5K0WA

Crystal structure of the metallo-beta-lactamase gob-18 from elizabethkingia meningoseptica
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
270
structure length
270
Chain Sequence
SAQVVKEPENMPKEWNQAYEPFRIAGNLYYVGTYDLASYLIVTDKGNILINTGTAESFPIIKANIQKLGFNYKDIKILLLTQAHYDHTGALQDFKTETAAKFYVDKADVDVLRTGGKSDYEMGKYGVTFKPVTPDKTLKDQDKIKLGNITLTLLHHPGHTKGSCSFIFETKDEKRKYRVLIANMPSVIVDKKFSEVTAYPNIQSDYAYTFGVMKKLDFDIWVASHASQFDLHEKRKEGDPYNPQLFMDKQSYFQNLNDLEKSYLNKIKKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Class B carbapenemase GOB-18
publication title Crystal Structure of the Metallo-beta-Lactamase GOB in the Periplasmic Dizinc Form Reveals an Unusual Metal Site.
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
total genus 96
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 5k0wA00
3Q6VA 1A7TA 3BC2A 5AXRA 2FU9A 2WRSA 1L9YA 1SMLA 2NZFA 3ZR9A 5LSCA 1YCGA 2Y87A 5HISA 1KO2A 1BMCA 4C1GA 4RL2A 4EYLA 5HIPA 5K4MA 3ZWFA 4Z67A 4BZ3A 3I11A 4EYBA 1X8GA 4KEPA 1WUPA 5ACRA 3RPCA 1BVTA 5LE1A 4EXSA 3IELA 2OHIA 1DXKA 2M5DA 1KO3A 5K4KA 1K07A 3SRXA 5AHRA 2ZO4A 2BFZA 2YNUA 3IE1A 5A0VA 2YNTA 4FR7A 4FEKA 2YCBA 4EXYA 2ZWRA 4TZ9A 2E7YA 4GCWA 3PY6A 4XWWA 5AHOA 4TYTA 3RKKA 3X2YA 4UWRB 4ZO2A 1X8IA 4D1UA 3WXCA 2NYPA 3IEKA 5ACXA 4TYFA 1DDKA 3AF5A 4C1EA 2GKLA 4D1WA 2P18A 2VW8A 4RAWA 3IE2A 2BFZB 1MQOA 5EWAA 4GYQA 2M5CA 2YNTB 1WRAA 4NQ5A 5ACSA 2CBNA 5IQKA 5LM6A 4B87A 4F6ZA 1VGNA 3DH8A 4AX1B 3IOGA 2DOOA 2BTNA 4DIKA 5LCHA 3S0ZA 1XM8A 4WD6A 5HIOA 3SFPA 3VPEA 5ACVA 1HLKA 3MD7A 1DD6A 2FU8A 4C09A 5B1UA 2BFLA 1YCFA 2NZEA 2NXAA 2YNVB 4ZNBA 2YZ3A 3DHCA 5KILA 5LCFA 4AD9A 3BV6A 3FAIA 5HH5A 1P9EA 2OHJA 4AWZA 3SBLA 5A5ZA 1VJNA 2BR6A 3SPUA 4UWPB 3ZNBA 2XF4A 5LCAA 4RAMA 3FCZA 5ACWA 1VMEA 3JXPA 1XTOA 2QDSA 4D02A 2XR1A 3RKJA 2P4ZA 3IEMA 3X2ZA 3BK2A 4DILA 5A87A 5EH9A 5FQBA 1BC2A 3IOFA 3PG4A 1JT1A 2BG8B 1ZNBA 4F6HA 2FHXB 2UYXA 4JO0A 4U4LA 5LMCA 1JJEA 3LVZA 2Q0IA 2Q42A 4BP0A 5HH4A 5ACUA 3BK1A 5LLDA 4TZBA 2FK6A 2QJSA 2YNVA 4RM5A 3R2UA 4YSBA 5EW0A 3I14A 4PVTA 1Y44A 5K0WA 2BG6A 3SW3A 4C1DA 5HH6A 4AWYB 1JJTA 3G1PA 1QH3A 2GFJA 2HB9A 1KR3A 2WYMA 5AEBA 4D1TA 4RL0A 2YNWA 4C1CA 4EYFA 4Z7RA 3F9OA 3T9MA 3KNRA 2Q0JA 2I7VA 2QDTA 2WYLA 4UWOB 3I0VA 4PVOA 5ACQA 2BG2A 2WYMC 1A8TA 5ACPA 3TP9A 4V0HA 3H3EA 3ADRA 2GCUA 3L6NA 4AX0B 1M2XA 3DHAA 2A7MA 2BG8A 5LS3A 3KNSA 5DPXA 2FHXA 4UBQA 2FU7A 2DKFA 1QH5A 2BIBA 3ESHA 4RBSA 5FQAA 2AZ4A 5EV6A 3T3OA 4Z60A 4P62A 3I15A 2BGAA 2FM6A 3VQZA 3I13A 3IDZA 3X30A 4HKYA 3DHBA 4ZEJA 2I7XA 4NQ4A 2GFKA 2Y8BA 2FU6A 3QH8A 2I7TA 2ZZIA 5EVKA 3IE0A 4UWSB 4GYUA 3KL7A 4Z6XA 2Q9UA 3P2UA 5B3RA 4H0DA 4EFZA 4Z5ZA 5A0TA 5EHTA 2P97A 1YCHA 4HL1A 3PY5A 1ZTCA 4O98A 4UAMA 5ACTA 5AXOA 5B15A 3X2XA 3SD9A 4YSLA 2WHGA 2QEDA 5KIKA 4CHLA 1ZKPA 2OHHA 5HIQA 4D1VA 5EV8A 4XWTA 4UA4A 2BFKA 4J5HA 1WW1A 3T3NA 4YSKA 3A4YA 4Z5YA 5FQCA 3AJ3A 2R2DA 5EVBA 2Y8AA 2QINA 4EY2A 2BG7A 4FSBA 1E5DA 5K4NA 3AF6A 5AYAA 4NQ2A 4C1HA 4J5FA 3ZQ4A 4TZEA 2H6AA 1X8HA 2BC2A 5EVDA 1WUOA 2P1EA 2GMNA 2ZNBA 2AIOA 4XUKA 4KEQA 4NQ6A 4HL2A 4ZO3A 4C1FA 4LE6A 4TZFA 2BMIA
chains in the Genus database with same CATH superfamily
3Q6VA 1A7TA 3BC2A 5AXRA 2FU9A 2WRSA 1L9YA 1SMLA 2NZFA 3ZR9A 5LSCA 1YCGA 2Y87A 4NURA 5HISA 1KO2A 1BMCA 4C1GA 4RL2A 4EYLA 5HIPA 5K4MA 3ZWFA 4Z67A 4BZ3A 3I11A 4EYBA 1X8GA 4KEPA 1WUPA 5ACRA 3RPCA 1BVTA 5LE1A 4EXSA 3IELA 2OHIA 1DXKA 2M5DA 1KO3A 5K4KA 1K07A 3SRXA 5AHRA 2ZO4A 2BFZA 2YNUA 3IE1A 5A0VA 2YNTA 4FR7A 4FEKA 2YCBA 4EXYA 2ZWRA 4TZ9A 2E7YA 4GCWA 3PY6A 4XWWA 5AHOA 4TYTA 2CG3A 3RKKA 3X2YA 4UWRB 4ZO2A 1X8IA 4D1UA 3WXCA 2NYPA 3IEKA 5ACXA 4TYFA 1DDKA 3AF5A 4C1EA 2GKLA 4D1WA 2P18A 2VW8A 4RAWA 3IE2A 4PDXA 2BFZB 1MQOA 5EWAA 4GYQA 2M5CA 2YNTB 1WRAA 4NQ5A 5ACSA 2CBNA 5IQKA 5LM6A 4B87A 4F6ZA 1VGNA 3DH8A 4AX1B 3IOGA 2DOOA 2BTNA 2CFZA 4DIKA 5LCHA 3S0ZA 1XM8A 4WD6A 5HIOA 3SFPA 3VPEA 5ACVA 1HLKA 3MD7A 1DD6A 2FU8A 4C09A 5B1UA 2BFLA 1YCFA 2NZEA 2NXAA 2YNVB 4ZNBA 2YZ3A 3DHCA 5KILA 5LCFA 4AD9A 3BV6A 3FAIA 5HH5A 1P9EA 2OHJA 4AWZA 4AV7A 3SBLA 5A5ZA 1VJNA 2BR6A 3SPUA 4UWPB 3ZNBA 2XF4A 5LCAA 4RAMA 3FCZA 5ACWA 1VMEA 3JXPA 1XTOA 2QDSA 4D02A 2XR1A 3RKJA 2P4ZA 3IEMA 3X2ZA 3BK2A 4DILA 5A87A 5EH9A 5FQBA 1BC2A 3IOFA 3PG4A 1JT1A 2BG8B 1ZNBA 4F6HA 2FHXB 2UYXA 4JO0A 4U4LA 5LMCA 1JJEA 3LVZA 2Q0IA 5A23A 2Q42A 4BP0A 5HH4A 5ACUA 3BK1A 5LLDA 4TZBA 2FK6A 2QJSA 2YNVA 4RM5A 3R2UA 4YSBA 5EW0A 3I14A 4PVTA 1Y44A 5K0WA 2BG6A 3SW3A 4C1DA 5HH6A 4AWYB 1JJTA 3G1PA 1QH3A 2GFJA 2HB9A 1KR3A 2WYMA 5AEBA 4D1TA 4RL0A 2YNWA 4C1CA 4EYFA 4Z7RA 3F9OA 3T9MA 3KNRA 2Q0JA 2I7VA 2QDTA 2WYLA 4UWOB 3I0VA 4PVOA 5ACQA 2BG2A 2WYMC 1A8TA 5ACPA 3TP9A 4V0HA 3H3EA 5AIJA 3ADRA 2GCUA 3L6NA 4AX0B 5AJLA 1M2XA 3DHAA 2A7MA 2BG8A 5LS3A 3KNSA 5DPXA 2FHXA 4UBQA 2FU7A 2DKFA 1QH5A 2BIBA 3ESHA 4RBSA 5FQAA 2AZ4A 5EV6A 3T3OA 4Z60A 4P62A 3I15A 2BGAA 2FM6A 3VQZA 3I13A 3IDZA 3X30A 4HKYA 3DHBA 4ZEJA 2I7XA 4NQ4A 2GFKA 2Y8BA 2FU6A 3QH8A 2I7TA 2ZZIA 5EVKA 3IE0A 4UWSB 4GYUA 2CFUA 3KL7A 4Z6XA 2Q9UA 3P2UA 5B3RA 4H0DA 4EFZA 4Z5ZA 5A0TA 5EHTA 2P97A 1YCHA 4HL1A 3PY5A 1ZTCA 4O98A 4UAMA 5ACTA 5AXOA 2CG2A 5B15A 3X2XA 3SD9A 4YSLA 2WHGA 2QEDA 5KIKA 4CHLA 1ZKPA 2OHHA 5HIQA 4D1VA 5EV8A 4XWTA 4UA4A 2BFKA 4J5HA 1WW1A 3T3NA 4YSKA 3A4YA 4Z5YA 5FQCA 3AJ3A 2R2DA 5EVBA 2Y8AA 2QINA 4EY2A 2BG7A 4FSBA 1E5DA 5K4NA 3AF6A 5AYAA 4NQ2A 4C1HA 4J5FA 3ZQ4A 4TZEA 2H6AA 1X8HA 2BC2A 5EVDA 1WUOA 2P1EA 2GMNA 2ZNBA 2AIOA 4XUKA 4KEQA 2YHEA 4NQ6A 4AXHA 4HL2A 4ZO3A 4C1FA 4LE6A 4TZFA 2BMIA
chains in the Genus database with same CATH topology
3Q6VA 1A7TA 3BC2A 5AXRA 2FU9A 2WRSA 1L9YA 1SMLA 2NZFA 3ZR9A 5LSCA 1YCGA 2Y87A 5HISA 1KO2A 1BMCA 4C1GA 4RL2A 4EYLA 5HIPA 5K4MA 3ZWFA 4Z67A 4BZ3A 3I11A 4EYBA 1X8GA 4KEPA 1WUPA 5ACRA 3RPCA 1BVTA 5LE1A 4EXSA 3IELA 2OHIA 1DXKA 2M5DA 1KO3A 5K4KA 1K07A 3SRXA 5AHRA 2ZO4A 2BFZA 2YNUA 3IE1A 5A0VA 2YNTA 4FR7A 4FEKA 2YCBA 4EXYA 2ZWRA 4TZ9A 2E7YA 4GCWA 3PY6A 4XWWA 5AHOA 4TYTA 3RKKA 3X2YA 4UWRB 4ZO2A 1X8IA 4D1UA 3WXCA 2NYPA 3IEKA 5ACXA 4TYFA 1DDKA 3AF5A 4C1EA 2GKLA 4D1WA 2P18A 2VW8A 4RAWA 3IE2A 2BFZB 1MQOA 5EWAA 4GYQA 2M5CA 2YNTB 1WRAA 4NQ5A 5ACSA 2CBNA 5IQKA 5LM6A 4B87A 4F6ZA 1VGNA 3DH8A 4AX1B 3IOGA 2DOOA 2BTNA 4DIKA 5LCHA 3S0ZA 1XM8A 4WD6A 5HIOA 3SFPA 3VPEA 5ACVA 1HLKA 3MD7A 1DD6A 2FU8A 4C09A 5B1UA 2BFLA 1YCFA 2NZEA 2NXAA 2YNVB 4ZNBA 2YZ3A 3DHCA 5KILA 5LCFA 4AD9A 3BV6A 3FAIA 5HH5A 1P9EA 2OHJA 4AWZA 3SBLA 5A5ZA 1VJNA 2BR6A 3SPUA 4UWPB 3ZNBA 2XF4A 5LCAA 4RAMA 3FCZA 5ACWA 1VMEA 3JXPA 1XTOA 2QDSA 4D02A 2XR1A 3RKJA 2P4ZA 3IEMA 3X2ZA 3BK2A 4DILA 5A87A 5EH9A 5FQBA 1BC2A 3IOFA 3PG4A 1JT1A 2BG8B 1ZNBA 4F6HA 2FHXB 2UYXA 4JO0A 4U4LA 5LMCA 1JJEA 3LVZA 2Q0IA 2Q42A 4BP0A 5HH4A 5ACUA 3BK1A 5LLDA 4TZBA 2FK6A 2QJSA 2YNVA 4RM5A 3R2UA 4YSBA 5EW0A 3I14A 4PVTA 1Y44A 5K0WA 2BG6A 3SW3A 4C1DA 5HH6A 4AWYB 1JJTA 3G1PA 1QH3A 2GFJA 2HB9A 1KR3A 2WYMA 5AEBA 4D1TA 4RL0A 2YNWA 4C1CA 4EYFA 4Z7RA 3F9OA 3T9MA 3KNRA 2Q0JA 2I7VA 2QDTA 2WYLA 4UWOB 3I0VA 4PVOA 5ACQA 2BG2A 2WYMC 1A8TA 5ACPA 3TP9A 4V0HA 3H3EA 3ADRA 2GCUA 3L6NA 4AX0B 1M2XA 3DHAA 2A7MA 2BG8A 5LS3A 3KNSA 5DPXA 2FHXA 4UBQA 2FU7A 2DKFA 1QH5A 2BIBA 3ESHA 4RBSA 5FQAA 2AZ4A 5EV6A 3T3OA 4Z60A 4P62A 3I15A 2BGAA 2FM6A 3VQZA 3I13A 3IDZA 3X30A 4HKYA 3DHBA 4ZEJA 2I7XA 4NQ4A 2GFKA 2Y8BA 2FU6A 3QH8A 2I7TA 2ZZIA 5EVKA 3IE0A 4UWSB 4GYUA 3KL7A 4Z6XA 2Q9UA 3P2UA 5B3RA 4H0DA 4EFZA 4Z5ZA 5A0TA 5EHTA 2P97A 1YCHA 4HL1A 3PY5A 1ZTCA 4O98A 4UAMA 5ACTA 5AXOA 5B15A 3X2XA 3SD9A 4YSLA 2WHGA 2QEDA 5KIKA 4CHLA 1ZKPA 2OHHA 5HIQA 4D1VA 5EV8A 4XWTA 4UA4A 2BFKA 4J5HA 1WW1A 3T3NA 4YSKA 3A4YA 4Z5YA 5FQCA 3AJ3A 2R2DA 5EVBA 2Y8AA 2QINA 4EY2A 2BG7A 4FSBA 1E5DA 5K4NA 3AF6A 5AYAA 4NQ2A 4C1HA 4J5FA 3ZQ4A 4TZEA 2H6AA 1X8HA 2BC2A 5EVDA 1WUOA 2P1EA 2GMNA 2ZNBA 2AIOA 4XUKA 4KEQA 4NQ6A 4HL2A 4ZO3A 4C1FA 4LE6A 4TZFA 2BMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6V A;  1A7T A;  3BC2 A;  5AXR A;  2FU9 A;  2WRS A;  1L9Y A;  1SML A;  2NZF A;  3ZR9 A;  5LSC A;  1YCG A;  2Y87 A;  5HIS A;  1KO2 A;  1BMC A;  4C1G A;  4RL2 A;  4EYL A;  5HIP A;  5K4M A;  3ZWF A;  4Z67 A;  4BZ3 A;  3I11 A;  4EYB A;  1X8G A;  4KEP A;  1WUP A;  5ACR A;  3RPC A;  1BVT A;  5LE1 A;  4EXS A;  3IEL A;  2OHI A;  1DXK A;  2M5D A;  1KO3 A;  5K4K A;  1K07 A;  3SRX A;  5AHR A;  2ZO4 A;  2BFZ A;  2YNU A;  3IE1 A;  5A0V A;  2YNT A;  4FR7 A;  4FEK A;  2YCB A;  4EXY A;  2ZWR A;  4TZ9 A;  2E7Y A;  4GCW A;  3PY6 A;  4XWW A;  5AHO A;  4TYT A;  3RKK A;  3X2Y A;  4UWR B;  4ZO2 A;  1X8I A;  4D1U A;  3WXC A;  2NYP A;  3IEK A;  5ACX A;  4TYF A;  1DDK A;  3AF5 A;  4C1E A;  2GKL A;  4D1W A;  2P18 A;  2VW8 A;  4RAW A;  3IE2 A;  2BFZ B;  1MQO A;  5EWA A;  4GYQ A;  2M5C A;  2YNT B;  1WRA A;  4NQ5 A;  5ACS A;  2CBN A;  5IQK A;  5LM6 A;  4B87 A;  4F6Z A;  1VGN A;  3DH8 A;  4AX1 B;  3IOG A;  2DOO A;  2BTN A;  4DIK A;  5LCH A;  3S0Z A;  1XM8 A;  4WD6 A;  5HIO A;  3SFP A;  3VPE A;  5ACV A;  1HLK A;  3MD7 A;  1DD6 A;  2FU8 A;  4C09 A;  5B1U A;  2BFL A;  1YCF A;  2NZE A;  2NXA A;  2YNV B;  4ZNB A;  2YZ3 A;  3DHC A;  5KIL A;  5LCF A;  4AD9 A;  3BV6 A;  3FAI A;  5HH5 A;  1P9E A;  2OHJ A;  4AWZ A;  3SBL A;  5A5Z A;  1VJN A;  2BR6 A;  3SPU A;  4UWP B;  3ZNB A;  2XF4 A;  5LCA A;  4RAM A;  3FCZ A;  5ACW A;  1VME A;  3JXP A;  1XTO A;  2QDS A;  4D02 A;  2XR1 A;  3RKJ A;  2P4Z A;  3IEM A;  3X2Z A;  3BK2 A;  4DIL A;  5A87 A;  5EH9 A;  5FQB A;  1BC2 A;  3IOF A;  3PG4 A;  1JT1 A;  2BG8 B;  1ZNB A;  4F6H A;  2FHX B;  2UYX A;  4JO0 A;  4U4L A;  5LMC A;  1JJE A;  3LVZ A;  2Q0I A;  2Q42 A;  4BP0 A;  5HH4 A;  5ACU A;  3BK1 A;  5LLD A;  4TZB A;  2FK6 A;  2QJS A;  2YNV A;  4RM5 A;  3R2U A;  4YSB A;  5EW0 A;  3I14 A;  4PVT A;  1Y44 A;  5K0W A;  2BG6 A;  3SW3 A;  4C1D A;  5HH6 A;  4AWY B;  1JJT A;  3G1P A;  1QH3 A;  2GFJ A;  2HB9 A;  1KR3 A;  2WYM A;  5AEB A;  4D1T A;  4RL0 A;  2YNW A;  4C1C A;  4EYF A;  4Z7R A;  3F9O A;  3T9M A;  3KNR A;  2Q0J A;  2I7V A;  2QDT A;  2WYL A;  4UWO B;  3I0V A;  4PVO A;  5ACQ A;  2BG2 A;  2WYM C;  1A8T A;  5ACP A;  3TP9 A;  4V0H A;  3H3E A;  3ADR A;  2GCU A;  3L6N A;  4AX0 B;  1M2X A;  3DHA A;  2A7M A;  2BG8 A;  5LS3 A;  3KNS A;  5DPX A;  2FHX A;  4UBQ A;  2FU7 A;  2DKF A;  1QH5 A;  2BIB A;  3ESH A;  4RBS A;  5FQA A;  2AZ4 A;  5EV6 A;  3T3O A;  4Z60 A;  4P62 A;  3I15 A;  2BGA A;  2FM6 A;  3VQZ A;  3I13 A;  3IDZ A;  3X30 A;  4HKY A;  3DHB A;  4ZEJ A;  2I7X A;  4NQ4 A;  2GFK A;  2Y8B A;  2FU6 A;  3QH8 A;  2I7T A;  2ZZI A;  5EVK A;  3IE0 A;  4UWS B;  4GYU A;  3KL7 A;  4Z6X A;  2Q9U A;  3P2U A;  5B3R A;  4H0D A;  4EFZ A;  4Z5Z A;  5A0T A;  5EHT A;  2P97 A;  1YCH A;  4HL1 A;  3PY5 A;  1ZTC A;  4O98 A;  4UAM A;  5ACT A;  5AXO A;  5B15 A;  3X2X A;  3SD9 A;  4YSL A;  2WHG A;  2QED A;  5KIK A;  4CHL A;  1ZKP A;  2OHH A;  5HIQ A;  4D1V A;  5EV8 A;  4XWT A;  4UA4 A;  2BFK A;  4J5H A;  1WW1 A;  3T3N A;  4YSK A;  3A4Y A;  4Z5Y A;  5FQC A;  3AJ3 A;  2R2D A;  5EVB A;  2Y8A A;  2QIN A;  4EY2 A;  2BG7 A;  4FSB A;  1E5D A;  5K4N A;  3AF6 A;  5AYA A;  4NQ2 A;  4C1H A;  4J5F A;  3ZQ4 A;  4TZE A;  2H6A A;  1X8H A;  2BC2 A;  5EVD A;  1WUO A;  2P1E A;  2GMN A;  2ZNB A;  2AIO A;  4XUK A;  4KEQ A;  4NQ6 A;  4HL2 A;  4ZO3 A;  4C1F A;  4LE6 A;  4TZF A;  2BMI A; 
#chains in the Genus database with same CATH topology
 3Q6V A;  1A7T A;  3BC2 A;  5AXR A;  2FU9 A;  2WRS A;  1L9Y A;  1SML A;  2NZF A;  3ZR9 A;  5LSC A;  1YCG A;  2Y87 A;  4NUR A;  5HIS A;  1KO2 A;  1BMC A;  4C1G A;  4RL2 A;  4EYL A;  5HIP A;  5K4M A;  3ZWF A;  4Z67 A;  4BZ3 A;  3I11 A;  4EYB A;  1X8G A;  4KEP A;  1WUP A;  5ACR A;  3RPC A;  1BVT A;  5LE1 A;  4EXS A;  3IEL A;  2OHI A;  1DXK A;  2M5D A;  1KO3 A;  5K4K A;  1K07 A;  3SRX A;  5AHR A;  2ZO4 A;  2BFZ A;  2YNU A;  3IE1 A;  5A0V A;  2YNT A;  4FR7 A;  4FEK A;  2YCB A;  4EXY A;  2ZWR A;  4TZ9 A;  2E7Y A;  4GCW A;  3PY6 A;  4XWW A;  5AHO A;  4TYT A;  2CG3 A;  3RKK A;  3X2Y A;  4UWR B;  4ZO2 A;  1X8I A;  4D1U A;  3WXC A;  2NYP A;  3IEK A;  5ACX A;  4TYF A;  1DDK A;  3AF5 A;  4C1E A;  2GKL A;  4D1W A;  2P18 A;  2VW8 A;  4RAW A;  3IE2 A;  4PDX A;  2BFZ B;  1MQO A;  5EWA A;  4GYQ A;  2M5C A;  2YNT B;  1WRA A;  4NQ5 A;  5ACS A;  2CBN A;  5IQK A;  5LM6 A;  4B87 A;  4F6Z A;  1VGN A;  3DH8 A;  4AX1 B;  3IOG A;  2DOO A;  2BTN A;  2CFZ A;  4DIK A;  5LCH A;  3S0Z A;  1XM8 A;  4WD6 A;  5HIO A;  3SFP A;  3VPE A;  5ACV A;  1HLK A;  3MD7 A;  1DD6 A;  2FU8 A;  4C09 A;  5B1U A;  2BFL A;  1YCF A;  2NZE A;  2NXA A;  2YNV B;  4ZNB A;  2YZ3 A;  3DHC A;  5KIL A;  5LCF A;  4AD9 A;  3BV6 A;  3FAI A;  5HH5 A;  1P9E A;  2OHJ A;  4AWZ A;  4AV7 A;  3SBL A;  5A5Z A;  1VJN A;  2BR6 A;  3SPU A;  4UWP B;  3ZNB A;  2XF4 A;  5LCA A;  4RAM A;  3FCZ A;  5ACW A;  1VME A;  3JXP A;  1XTO A;  2QDS A;  4D02 A;  2XR1 A;  3RKJ A;  2P4Z A;  3IEM A;  3X2Z A;  3BK2 A;  4DIL A;  5A87 A;  5EH9 A;  5FQB A;  1BC2 A;  3IOF A;  3PG4 A;  1JT1 A;  2BG8 B;  1ZNB A;  4F6H A;  2FHX B;  2UYX A;  4JO0 A;  4U4L A;  5LMC A;  1JJE A;  3LVZ A;  2Q0I A;  5A23 A;  2Q42 A;  4BP0 A;  5HH4 A;  5ACU A;  3BK1 A;  5LLD A;  4TZB A;  2FK6 A;  2QJS A;  2YNV A;  4RM5 A;  3R2U A;  4YSB A;  5EW0 A;  3I14 A;  4PVT A;  1Y44 A;  5K0W A;  2BG6 A;  3SW3 A;  4C1D A;  5HH6 A;  4AWY B;  1JJT A;  3G1P A;  1QH3 A;  2GFJ A;  2HB9 A;  1KR3 A;  2WYM A;  5AEB A;  4D1T A;  4RL0 A;  2YNW A;  4C1C A;  4EYF A;  4Z7R A;  3F9O A;  3T9M A;  3KNR A;  2Q0J A;  2I7V A;  2QDT A;  2WYL A;  4UWO B;  3I0V A;  4PVO A;  5ACQ A;  2BG2 A;  2WYM C;  1A8T A;  5ACP A;  3TP9 A;  4V0H A;  3H3E A;  5AIJ A;  3ADR A;  2GCU A;  3L6N A;  4AX0 B;  5AJL A;  1M2X A;  3DHA A;  2A7M A;  2BG8 A;  5LS3 A;  3KNS A;  5DPX A;  2FHX A;  4UBQ A;  2FU7 A;  2DKF A;  1QH5 A;  2BIB A;  3ESH A;  4RBS A;  5FQA A;  2AZ4 A;  5EV6 A;  3T3O A;  4Z60 A;  4P62 A;  3I15 A;  2BGA A;  2FM6 A;  3VQZ A;  3I13 A;  3IDZ A;  3X30 A;  4HKY A;  3DHB A;  4ZEJ A;  2I7X A;  4NQ4 A;  2GFK A;  2Y8B A;  2FU6 A;  3QH8 A;  2I7T A;  2ZZI A;  5EVK A;  3IE0 A;  4UWS B;  4GYU A;  2CFU A;  3KL7 A;  4Z6X A;  2Q9U A;  3P2U A;  5B3R A;  4H0D A;  4EFZ A;  4Z5Z A;  5A0T A;  5EHT A;  2P97 A;  1YCH A;  4HL1 A;  3PY5 A;  1ZTC A;  4O98 A;  4UAM A;  5ACT A;  5AXO A;  2CG2 A;  5B15 A;  3X2X A;  3SD9 A;  4YSL A;  2WHG A;  2QED A;  5KIK A;  4CHL A;  1ZKP A;  2OHH A;  5HIQ A;  4D1V A;  5EV8 A;  4XWT A;  4UA4 A;  2BFK A;  4J5H A;  1WW1 A;  3T3N A;  4YSK A;  3A4Y A;  4Z5Y A;  5FQC A;  3AJ3 A;  2R2D A;  5EVB A;  2Y8A A;  2QIN A;  4EY2 A;  2BG7 A;  4FSB A;  1E5D A;  5K4N A;  3AF6 A;  5AYA A;  4NQ2 A;  4C1H A;  4J5F A;  3ZQ4 A;  4TZE A;  2H6A A;  1X8H A;  2BC2 A;  5EVD A;  1WUO A;  2P1E A;  2GMN A;  2ZNB A;  2AIO A;  4XUK A;  4KEQ A;  2YHE A;  4NQ6 A;  4AXH A;  4HL2 A;  4ZO3 A;  4C1F A;  4LE6 A;  4TZF A;  2BMI A; 
#chains in the Genus database with same CATH homology
 3Q6V A;  1A7T A;  3BC2 A;  5AXR A;  2FU9 A;  2WRS A;  1L9Y A;  1SML A;  2NZF A;  3ZR9 A;  5LSC A;  1YCG A;  2Y87 A;  5HIS A;  1KO2 A;  1BMC A;  4C1G A;  4RL2 A;  4EYL A;  5HIP A;  5K4M A;  3ZWF A;  4Z67 A;  4BZ3 A;  3I11 A;  4EYB A;  1X8G A;  4KEP A;  1WUP A;  5ACR A;  3RPC A;  1BVT A;  5LE1 A;  4EXS A;  3IEL A;  2OHI A;  1DXK A;  2M5D A;  1KO3 A;  5K4K A;  1K07 A;  3SRX A;  5AHR A;  2ZO4 A;  2BFZ A;  2YNU A;  3IE1 A;  5A0V A;  2YNT A;  4FR7 A;  4FEK A;  2YCB A;  4EXY A;  2ZWR A;  4TZ9 A;  2E7Y A;  4GCW A;  3PY6 A;  4XWW A;  5AHO A;  4TYT A;  3RKK A;  3X2Y A;  4UWR B;  4ZO2 A;  1X8I A;  4D1U A;  3WXC A;  2NYP A;  3IEK A;  5ACX A;  4TYF A;  1DDK A;  3AF5 A;  4C1E A;  2GKL A;  4D1W A;  2P18 A;  2VW8 A;  4RAW A;  3IE2 A;  2BFZ B;  1MQO A;  5EWA A;  4GYQ A;  2M5C A;  2YNT B;  1WRA A;  4NQ5 A;  5ACS A;  2CBN A;  5IQK A;  5LM6 A;  4B87 A;  4F6Z A;  1VGN A;  3DH8 A;  4AX1 B;  3IOG A;  2DOO A;  2BTN A;  4DIK A;  5LCH A;  3S0Z A;  1XM8 A;  4WD6 A;  5HIO A;  3SFP A;  3VPE A;  5ACV A;  1HLK A;  3MD7 A;  1DD6 A;  2FU8 A;  4C09 A;  5B1U A;  2BFL A;  1YCF A;  2NZE A;  2NXA A;  2YNV B;  4ZNB A;  2YZ3 A;  3DHC A;  5KIL A;  5LCF A;  4AD9 A;  3BV6 A;  3FAI A;  5HH5 A;  1P9E A;  2OHJ A;  4AWZ A;  3SBL A;  5A5Z A;  1VJN A;  2BR6 A;  3SPU A;  4UWP B;  3ZNB A;  2XF4 A;  5LCA A;  4RAM A;  3FCZ A;  5ACW A;  1VME A;  3JXP A;  1XTO A;  2QDS A;  4D02 A;  2XR1 A;  3RKJ A;  2P4Z A;  3IEM A;  3X2Z A;  3BK2 A;  4DIL A;  5A87 A;  5EH9 A;  5FQB A;  1BC2 A;  3IOF A;  3PG4 A;  1JT1 A;  2BG8 B;  1ZNB A;  4F6H A;  2FHX B;  2UYX A;  4JO0 A;  4U4L A;  5LMC A;  1JJE A;  3LVZ A;  2Q0I A;  2Q42 A;  4BP0 A;  5HH4 A;  5ACU A;  3BK1 A;  5LLD A;  4TZB A;  2FK6 A;  2QJS A;  2YNV A;  4RM5 A;  3R2U A;  4YSB A;  5EW0 A;  3I14 A;  4PVT A;  1Y44 A;  5K0W A;  2BG6 A;  3SW3 A;  4C1D A;  5HH6 A;  4AWY B;  1JJT A;  3G1P A;  1QH3 A;  2GFJ A;  2HB9 A;  1KR3 A;  2WYM A;  5AEB A;  4D1T A;  4RL0 A;  2YNW A;  4C1C A;  4EYF A;  4Z7R A;  3F9O A;  3T9M A;  3KNR A;  2Q0J A;  2I7V A;  2QDT A;  2WYL A;  4UWO B;  3I0V A;  4PVO A;  5ACQ A;  2BG2 A;  2WYM C;  1A8T A;  5ACP A;  3TP9 A;  4V0H A;  3H3E A;  3ADR A;  2GCU A;  3L6N A;  4AX0 B;  1M2X A;  3DHA A;  2A7M A;  2BG8 A;  5LS3 A;  3KNS A;  5DPX A;  2FHX A;  4UBQ A;  2FU7 A;  2DKF A;  1QH5 A;  2BIB A;  3ESH A;  4RBS A;  5FQA A;  2AZ4 A;  5EV6 A;  3T3O A;  4Z60 A;  4P62 A;  3I15 A;  2BGA A;  2FM6 A;  3VQZ A;  3I13 A;  3IDZ A;  3X30 A;  4HKY A;  3DHB A;  4ZEJ A;  2I7X A;  4NQ4 A;  2GFK A;  2Y8B A;  2FU6 A;  3QH8 A;  2I7T A;  2ZZI A;  5EVK A;  3IE0 A;  4UWS B;  4GYU A;  3KL7 A;  4Z6X A;  2Q9U A;  3P2U A;  5B3R A;  4H0D A;  4EFZ A;  4Z5Z A;  5A0T A;  5EHT A;  2P97 A;  1YCH A;  4HL1 A;  3PY5 A;  1ZTC A;  4O98 A;  4UAM A;  5ACT A;  5AXO A;  5B15 A;  3X2X A;  3SD9 A;  4YSL A;  2WHG A;  2QED A;  5KIK A;  4CHL A;  1ZKP A;  2OHH A;  5HIQ A;  4D1V A;  5EV8 A;  4XWT A;  4UA4 A;  2BFK A;  4J5H A;  1WW1 A;  3T3N A;  4YSK A;  3A4Y A;  4Z5Y A;  5FQC A;  3AJ3 A;  2R2D A;  5EVB A;  2Y8A A;  2QIN A;  4EY2 A;  2BG7 A;  4FSB A;  1E5D A;  5K4N A;  3AF6 A;  5AYA A;  4NQ2 A;  4C1H A;  4J5F A;  3ZQ4 A;  4TZE A;  2H6A A;  1X8H A;  2BC2 A;  5EVD A;  1WUO A;  2P1E A;  2GMN A;  2ZNB A;  2AIO A;  4XUK A;  4KEQ A;  4NQ6 A;  4HL2 A;  4ZO3 A;  4C1F A;  4LE6 A;  4TZF A;  2BMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...