1X91A

Crystal structure of mutant form a of a pectin methylesterase inhibitor from arabidopsis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
149
structure length
149
Chain Sequence
SSEMSTICDKTLNPSFCLKFLNTKFASANLQALAKTTLDSTQARATQTLKKLQSIIDGGVDPRSKLAYRSCVDEYESAIGNLEEAFEHLASGDGMGMNMKVSAALDGADTCLDDVKRLRSVDSSVVNNSKTIKNLCGIALVISNMLPRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords invertase/pectin methylesterase inhibitor family protein
publication title Structural insights into the target specificity of plant invertase and pectin methylesterase inhibitory proteins
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 64
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 1x91A00
1XG2B 1RJ4A 2CJ8A 1X91A 1RJ1A 2CJ5A 2XQRB 2CJ6A 2CJ7A 2CJ4A 1X90A 1X8ZA
chains in the Genus database with same CATH superfamily
1IVHA 3NF4A 4AKGA 3CE2A 1GJVA 4Q0TA 3F29A 4KSAA 4LQSB 4O5MA 4ZXVA 3N0RA 2R0MA 2CJ7A 4L3XA 1U8VA 4JIOA 4JIZA 4NXLA 4V25A 4Q5CA 5GJVE 3MMOA 2OR0A 1XFZA 2BU6A 4DZYA 1RX0A 3MPJA 1WS9A 2C12A 2J7AA 2PG0A 3II9A 4HKRA 3D6BA 4H85A 2Q8HA 3C2PA 1JQIA 3BNGA 2VR0A 4J1VA 4F0XA 3TZ0A 1IS2A 1EGCA 2Z1QA 1SIRA 3FCJA 4E00A 5K3GA 2D29A 3UBRA 5M4PA 1FS8A 2JBSA 3MDEA 4DOYA 4RM7A 4P79A 5K3JA 3Q24A 2YYMA 3CRKA 3X0YA 1Y8PA 5K3HA 4JEKA 1OAHA 2Q8IA 4Q5BA 2BU7A 2FONA 2AZEA 3SF6A 4KS9A 2ZDYA 1XFXA 4MPCA 2ZDXA 5B6BA 2F6LA 1K93A 4KCFA 4N5FA 4OO2A 2IX5A 1Y0VA 3SCEA 1K8TA 3AFFA 5M4KA 2DDHA 4MP2A 2E81A 2Q8GA 2ZO5A 3LG1A 2YYJA 3GNCA 4KSFA 5J71A 2FP2A 2AO2A 4E01A 3FO3A 3AFEA 2Q8FA 4E02A 4H81A 3Q22A 3P4TA 4G5EA 3D9GA 3L1TA 3OIBA 4QICA 5J6AA 2VIGA 2CJ4A 2VF1A 3C3LA 1JM6A 3CRLA 2OEVA 2EBAA 4IRNA 1FS7A 5BRKA 2PO4A 2E0AA 4U83A 1GKZA 3OWMA 3Q23A 2R02A 2FP1A 2WBIA 1LVCA 2XS8A 2YGWA 4AKIA 3TZ5A 4MP7A 3D9FA 4L38A 5M4NA 5K3IA 1PI1A 4HR3A 3UU9A 3X29A 2OJQA 1FS9A 2RFQA 2EBFX 4X28C 4M9AA 1GU6A 4WJYA 2BTZA 4Q17A 3D9EA 5B5VA 1XG2B 2BU5A 3MXLA 5BRMA 2PNRA 1GKXA 4H7QA 1EGEA 1W07A 2R0NA 4KTOA 4L3YA 4FF3A 1R2JA 2ZAFA 3D2RA 5M4MA 3BNFA 4P13A 3KMLA 2JBTA 2DVLA 3LGQA 1RJ1A 3VKGA 4L3ZA 3Q0AA 1EGDA 1SC5A 1Y8NA 3OWAA 4Q4UA 4V26A 2BU2A 1RP3A 1R3BA 3MPIA 1SK6A 3EONA 3D1IA 2XQRB 1UDYA 1XFUA 2YYLA 1K90A 4HKSA 1BUCA 4AKHA 4FF4A 1X90A 1X8ZA 2GBBA 3GM6A 2E80A 2REHA 3BNHA 2CJ6A 3D9DA 4MPEA 2OEXA 3VADA 2QR4A 3HWCA 3VKHA 2CJ5A 2JBRA 2R05A 2YYIA 4MPNA 3BNJA 3TORA 2HJNA 4AI6A 1PK0A 1T9GA 3SXQA 3B96A 4G97A 1XFYA 4FZ4A 3C46A 3GQTA 2OT4A 1Y8OA 1RJ4A 2BU8A 4X28A 3MDDA 1QDBA 3RKHA 1XFVA 3TTBA 3X0XA 1XFWA 3EOMA 3S7WA 1S26A 3PFDA 4XVXA 2JIFA 2UXWA 2CX9A 2YYKA 2CJ8A 2XS1A 5B5WA 1X91A 3TZ2A 2R03A 2RDZA 4FF1A 4Q1OA 4W9UA 2A1TA 5GJWE 2LFWA 2EC5A 2IX6A 2EBHX 4IV6A 3R7KA 4L1FA 2C0UA 4LQQB 3SWOA 2ZKJA 1SIQA 3MKHA 1UKWA 4FF2A 2RF7A 4ZYJA 3M9VA 3TZ4A 2YYGA
chains in the Genus database with same CATH topology
1XG2B 1RJ4A 2CJ8A 1X91A 1RJ1A 2CJ5A 2XQRB 2CJ6A 2CJ7A 2CJ4A 1X90A 1X8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XG2 B;  1RJ4 A;  2CJ8 A;  1X91 A;  1RJ1 A;  2CJ5 A;  2XQR B;  2CJ6 A;  2CJ7 A;  2CJ4 A;  1X90 A;  1X8Z A; 
#chains in the Genus database with same CATH topology
 1IVH A;  3NF4 A;  4AKG A;  3CE2 A;  1GJV A;  4Q0T A;  3F29 A;  4KSA A;  4LQS B;  4O5M A;  4ZXV A;  3N0R A;  2R0M A;  2CJ7 A;  4L3X A;  1U8V A;  4JIO A;  4JIZ A;  4NXL A;  4V25 A;  4Q5C A;  5GJV E;  3MMO A;  2OR0 A;  1XFZ A;  2BU6 A;  4DZY A;  1RX0 A;  3MPJ A;  1WS9 A;  2C12 A;  2J7A A;  2PG0 A;  3II9 A;  4HKR A;  3D6B A;  4H85 A;  2Q8H A;  3C2P A;  1JQI A;  3BNG A;  2VR0 A;  4J1V A;  4F0X A;  3TZ0 A;  1IS2 A;  1EGC A;  2Z1Q A;  1SIR A;  3FCJ A;  4E00 A;  5K3G A;  2D29 A;  3UBR A;  5M4P A;  1FS8 A;  2JBS A;  3MDE A;  4DOY A;  4RM7 A;  4P79 A;  5K3J A;  3Q24 A;  2YYM A;  3CRK A;  3X0Y A;  1Y8P A;  5K3H A;  4JEK A;  1OAH A;  2Q8I A;  4Q5B A;  2BU7 A;  2FON A;  2AZE A;  3SF6 A;  4KS9 A;  2ZDY A;  1XFX A;  4MPC A;  2ZDX A;  5B6B A;  2F6L A;  1K93 A;  4KCF A;  4N5F A;  4OO2 A;  2IX5 A;  1Y0V A;  3SCE A;  1K8T A;  3AFF A;  5M4K A;  2DDH A;  4MP2 A;  2E81 A;  2Q8G A;  2ZO5 A;  3LG1 A;  2YYJ A;  3GNC A;  4KSF A;  5J71 A;  2FP2 A;  2AO2 A;  4E01 A;  3FO3 A;  3AFE A;  2Q8F A;  4E02 A;  4H81 A;  3Q22 A;  3P4T A;  4G5E A;  3D9G A;  3L1T A;  3OIB A;  4QIC A;  5J6A A;  2VIG A;  2CJ4 A;  2VF1 A;  3C3L A;  1JM6 A;  3CRL A;  2OEV A;  2EBA A;  4IRN A;  1FS7 A;  5BRK A;  2PO4 A;  2E0A A;  4U83 A;  1GKZ A;  3OWM A;  3Q23 A;  2R02 A;  2FP1 A;  2WBI A;  1LVC A;  2XS8 A;  2YGW A;  4AKI A;  3TZ5 A;  4MP7 A;  3D9F A;  4L38 A;  5M4N A;  5K3I A;  1PI1 A;  4HR3 A;  3UU9 A;  3X29 A;  2OJQ A;  1FS9 A;  2RFQ A;  2EBF X;  4X28 C;  4M9A A;  1GU6 A;  4WJY A;  2BTZ A;  4Q17 A;  3D9E A;  5B5V A;  1XG2 B;  2BU5 A;  3MXL A;  5BRM A;  2PNR A;  1GKX A;  4H7Q A;  1EGE A;  1W07 A;  2R0N A;  4KTO A;  4L3Y A;  4FF3 A;  1R2J A;  2ZAF A;  3D2R A;  5M4M A;  3BNF A;  4P13 A;  3KML A;  2JBT A;  2DVL A;  3LGQ A;  1RJ1 A;  3VKG A;  4L3Z A;  3Q0A A;  1EGD A;  1SC5 A;  1Y8N A;  3OWA A;  4Q4U A;  4V26 A;  2BU2 A;  1RP3 A;  1R3B A;  3MPI A;  1SK6 A;  3EON A;  3D1I A;  2XQR B;  1UDY A;  1XFU A;  2YYL A;  1K90 A;  4HKS A;  1BUC A;  4AKH A;  4FF4 A;  1X90 A;  1X8Z A;  2GBB A;  3GM6 A;  2E80 A;  2REH A;  3BNH A;  2CJ6 A;  3D9D A;  4MPE A;  2OEX A;  3VAD A;  2QR4 A;  3HWC A;  3VKH A;  2CJ5 A;  2JBR A;  2R05 A;  2YYI A;  4MPN A;  3BNJ A;  3TOR A;  2HJN A;  4AI6 A;  1PK0 A;  1T9G A;  3SXQ A;  3B96 A;  4G97 A;  1XFY A;  4FZ4 A;  3C46 A;  3GQT A;  2OT4 A;  1Y8O A;  1RJ4 A;  2BU8 A;  4X28 A;  3MDD A;  1QDB A;  3RKH A;  1XFV A;  3TTB A;  3X0X A;  1XFW A;  3EOM A;  3S7W A;  1S26 A;  3PFD A;  4XVX A;  2JIF A;  2UXW A;  2CX9 A;  2YYK A;  2CJ8 A;  2XS1 A;  5B5W A;  1X91 A;  3TZ2 A;  2R03 A;  2RDZ A;  4FF1 A;  4Q1O A;  4W9U A;  2A1T A;  5GJW E;  2LFW A;  2EC5 A;  2IX6 A;  2EBH X;  4IV6 A;  3R7K A;  4L1F A;  2C0U A;  4LQQ B;  3SWO A;  2ZKJ A;  1SIQ A;  3MKH A;  1UKW A;  4FF2 A;  2RF7 A;  4ZYJ A;  3M9V A;  3TZ4 A;  2YYG A; 
#chains in the Genus database with same CATH homology
 1XG2 B;  1RJ4 A;  2CJ8 A;  1X91 A;  1RJ1 A;  2CJ5 A;  2XQR B;  2CJ6 A;  2CJ7 A;  2CJ4 A;  1X90 A;  1X8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...