The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
64
|
sequence length |
149
|
structure length |
149
|
Chain Sequence |
SSEMSTICDKTLNPSFCLKFLNTKFASANLQALAKTTLDSTQARATQTLKKLQSIIDGGVDPRSKLAYRSCVDEYESAIGNLEEAFEHLASGDGMGMNMKVSAALDGADTCLDDVKRLRSVDSSVVNNSKTIKNLCGIALVISNMLPRN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural insights into the target specificity of plant invertase and pectin methylesterase inhibitory proteins
pubmed doi rcsb |
| molecule keywords |
invertase/pectin methylesterase inhibitor family protein
|
| molecule tags |
Protein binding
|
| source organism |
Arabidopsis thaliana
|
| total genus |
64
|
| structure length |
149
|
| sequence length |
149
|
| ec nomenclature | |
| pdb deposition date | 2004-08-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04043 | PMEI | Plant invertase/pectin methylesterase inhibitor |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Butyryl-CoA Dehydrogenase, subunit A; domain 3 | Invertase/pectin methylesterase inhibitor family protein |
#chains in the Genus database with same CATH superfamily 1RJ4 A; 2CJ6 A; 1X90 A; 1RJ1 A; 2CJ4 A; 1XG2 B; 2CJ8 A; 2CJ5 A; 1X91 A; 1X8Z A; 2XQR B; 2CJ7 A; #chains in the Genus database with same CATH topology 1BUC A; 2F6L A; 2Z1Q A; 2BU5 A; 1IS2 A; 3LGQ A; 2R05 A; 2OEV A; 1SC5 A; 4L3Z A; 1XG2 B; 3M9V A; 1S26 A; 2YYK A; 4OO2 A; 2C0U A; 3AFF A; 4KCF A; 1GKZ A; 2E80 A; 2R02 A; 1RJ4 A; 5M4P A; 2CJ6 A; 3VAD A; 2RF7 A; 4N5F A; 2PO4 A; 4P13 A; 4FF3 A; 4XVX A; 2JIF A; 4RM7 A; 4DOY A; 1X91 A; 2YYG A; 3X0Y A; 3MPJ A; 2CJ7 A; 1W07 A; 2BU6 A; 4H85 A; 1EGC A; 5K3G A; 3MKH A; 1XFY A; 4L1F A; 2OT4 A; 3CRL A; 1IVH A; 2FP2 A; 3LG1 A; 2CX9 A; 3UU9 A; 4IRN A; 2JBT A; 1EGE A; 2YYJ A; 1XFX A; 2YYL A; 1K90 A; 3BNG A; 3D9E A; 1R3B A; 3GM6 A; 1T9G A; 1RJ1 A; 1XFU A; 2HJN A; 3NF4 A; 4Q5C A; 1UDY A; 2LFW A; 4Q17 A; 3EON A; 3X29 A; 3TZ5 A; 3TTB A; 2Q8I A; 4AKI A; 3UBR A; 3D1I A; 1XFW A; 4E00 A; 1FS8 A; 4FF2 A; 2QR4 A; 4FF1 A; 3FCJ A; 1GKX A; 3FO3 A; 3EOM A; 2A1T A; 4NXL A; 2VF1 A; 3S7W A; 2Q8G A; 2ZAF A; 3C2P A; 1R2J A; 2YYI A; 4FZ4 A; 4L38 A; 4FF4 A; 3VKG A; 2CJ8 A; 5M4N A; 1SIQ A; 3BNH A; 3N0R A; 4LQS B; 4Q1O A; 2XQR B; 4WJY A; 5B5V A; 3L1T A; 4MP2 A; 3Q22 A; 1PK0 A; 2ZO5 A; 1GJV A; 4HR3 A; 3D9F A; 2YYM A; 5BRM A; 4E01 A; 2REH A; 2DVL A; 4H7Q A; 4MPC A; 1WS9 A; 2IX6 A; 2IX5 A; 2XS1 A; 4Q0T A; 5J71 A; 5K3I A; 4JEK A; 2JBS A; 4IV6 A; 4KTO A; 2ZKJ A; 2Q8H A; 1Y0V A; 4X28 A; 4ZYJ A; 4HKR A; 1Y8P A; 4JIZ A; 2CJ5 A; 1X8Z A; 4HKS A; 2OJQ A; 5GJW E; 3TZ2 A; 2OR0 A; 4E02 A; 3MMO A; 1SK6 A; 2AZE A; 2JBR A; 1X90 A; 3SCE A; 4Q4U A; 3RKH A; 4ZXV A; 4G5E A; 1OAH A; 4KSF A; 2PNR A; 1K93 A; 3Q23 A; 5M4K A; 2C12 A; 5M4M A; 4G97 A; 4KS9 A; 4F0X A; 3HWC A; 1SIR A; 4O5M A; 2CJ4 A; 2EBA A; 4L3Y A; 4L3X A; 3OIB A; 1GU6 A; 2E81 A; 4U83 A; 2RFQ A; 3MDE A; 4H81 A; 3Q0A A; 2ZDX A; 5GJV E; 3VKH A; 2BU8 A; 3KML A; 1XFV A; 4W9U A; 3D9G A; 4Q5B A; 3TZ0 A; 4V25 A; 4M9A A; 2UXW A; 4QIC A; 3BNF A; 2E0A A; 4MPE A; 3Q24 A; 3D2R A; 3AFE A; 1XFZ A; 3BNJ A; 4P79 A; 2Q8F A; 5B5W A; 4JIO A; 2J7A A; 3CRK A; 3SXQ A; 3D9D A; 5B6B A; 1QDB A; 3SWO A; 4X28 C; 5K3J A; 4MP7 A; 5K3H A; 2EBF X; 3B96 A; 2BU7 A; 2EC5 A; 1EGD A; 3MXL A; 2ZDY A; 4V26 A; 2YGW A; 3GNC A; 3P4T A; 4LQQ B; 3SF6 A; 2XS8 A; 3OWA A; 3C3L A; 1FS9 A; 2AO2 A; 2EBH X; 3GQT A; 1FS7 A; 3X0X A; 4MPN A; 4DZY A; 3PFD A; 4KSA A; 4AKG A; 2VR0 A; 2FON A; 5J6A A; 2FP1 A; 2PG0 A; 3MPI A; 5BRK A; 3C46 A; 1LVC A; 3OWM A; 2R03 A; 3R7K A; 1RP3 A; 1U8V A; 4AKH A; 2RDZ A; 2BU2 A; 3TZ4 A; 3CE2 A; 1Y8O A; 2WBI A; 3TOR A; 1JM6 A; 3II9 A; 1K8T A; 3MDD A; 2D29 A; 2OEX A; 2BTZ A; 3D6B A; 1RX0 A; 2DDH A; 2R0N A; 2GBB A; 1PI1 A; 2R0M A; 3F29 A; 2VIG A; 1UKW A; 4J1V A; 1JQI A; 1Y8N A; 4AI6 A; #chains in the Genus database with same CATH homology 1RJ4 A; 2CJ6 A; 1X90 A; 1RJ1 A; 2CJ4 A; 1XG2 B; 2CJ8 A; 2CJ5 A; 1X91 A; 1X8Z A; 2XQR B; 2CJ7 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...