1X91A

Crystal structure of mutant form a of a pectin methylesterase inhibitor from arabidopsis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
149
structure length
149
Chain Sequence
SSEMSTICDKTLNPSFCLKFLNTKFASANLQALAKTTLDSTQARATQTLKKLQSIIDGGVDPRSKLAYRSCVDEYESAIGNLEEAFEHLASGDGMGMNMKVSAALDGADTCLDDVKRLRSVDSSVVNNSKTIKNLCGIALVISNMLPRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords invertase/pectin methylesterase inhibitor family protein
publication title Structural insights into the target specificity of plant invertase and pectin methylesterase inhibitory proteins
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 64
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 1x91A00
2CJ8A 1X90A 1RJ4A 2XQRB 1X8ZA 2CJ4A 1XG2B 2CJ6A 2CJ5A 1X91A 2CJ7A 1RJ1A
chains in the Genus database with same CATH superfamily
2Q8GA 2HJNA 3CRKA 2R02A 1OAHA 3D9EA 4JIZA 2ZKJA 2WBIA 4MP7A 2J7AA 3GNCA 4P13A 2OJQA 3EOMA 2QR4A 4L3ZA 2YYKA 4H81A 2FONA 4L1FA 3N0RA 4FF3A 1Y8NA 4HKSA 5M4KA 2BU6A 4KSFA 4V25A 1X8ZA 2EBAA 4E00A 4F0XA 3D6BA 3D9DA 2Q8FA 4MPEA 5BRMA 1S26A 4XVXA 3BNHA 3D1IA 1SC5A 2OEVA 3PFDA 1GU6A 4X28A 2FP1A 4Q5BA 4E01A 3FCJA 3BNJA 4JEKA 4OO2A 5B5WA 3GQTA 3TTBA 2ZO5A 3GM6A 1W07A 2YGWA 4MPNA 2D29A 2EBFX 1RP3A 1PK0A 3X0XA 2R0NA 1EGCA 3FO3A 3II9A 3MPIA 4U83A 4AI6A 2YYMA 1JM6A 1R2JA 1FS8A 1FS7A 1XFWA 3L1TA 1Y0VA 3AFEA 3Q0AA 3BNFA 1K90A 5K3IA 4H85A 4LQQB 3C2PA 4HKRA 2RF7A 5M4PA 4E02A 1EGEA 3BNGA 3HWCA 1GKXA 4J1VA 1SK6A 2CX9A 4HR3A 3SXQA 3MDDA 1XFVA 3SCEA 1RJ4A 3Q23A 2AZEA 2ZDXA 2CJ5A 2A1TA 1SIQA 4L3YA 4MPCA 4G5EA 1XFYA 2C0UA 1RJ1A 2E80A 2JIFA 4X28C 3VKHA 4KTOA 3TZ2A 4O5MA 2UXWA 4FF4A 4L38A 4LQSB 5BRKA 2YYGA 2IX6A 1T9GA 3B96A 1Y8OA 3CE2A 4W9UA 1IVHA 3TZ5A 2CJ8A 5M4MA 2YYIA 5M4NA 4NXLA 2XQRB 2EC5A 2XS8A 1FS9A 4P79A 3UBRA 5K3HA 2CJ4A 2RFQA 3RKHA 4FF2A 1X91A 3MMOA 1BUCA 2BU2A 3OIBA 4KSAA 3X0YA 3SWOA 2VF1A 3SF6A 2E81A 1U8VA 3EONA 3VADA 1SIRA 1Y8PA 2BU5A 2C12A 2XS1A 3P4TA 4G97A 2DVLA 4Q5CA 3TZ4A 2JBSA 2OT4A 4DOYA 1GKZA 3CRLA 3TZ0A 1R3BA 3S7WA 3D9GA 2BTZA 2R0MA 3MPJA 4Q17A 4V26A 1XG2B 3NF4A 2OR0A 3AFFA 4KS9A 1RX0A 2VR0A 1XFUA 3LGQA 3C3LA 2JBTA 1GJVA 2GBBA 2IX5A 1K8TA 1WS9A 3Q24A 2CJ6A 2E0AA 4AKGA 2CJ7A 2AO2A 1LVCA 1EGDA 4IRNA 1K93A 2LFWA 4M9AA 2PO4A 1JQIA 5GJVE 5B5VA 3UU9A 5GJWE 2Q8IA 1PI1A 3OWAA 2EBHX 2ZAFA 2F6LA 3MXLA 4FZ4A 3C46A 4KCFA 2PNRA 4Q0TA 2RDZA 4ZYJA 2JBRA 3D9FA 4AKIA 2BU7A 1QDBA 3MKHA 3TORA 4DZYA 4RM7A 3X29A 2R05A 5K3JA 2Q8HA 1UDYA 3D2RA 5J6AA 2ZDYA 3M9VA 3F29A 2VIGA 1X90A 3MDEA 4QICA 4H7QA 3LG1A 3VKGA 3R7KA 1XFXA 2FP2A 2PG0A 4JIOA 5B6BA 2BU8A 4ZXVA 4N5FA 3KMLA 4Q4UA 2YYJA 1XFZA 4WJYA 1IS2A 1UKWA 3OWMA 4IV6A 4MP2A 2Z1QA 3Q22A 2REHA 4L3XA 5J71A 4FF1A 4Q1OA 2YYLA 2R03A 2DDHA 2OEXA 4AKHA 5K3GA
chains in the Genus database with same CATH topology
2CJ8A 1X90A 1RJ4A 2XQRB 1X8ZA 2CJ4A 1XG2B 2CJ6A 2CJ5A 1X91A 2CJ7A 1RJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJ8 A;  1X90 A;  1RJ4 A;  2XQR B;  1X8Z A;  2CJ4 A;  1XG2 B;  2CJ6 A;  2CJ5 A;  1X91 A;  2CJ7 A;  1RJ1 A; 
#chains in the Genus database with same CATH topology
 2Q8G A;  2HJN A;  3CRK A;  2R02 A;  1OAH A;  3D9E A;  4JIZ A;  2ZKJ A;  2WBI A;  4MP7 A;  2J7A A;  3GNC A;  4P13 A;  2OJQ A;  3EOM A;  2QR4 A;  4L3Z A;  2YYK A;  4H81 A;  2FON A;  4L1F A;  3N0R A;  4FF3 A;  1Y8N A;  4HKS A;  5M4K A;  2BU6 A;  4KSF A;  4V25 A;  1X8Z A;  2EBA A;  4E00 A;  4F0X A;  3D6B A;  3D9D A;  2Q8F A;  4MPE A;  5BRM A;  1S26 A;  4XVX A;  3BNH A;  3D1I A;  1SC5 A;  2OEV A;  3PFD A;  1GU6 A;  4X28 A;  2FP1 A;  4Q5B A;  4E01 A;  3FCJ A;  3BNJ A;  4JEK A;  4OO2 A;  5B5W A;  3GQT A;  3TTB A;  2ZO5 A;  3GM6 A;  1W07 A;  2YGW A;  4MPN A;  2D29 A;  2EBF X;  1RP3 A;  1PK0 A;  3X0X A;  2R0N A;  1EGC A;  3FO3 A;  3II9 A;  3MPI A;  4U83 A;  4AI6 A;  2YYM A;  1JM6 A;  1R2J A;  1FS8 A;  1FS7 A;  1XFW A;  3L1T A;  1Y0V A;  3AFE A;  3Q0A A;  3BNF A;  1K90 A;  5K3I A;  4H85 A;  4LQQ B;  3C2P A;  4HKR A;  2RF7 A;  5M4P A;  4E02 A;  1EGE A;  3BNG A;  3HWC A;  1GKX A;  4J1V A;  1SK6 A;  2CX9 A;  4HR3 A;  3SXQ A;  3MDD A;  1XFV A;  3SCE A;  1RJ4 A;  3Q23 A;  2AZE A;  2ZDX A;  2CJ5 A;  2A1T A;  1SIQ A;  4L3Y A;  4MPC A;  4G5E A;  1XFY A;  2C0U A;  1RJ1 A;  2E80 A;  2JIF A;  4X28 C;  3VKH A;  4KTO A;  3TZ2 A;  4O5M A;  2UXW A;  4FF4 A;  4L38 A;  4LQS B;  5BRK A;  2YYG A;  2IX6 A;  1T9G A;  3B96 A;  1Y8O A;  3CE2 A;  4W9U A;  1IVH A;  3TZ5 A;  2CJ8 A;  5M4M A;  2YYI A;  5M4N A;  4NXL A;  2XQR B;  2EC5 A;  2XS8 A;  1FS9 A;  4P79 A;  3UBR A;  5K3H A;  2CJ4 A;  2RFQ A;  3RKH A;  4FF2 A;  1X91 A;  3MMO A;  1BUC A;  2BU2 A;  3OIB A;  4KSA A;  3X0Y A;  3SWO A;  2VF1 A;  3SF6 A;  2E81 A;  1U8V A;  3EON A;  3VAD A;  1SIR A;  1Y8P A;  2BU5 A;  2C12 A;  2XS1 A;  3P4T A;  4G97 A;  2DVL A;  4Q5C A;  3TZ4 A;  2JBS A;  2OT4 A;  4DOY A;  1GKZ A;  3CRL A;  3TZ0 A;  1R3B A;  3S7W A;  3D9G A;  2BTZ A;  2R0M A;  3MPJ A;  4Q17 A;  4V26 A;  1XG2 B;  3NF4 A;  2OR0 A;  3AFF A;  4KS9 A;  1RX0 A;  2VR0 A;  1XFU A;  3LGQ A;  3C3L A;  2JBT A;  1GJV A;  2GBB A;  2IX5 A;  1K8T A;  1WS9 A;  3Q24 A;  2CJ6 A;  2E0A A;  4AKG A;  2CJ7 A;  2AO2 A;  1LVC A;  1EGD A;  4IRN A;  1K93 A;  2LFW A;  4M9A A;  2PO4 A;  1JQI A;  5GJV E;  5B5V A;  3UU9 A;  5GJW E;  2Q8I A;  1PI1 A;  3OWA A;  2EBH X;  2ZAF A;  2F6L A;  3MXL A;  4FZ4 A;  3C46 A;  4KCF A;  2PNR A;  4Q0T A;  2RDZ A;  4ZYJ A;  2JBR A;  3D9F A;  4AKI A;  2BU7 A;  1QDB A;  3MKH A;  3TOR A;  4DZY A;  4RM7 A;  3X29 A;  2R05 A;  5K3J A;  2Q8H A;  1UDY A;  3D2R A;  5J6A A;  2ZDY A;  3M9V A;  3F29 A;  2VIG A;  1X90 A;  3MDE A;  4QIC A;  4H7Q A;  3LG1 A;  3VKG A;  3R7K A;  1XFX A;  2FP2 A;  2PG0 A;  4JIO A;  5B6B A;  2BU8 A;  4ZXV A;  4N5F A;  3KML A;  4Q4U A;  2YYJ A;  1XFZ A;  4WJY A;  1IS2 A;  1UKW A;  3OWM A;  4IV6 A;  4MP2 A;  2Z1Q A;  3Q22 A;  2REH A;  4L3X A;  5J71 A;  4FF1 A;  4Q1O A;  2YYL A;  2R03 A;  2DDH A;  2OEX A;  4AKH A;  5K3G A; 
#chains in the Genus database with same CATH homology
 2CJ8 A;  1X90 A;  1RJ4 A;  2XQR B;  1X8Z A;  2CJ4 A;  1XG2 B;  2CJ6 A;  2CJ5 A;  1X91 A;  2CJ7 A;  1RJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...