7RA 3Q6VA 3P2UA 3IEMA 3TP9A 4Z5ZA 5AEBA 2OHJA 4C1HA 5LM6A 5HIPA 4ZO2A 4PVOA 3I14A 5A87A 4D1WA 5B15A 4F6ZA 5HISA 2P1EA 2QEDA 5HIOA 4ZO3A 3X2XA 2YNTA 3DHAA 2P4ZA 2BFZA 1MQOA 5EHTA 4TZ9A 4EXYA 4BP0A 4YSBA 2FM6A 4Z60A 2A7MA 2AZ4A 4HL1A 5AHRA 2BFKA 3T9MA 2Y87A 5ACVA 3FAIA 4TYFA 2FU9A 2GFKA 4AWZA 1SMLA 3ZNBA 2H6AA 5LSCA 3BK1A 2WYLA 2GCUA 2BMIA 3ESHA 2QJSA 3I11A 2NZEA 3SW3A 1QH3A 4XUKA 2UYXA 5A5ZA 1Y44A 3SBLA 2FU7A 2WRSA 4J5HA 4UWPB 5AYAA 2QDSA 4EFZA 1DDKA 5ACSA 2Q9UA 4UWRB 5EVKA 1KR3A 5ACPA 1HLKA 2YNWA 4FEKA 1K07A 4Z6XA 2BTNA 5EV8A 5B1UA 1BC2A 2WYMA 3G1PA 4RM5A 4F6HA 3KL7A 5A0TA 1ZKPA 2Y8BA 5ACQA 3IOGA 3L6NA 4BZ3A 4EXSA 4NQ4A 4O98A 4UWOB 4GCWA 4C1FA 2BG2A 2XF4A 5KIKA 4D1UA 4B87A 1YCGA 4GYQA 5HH4A 2AIOA 4D1TA 2BG7A 2BGAA 2BFLA 5FQAA 1BVTA 3DH8A 4EYLA 2QINA 2YCBA 3IE1A 1JT1A 5LLDA 3S0ZA 5HIQA 4FR7A 3R2UA 5HH6A 4DILA 3DHBA 5KILA 5K0WA 4C1EA 4UAMA 1L9YA 4AWYB 3JXPA 2YZ3A 4NQ6A 5IQKA 2NZFA 3SFPA 2NXAA 2YNVA 3PY6A 5K4MA 2FHXA 3ZQ4A 4AD9A 2M5CA 2ZO4A 3PG4A 4J5FA 4TZEA 4D02A 4RAWA 2GMNA 3T3NA 4CHLA 2GFJA 3DHCA 4EY2A 3F9OA 1WW1A 4TZFA 4D1VA 4Z67A 4KEQA 2CBNA 2FK6A 2I7VA 4XWTA 4HKYA 5AXOA 5LCHA 4EYFA 5LS3A 2WYMC 4P62A 3IELA 4YSKA 4HL2A 5FQCA 2DOOA 3T3OA 4KEPA 5EH9A 1X8GA 2OHIA 2Q0IA 1VJNA 3X2YA 3IDZA 4NQ5A 3AF6A 5ACWA 5DPXA 2YNVB 2FHXB 5K4NA 1A7TA 1X8HA 5EVDA 2NYPA 2P18A 2OHHA 2Q42A 2HB9A 1QH5A 2BG8B 3LVZA 5K4KA 5FQBA 3IOFA 3FCZA 2QDTA 2GKLA 5ACRA 3VPEA 4U4LA 4RL2A 2VW8A 3WXCA 1M2XA 4C09A 3IE2A 4C1CA 1DD6A 3BC2A 5ACXA 4AX0B 2Y8AA 1KO2A 1ZTCA 2P97A 2BIBA 4AX1B 4UA4A 4XWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7X A;  3H3E A;  1DXK A;  4RBS A;  2DKF A;  1A8T A;  2BC2 A;  5LMC A;  1XM8 A;  5ACT A;  4RAM A;  4TYT A;  1WUP A;  3VQZ A;  4ZNB A;  3KNR A;  3BK2 A;  3AJ3 A;  5EV6 A;  2Q0J A;  3IE0 A;  2BR6 A;  5HH5 A;  3AF5 A;  1BMC A;  5ACU A;  2BG8 A;  4V0H A;  1VGN A;  1E5D A;  5EWA A;  1JJE A;  3X30 A;  4NQ2 A;  2ZNB A;  4YSL A;  3ZWF A;  1X8I A;  5AHO A;  4H0D A;  4TZB A;  4FSB A;  3ADR A;  3KNS A;  2I7T A;  4RL0 A;  3RKJ A;  3A4Y A;  1XTO A;  2R2D A;  3I15 A;  1ZNB A;  1YCH A;  5LCF A;  2WHG A;  4PVT A;  4GYU A;  5LE1 A;  1VME A;  5A0V A;  2FU8 A;  2FU6 A;  5B3R A;  3SRX A;  4ZEJ A;  4Z5Y A;  3MD7 A;  4C1D A;  4DIK A;  5LCA A;  2YNT B;  2ZZI A;  2BFZ B;  1WRA A;  3SD9 A;  2M5D A;  3RKK A;  3ZR9 A;  1P9E A;  3X2Z A;  3IEK A;  5AXR A;  4WD6 A;  2E7Y A;  4EYB A;  4JO0 A;  1KO3 A;  5EW0 A;  3RPC A;  2BG6 A;  3I13 A;  3I0V A;  3PY5 A;  2ZWR A;  2XR1 A;  1WUO A;  1JJT A;  3SPU A;  4UWS B;  2YNU A;  1YCF A;  4UBQ A;  5EVB A;  4LE6 A;  3BV6 A;  4C1G A;  3QH8 A;  4Z7R A;  3Q6V A;  3P2U A;  3IEM A;  3TP9 A;  4Z5Z A;  5AEB A;  2OHJ A;  4C1H A;  5LM6 A;  5HIP A;  4ZO2 A;  4PVO A;  3I14 A;  5A87 A;  4D1W A;  5B15 A;  4F6Z A;  5HIS A;  2P1E A;  2QED A;  5HIO A;  4ZO3 A;  3X2X A;  2YNT A;  3DHA A;  2P4Z A;  2BFZ A;  1MQO A;  5EHT A;  4TZ9 A;  4EXY A;  4BP0 A;  4YSB A;  2FM6 A;  4Z60 A;  2A7M A;  2AZ4 A;  4HL1 A;  5AHR A;  2BFK A;  3T9M A;  2Y87 A;  5ACV A;  3FAI A;  4TYF A;  2FU9 A;  2GFK A;  4AWZ A;  1SML A;  3ZNB A;  2H6A A;  5LSC A;  3BK1 A;  2WYL A;  2GCU A;  2BMI A;  3ESH A;  2QJS A;  3I11 A;  2NZE A;  3SW3 A;  1QH3 A;  4XUK A;  2UYX A;  5A5Z A;  1Y44 A;  3SBL A;  2FU7 A;  2WRS A;  4J5H A;  4UWP B;  5AYA A;  2QDS A;  4EFZ A;  1DDK A;  5ACS A;  2Q9U A;  4UWR B;  5EVK A;  1KR3 A;  5ACP A;  1HLK A;  2YNW A;  4FEK A;  1K07 A;  4Z6X A;  2BTN A;  5EV8 A;  5B1U A;  1BC2 A;  2WYM A;  3G1P A;  4RM5 A;  4F6H A;  3KL7 A;  5A0T A;  1ZKP A;  2Y8B A;  5ACQ A;  3IOG A;  3L6N A;  4BZ3 A;  4EXS A;  4NQ4 A;  4O98 A;  4UWO B;  4GCW A;  4C1F A;  2BG2 A;  2XF4 A;  5KIK A;  4D1U A;  4B87 A;  1YCG A;  4GYQ A;  5HH4 A;  2AIO A;  4D1T A;  2BG7 A;  2BGA A;  2BFL A;  5FQA A;  1BVT A;  3DH8 A;  4EYL A;  2QIN A;  2YCB A;  3IE1 A;  1JT1 A;  5LLD A;  3S0Z A;  5HIQ A;  4FR7 A;  3R2U A;  5HH6 A;  4DIL A;  3DHB A;  5KIL A;  5K0W A;  4C1E A;  4UAM A;  1L9Y A;  4AWY B;  3JXP A;  2YZ3 A;  4NQ6 A;  5IQK A;  2NZF A;  3SFP A;  2NXA A;  2YNV A;  3PY6 A;  5K4M A;  2FHX A;  3ZQ4 A;  4AD9 A;  2M5C A;  2ZO4 A;  3PG4 A;  4J5F A;  4TZE A;  4D02 A;  4RAW A;  2GMN A;  3T3N A;  4CHL A;  2GFJ A;  3DHC A;  4EY2 A;  3F9O A;  1WW1 A;  4TZF A;  4D1V A;  4Z67 A;  4KEQ A;  2CBN A;  2FK6 A;  2I7V A;  4XWT A;  4HKY A;  5AXO A;  5LCH A;  4EYF A;  5LS3 A;  2WYM C;  4P62 A;  3IEL A;  4YSK A;  4HL2 A;  5FQC A;  2DOO A;  3T3O A;  4KEP A;  5EH9 A;  1X8G A;  2OHI A;  2Q0I A;  1VJN A;  3X2Y A;  3IDZ A;  4NQ5 A;  3AF6 A;  5ACW A;  5DPX A;  2YNV B;  2FHX B;  5K4N A;  1A7T A;  1X8H A;  5EVD A;  2NYP A;  2P18 A;  2OHH A;  2Q42 A;  2HB9 A;  1QH5 A;  2BG8 B;  3LVZ A;  5K4K A;  5FQB A;  3IOF A;  3FCZ A;  2QDT A;  2GKL A;  5ACR A;  3VPE A;  4U4L A;  4RL2 A;  2VW8 A;  3WXC A;  1M2X A;  4C09 A;  3IE2 A;  4C1C A;  1DD6 A;  3BC2 A;  5ACX A;  4AX0 B;  2Y8A A;  1KO2 A;  1ZTC A;  2P97 A;  2BIB A;  4AX1 B;  4UA4 A;  4XWW A; 
#chains in the Genus database with same CATH topology
 2I7X A;  3H3E A;  1DXK A;  4RBS A;  2DKF A;  1A8T A;  2BC2 A;  5LMC A;  1XM8 A;  5ACT A;  4RAM A;  4TYT A;  5AIJ A;  1WUP A;  3VQZ A;  4ZNB A;  3KNR A;  3BK2 A;  3AJ3 A;  5EV6 A;  2Q0J A;  3IE0 A;  2BR6 A;  5HH5 A;  3AF5 A;  1BMC A;  2CG3 A;  5ACU A;  2BG8 A;  4V0H A;  1VGN A;  1E5D A;  5EWA A;  1JJE A;  3X30 A;  4NQ2 A;  2ZNB A;  4YSL A;  5A23 A;  3ZWF A;  1X8I A;  5AHO A;  4H0D A;  4TZB A;  4FSB A;  3ADR A;  3KNS A;  2I7T A;  4RL0 A;  3RKJ A;  3A4Y A;  1XTO A;  2R2D A;  3I15 A;  1ZNB A;  1YCH A;  5LCF A;  2WHG A;  4PVT A;  4GYU A;  5LE1 A;  1VME A;  5A0V A;  2FU8 A;  5AJL A;  2FU6 A;  5B3R A;  3SRX A;  4ZEJ A;  4Z5Y A;  3MD7 A;  4C1D A;  4DIK A;  5LCA A;  2YNT B;  2ZZI A;  4AV7 A;  2BFZ B;  1WRA A;  3SD9 A;  2M5D A;  3RKK A;  3ZR9 A;  1P9E A;  3X2Z A;  3IEK A;  5AXR A;  4WD6 A;  2E7Y A;  4EYB A;  4JO0 A;  1KO3 A;  5EW0 A;  3RPC A;  2CG2 A;  2BG6 A;  3I13 A;  2CFU A;  3I0V A;  3PY5 A;  2ZWR A;  2XR1 A;  1WUO A;  1JJT A;  3SPU A;  4UWS B;  2YNU A;  1YCF A;  4UBQ A;  5EVB A;  4LE6 A;  3BV6 A;  4C1G A;  3QH8 A;  4Z7R A;  3Q6V A;  3P2U A;  3IEM A;  3TP9 A;  4Z5Z A;  5AEB A;  2OHJ A;  4C1H A;  5LM6 A;  5HIP A;  4ZO2 A;  4PVO A;  3I14 A;  5A87 A;  4D1W A;  5B15 A;  4F6Z A;  5HIS A;  2P1E A;  2QED A;  5HIO A;  4ZO3 A;  3X2X A;  2YNT A;  3DHA A;  2P4Z A;  2BFZ A;  1MQO A;  5EHT A;  4TZ9 A;  4EXY A;  4BP0 A;  4YSB A;  2FM6 A;  4Z60 A;  2A7M A;  2AZ4 A;  4HL1 A;  5AHR A;  2BFK A;  3T9M A;  2Y87 A;  5ACV A;  3FAI A;  4TYF A;  2FU9 A;  2GFK A;  4AWZ A;  1SML A;  3ZNB A;  2H6A A;  5LSC A;  3BK1 A;  2WYL A;  2GCU A;  2BMI A;  3ESH A;  2QJS A;  3I11 A;  2NZE A;  3SW3 A;  1QH3 A;  4XUK A;  2UYX A;  5A5Z A;  1Y44 A;  3SBL A;  2FU7 A;  2WRS A;  4J5H A;  4UWP B;  5AYA A;  2QDS A;  4EFZ A;  1DDK A;  5ACS A;  2Q9U A;  4UWR B;  5EVK A;  1KR3 A;  5ACP A;  1HLK A;  2YNW A;  4FEK A;  1K07 A;  4Z6X A;  2BTN A;  5EV8 A;  4PDX A;  5B1U A;  4NUR A;  1BC2 A;  2WYM A;  3G1P A;  4RM5 A;  4F6H A;  3KL7 A;  2YHE A;  5A0T A;  1ZKP A;  2Y8B A;  5ACQ A;  3IOG A;  3L6N A;  4BZ3 A;  4EXS A;  4NQ4 A;  4O98 A;  4UWO B;  4GCW A;  4C1F A;  2BG2 A;  2CFZ A;  2XF4 A;  5KIK A;  4D1U A;  4B87 A;  1YCG A;  4GYQ A;  5HH4 A;  2AIO A;  4D1T A;  2BG7 A;  2BGA A;  2BFL A;  5FQA A;  1BVT A;  3DH8 A;  4EYL A;  2QIN A;  2YCB A;  3IE1 A;  1JT1 A;  5LLD A;  3S0Z A;  5HIQ A;  4FR7 A;  3R2U A;  5HH6 A;  4DIL A;  3DHB A;  5KIL A;  5K0W A;  4C1E A;  4UAM A;  1L9Y A;  4AWY B;  3JXP A;  2YZ3 A;  4NQ6 A;  5IQK A;  2NZF A;  3SFP A;  2NXA A;  2YNV A;  3PY6 A;  5K4M A;  2FHX A;  3ZQ4 A;  4AD9 A;  2M5C A;  2ZO4 A;  3PG4 A;  4J5F A;  4TZE A;  4D02 A;  4RAW A;  2GMN A;  3T3N A;  4CHL A;  2GFJ A;  3DHC A;  4EY2 A;  3F9O A;  1WW1 A;  4TZF A;  4D1V A;  4Z67 A;  4KEQ A;  2CBN A;  4AXH A;  2FK6 A;  2I7V A;  4XWT A;  4HKY A;  5AXO A;  5LCH A;  4EYF A;  5LS3 A;  2WYM C;  4P62 A;  3IEL A;  4YSK A;  4HL2 A;  5FQC A;  2DOO A;  3T3O A;  4KEP A;  5EH9 A;  1X8G A;  2OHI A;  2Q0I A;  1VJN A;  3X2Y A;  3IDZ A;  4NQ5 A;  3AF6 A;  5ACW A;  5DPX A;  2YNV B;  2FHX B;  5K4N A;  1A7T A;  1X8H A;  5EVD A;  2NYP A;  2P18 A;  2OHH A;  2Q42 A;  2HB9 A;  1QH5 A;  2BG8 B;  3LVZ A;  5K4K A;  5FQB A;  3IOF A;  3FCZ A;  2QDT A;  2GKL A;  5ACR A;  3VPE A;  4U4L A;  4RL2 A;  2VW8 A;  3WXC A;  1M2X A;  4C09 A;  3IE2 A;  4C1C A;  1DD6 A;  3BC2 A;  5ACX A;  4AX0 B;  2Y8A A;  1KO2 A;  1ZTC A;  2P97 A;  2BIB A;  4AX1 B;  4UA4 A;  4XWW A; 
#chains in the Genus database with same CATH homology
 2I7X A;  3H3E A;  1DXK A;  4RBS A;  2DKF A;  1A8T A;  2BC2 A;  5LMC A;  1XM8 A;  5ACT A;  4RAM A;  4TYT A;  1WUP A;  3VQZ A;  4ZNB A;  3KNR A;  3BK2 A;  3AJ3 A;  5EV6 A;  2Q0J A;  3IE0 A;  2BR6 A;  5HH5 A;  3AF5 A;  1BMC A;  5ACU A;  2BG8 A;  4V0H A;  1VGN A;  1E5D A;  5EWA A;  1JJE A;  3X30 A;  4NQ2 A;  2ZNB A;  4YSL A;  3ZWF A;  1X8I A;  5AHO A;  4H0D A;  4TZB A;  4FSB A;  3ADR A;  3KNS A;  2I7T A;  4RL0 A;  3RKJ A;  3A4Y A;  1XTO A;  2R2D A;  3I15 A;  1ZNB A;  1YCH A;  5LCF A;  2WHG A;  4PVT A;  4GYU A;  5LE1 A;  1VME A;  5A0V A;  2FU8 A;  2FU6 A;  5B3R A;  3SRX A;  4ZEJ A;  4Z5Y A;  3MD7 A;  4C1D A;  4DIK A;  5LCA A;  2YNT B;  2ZZI A;  2BFZ B;  1WRA A;  3SD9 A;  2M5D A;  3RKK A;  3ZR9 A;  1P9E A;  3X2Z A;  3IEK A;  5AXR A;  4WD6 A;  2E7Y A;  4EYB A;  4JO0 A;  1KO3 A;  5EW0 A;  3RPC A;  2BG6 A;  3I13 A;  3I0V A;  3PY5 A;  2ZWR A;  2XR1 A;  1WUO A;  1JJT A;  3SPU A;  4UWS B;  2YNU A;  1YCF A;  4UBQ A;  5EVB A;  4LE6 A;  3BV6 A;  4C1G A;  3QH8 A;  4Z7R A;  3Q6V A;  3P2U A;  3IEM A;  3TP9 A;  4Z5Z A;  5AEB A;  2OHJ A;  4C1H A;  5LM6 A;  5HIP A;  4ZO2 A;  4PVO A;  3I14 A;  5A87 A;  4D1W A;  5B15 A;  4F6Z A;  5HIS A;  2P1E A;  2QED A;  5HIO A;  4ZO3 A;  3X2X A;  2YNT A;  3DHA A;  2P4Z A;  2BFZ A;  1MQO A;  5EHT A;  4TZ9 A;  4EXY A;  4BP0 A;  4YSB A;  2FM6 A;  4Z60 A;  2A7M A;  2AZ4 A;  4HL1 A;  5AHR A;  2BFK A;  3T9M A;  2Y87 A;  5ACV A;  3FAI A;  4TYF A;  2FU9 A;  2GFK A;  4AWZ A;  1SML A;  3ZNB A;  2H6A A;  5LSC A;  3BK1 A;  2WYL A;  2GCU A;  2BMI A;  3ESH A;  2QJS A;  3I11 A;  2NZE A;  3SW3 A;  1QH3 A;  4XUK A;  2UYX A;  5A5Z A;  1Y44 A;  3SBL A;  2FU7 A;  2WRS A;  4J5H A;  4UWP B;  5AYA A;  2QDS A;  4EFZ A;  1DDK A;  5ACS A;  2Q9U A;  4UWR B;  5EVK A;  1KR3 A;  5ACP A;  1HLK A;  2YNW A;  4FEK A;  1K07 A;  4Z6X A;  2BTN A;  5EV8 A;  5B1U A;  1BC2 A;  2WYM A;  3G1P A;  4RM5 A;  4F6H A;  3KL7 A;  5A0T A;  1ZKP A;  2Y8B A;  5ACQ A;  3IOG A;  3L6N A;  4BZ3 A;  4EXS A;  4NQ4 A;  4O98 A;  4UWO B;  4GCW A;  4C1F A;  2BG2 A;  2XF4 A;  5KIK A;  4D1U A;  4B87 A;  1YCG A;  4GYQ A;  5HH4 A;  2AIO A;  4D1T A;  2BG7 A;  2BGA A;  2BFL A;  5FQA A;  1BVT A;  3DH8 A;  4EYL A;  2QIN A;  2YCB A;  3IE1 A;  1JT1 A;  5LLD A;  3S0Z A;  5HIQ A;  4FR7 A;  3R2U A;  5HH6 A;  4DIL A;  3DHB A;  5KIL A;  5K0W A;  4C1E A;  4UAM A;  1L9Y A;  4AWY B;  3JXP A;  2YZ3 A;  4NQ6 A;  5IQK A;  2NZF A;  3SFP A;  2NXA A;  2YNV A;  3PY6 A;  5K4M A;  2FHX A;  3ZQ4 A;  4AD9 A;  2M5C A;  2ZO4 A;  3PG4 A;  4J5F A;  4TZE A;  4D02 A;  4RAW A;  2GMN A;  3T3N A;  4CHL A;  2GFJ A;  3DHC A;  4EY2 A;  3F9O A;  1WW1 A;  4TZF A;  4D1V A;  4Z67 A;  4KEQ A;  2CBN A;  2FK6 A;  2I7V A;  4XWT A;  4HKY A;  5AXO A;  5LCH A;  4EYF A;  5LS3 A;  2WYM C;  4P62 A;  3IEL A;  4YSK A;  4HL2 A;  5FQC A;  2DOO A;  3T3O A;  4KEP A;  5EH9 A;  1X8G A;  2OHI A;  2Q0I A;  1VJN A;  3X2Y A;  3IDZ A;  4NQ5 A;  3AF6 A;  5ACW A;  5DPX A;  2YNV B;  2FHX B;  5K4N A;  1A7T A;  1X8H A;  5EVD A;  2NYP A;  2P18 A;  2OHH A;  2Q42 A;  2HB9 A;  1QH5 A;  2BG8 B;  3LVZ A;  5K4K A;  5FQB A;  3IOF A;  3FCZ A;  2QDT A;  2GKL A;  5ACR A;  3VPE A;  4U4L A;  4RL2 A;  2VW8 A;  3WXC A;  1M2X A;  4C09 A;  3IE2 A;  4C1C A;  1DD6 A;  3BC2 A;  5ACX A;  4AX0 B;  2Y8A A;  1KO2 A;  1ZTC A;  2P97 A;  2BIB A;  4AX1 B;  4UA4 A;  4XWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...