2GBBA

Crystal structure of secreted chorismate mutase from yersinia pestis
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
156
structure length
156
Chain Sequence
QQCGQTAPLINERLSYMKDVAGYKAENHLPIEDRIQEEKVINSAMAQAESLGLNGESIKPLMVAQINAAKAIQYRYRADWLSQPEPGWQPKPLDDVRANIGELSTKILEQIAEELKTCKPAEMGDKAHFINTIRQHNLTSADVEAIFSTFNQVKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords putative chorismate mutase
publication title A comparative biochemical and structural analysis of the intracellular chorismate mutase (Rv0948c) from Mycobacterium tuberculosis H(37)R(v) and the secreted chorismate mutase (y2828) from Yersinia pestis.
pubmed doi rcsb
source organism Yersinia pestis biovar microtus str. 91001
total genus 57
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2006-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.170 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 2gbbA00
2FP1A 2GBBA 2AO2A 2FP2A 2F6LA
chains in the Genus database with same CATH superfamily
4XVXA 2ZDXA 2EBFX 3TZ0A 2GBBA 4G97A 3C3LA 4IV6A 3EOMA 4E02A 1W07A 2ZAFA 1R2JA 2BU6A 5B6BA 3C2PA 1GKZA 2BU5A 3GQTA 3SF6A 4E00A 4HKRA 2WBIA 4JEKA 5K3HA 5BRKA 2CX9A 3GNCA 3BNGA 4MP7A 2FONA 4FF1A 3F29A 3VKHA 4ZXVA 3MMOA 2FP2A 2PNRA 5M4PA 3TORA 2UXWA 1Y8OA 2EBAA 5M4NA 4HR3A 4Q1OA 2JBSA 4W9UA 5K3IA 3CRKA 2ZKJA 5M4KA 3S7WA 1JQIA 1OAHA 1LVCA 3MKHA 3X0XA 2CJ5A 3HWCA 2CJ8A 4JIZA 4KSFA 4DZYA 2F6LA 4FZ4A 2OR0A 1EGEA 4LQQB 4MP2A 4ZYJA 2CJ6A 4N5FA 1BUCA 4FF2A 3OWAA 1K93A 1XFWA 2IX5A 2YYKA 4IRNA 3LGQA 1SIQA 1IS2A 2YYJA 2VR0A 2HJNA 1XFXA 1RJ4A 2E0AA 2XS1A 3NF4A 4O5MA 4P13A 4LQSB 3SXQA 1XFYA 3Q0AA 2YYMA 1GJVA 1PK0A 1XFUA 2EBHX 3FO3A 3MPIA 3LG1A 3GM6A 4L38A 1XFZA 2QR4A 3PFDA 1JM6A 3D9FA 2JBRA 3TZ5A 2AO2A 1WS9A 4AI6A 1FS7A 2YGWA 4H7QA 1PI1A 2DDHA 5B5WA 1FS9A 2AZEA 5J6AA 4J1VA 5GJVE 2R0NA 3P4TA 4P79A 4MPNA 2C0UA 4X28A 1X8ZA 2CJ4A 3D6BA 3OIBA 5K3JA 4DOYA 3BNFA 2REHA 1EGCA 2ZO5A 3X29A 2E80A 3BNHA 4KCFA 3AFEA 4H81A 4M9AA 3VADA 5M4MA 2Q8HA 3FCJA 4HKSA 5K3GA 4FF3A 2RFQA 2OJQA 1X90A 3II9A 4WJYA 4AKIA 5J71A 4KTOA 3EONA 1Y0VA 2XQRB 1GU6A 2LFWA 1FS8A 1U8VA 3TZ2A 2PO4A 3BNJA 3SCEA 3SWOA 1UDYA 2R0MA 1GKXA 2D29A 3D2RA 1SIRA 1SC5A 2R03A 3TZ4A 3Q22A 3UBRA 2RDZA 1Y8NA 2XS8A 3N0RA 4L1FA 3TTBA 3VKGA 3B96A 3OWMA 2A1TA 3D9EA 2OT4A 4AKGA 3Q24A 3D1IA 2R02A 3RKHA 1Y8PA 1S26A 2YYLA 4F0XA 3Q23A 3D9GA 4L3ZA 3D9DA 2Q8FA 1RP3A 2OEXA 4MPCA 2OEVA 2Q8GA 3MPJA 2BU2A 2J7AA 1EGDA 3KMLA 4H85A 1T9GA 2BTZA 2FP1A 4JIOA 4Q5BA 1X91A 1QDBA 4Q4UA 3L1TA 4Q0TA 3X0YA 3C46A 1K8TA 4NXLA 3MXLA 2E81A 2YYGA 2VIGA 4U83A 2RF7A 2PG0A 3AFFA 4Q17A 3R7KA 2JBTA 3CE2A 1XG2B 2VF1A 2JIFA 3M9VA 3MDDA 4L3XA 2CJ7A 5B5VA 2BU7A 4KS9A 3CRLA 4V26A 4KSAA 2BU8A 4G5EA 3UU9A 1SK6A 5BRMA 4E01A 4MPEA 4OO2A 2Q8IA 2EC5A 1RJ1A 1UKWA 2C12A 2Z1QA 2ZDYA 4Q5CA 1K90A 4L3YA 4V25A 2R05A 5GJWE 3MDEA 2IX6A 4RM7A 4QICA 1IVHA 1R3BA 2DVLA 1RX0A 1XFVA 4X28C 2YYIA 4AKHA 4FF4A
chains in the Genus database with same CATH topology
2EBFX 2FP1A 4HKSA 2GBBA 4G97A 3C3LA 1K93A 3C46A 1XFWA 4FF3A 4FF2A 1K8TA 4AKIA 3C2PA 1XFXA 1Y0VA 2LFWA 4HKRA 2PO4A 1XFYA 3CE2A 3Q0AA 1PK0A 2EBHX 1XFUA 2VF1A 1XFZA 1SC5A 2QR4A 3Q22A 3N0RA 4KS9A 4FF1A 3VKHA 3VKGA 2AO2A 4KSAA 2FP2A 4AI6A 1SK6A 2YGWA 2AZEA 4AKGA 5GJVE 3Q24A 2EC5A 4P79A 1K90A 1LVCA 1S26A 5GJWE 4F0XA 3Q23A 4KSFA 1RP3A 2F6LA 4FZ4A 4QICA 3X29A 1XFVA 3KMLA 4AKHA 4FF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FP1 A;  2GBB A;  2AO2 A;  2FP2 A;  2F6L A; 
#chains in the Genus database with same CATH topology
 4XVX A;  2ZDX A;  2EBF X;  3TZ0 A;  2GBB A;  4G97 A;  3C3L A;  4IV6 A;  3EOM A;  4E02 A;  1W07 A;  2ZAF A;  1R2J A;  2BU6 A;  5B6B A;  3C2P A;  1GKZ A;  2BU5 A;  3GQT A;  3SF6 A;  4E00 A;  4HKR A;  2WBI A;  4JEK A;  5K3H A;  5BRK A;  2CX9 A;  3GNC A;  3BNG A;  4MP7 A;  2FON A;  4FF1 A;  3F29 A;  3VKH A;  4ZXV A;  3MMO A;  2FP2 A;  2PNR A;  5M4P A;  3TOR A;  2UXW A;  1Y8O A;  2EBA A;  5M4N A;  4HR3 A;  4Q1O A;  2JBS A;  4W9U A;  5K3I A;  3CRK A;  2ZKJ A;  5M4K A;  3S7W A;  1JQI A;  1OAH A;  1LVC A;  3MKH A;  3X0X A;  2CJ5 A;  3HWC A;  2CJ8 A;  4JIZ A;  4KSF A;  4DZY A;  2F6L A;  4FZ4 A;  2OR0 A;  1EGE A;  4LQQ B;  4MP2 A;  4ZYJ A;  2CJ6 A;  4N5F A;  1BUC A;  4FF2 A;  3OWA A;  1K93 A;  1XFW A;  2IX5 A;  2YYK A;  4IRN A;  3LGQ A;  1SIQ A;  1IS2 A;  2YYJ A;  2VR0 A;  2HJN A;  1XFX A;  1RJ4 A;  2E0A A;  2XS1 A;  3NF4 A;  4O5M A;  4P13 A;  4LQS B;  3SXQ A;  1XFY A;  3Q0A A;  2YYM A;  1GJV A;  1PK0 A;  1XFU A;  2EBH X;  3FO3 A;  3MPI A;  3LG1 A;  3GM6 A;  4L38 A;  1XFZ A;  2QR4 A;  3PFD A;  1JM6 A;  3D9F A;  2JBR A;  3TZ5 A;  2AO2 A;  1WS9 A;  4AI6 A;  1FS7 A;  2YGW A;  4H7Q A;  1PI1 A;  2DDH A;  5B5W A;  1FS9 A;  2AZE A;  5J6A A;  4J1V A;  5GJV E;  2R0N A;  3P4T A;  4P79 A;  4MPN A;  2C0U A;  4X28 A;  1X8Z A;  2CJ4 A;  3D6B A;  3OIB A;  5K3J A;  4DOY A;  3BNF A;  2REH A;  1EGC A;  2ZO5 A;  3X29 A;  2E80 A;  3BNH A;  4KCF A;  3AFE A;  4H81 A;  4M9A A;  3VAD A;  5M4M A;  2Q8H A;  3FCJ A;  4HKS A;  5K3G A;  4FF3 A;  2RFQ A;  2OJQ A;  1X90 A;  3II9 A;  4WJY A;  4AKI A;  5J71 A;  4KTO A;  3EON A;  1Y0V A;  2XQR B;  1GU6 A;  2LFW A;  1FS8 A;  1U8V A;  3TZ2 A;  2PO4 A;  3BNJ A;  3SCE A;  3SWO A;  1UDY A;  2R0M A;  1GKX A;  2D29 A;  3D2R A;  1SIR A;  1SC5 A;  2R03 A;  3TZ4 A;  3Q22 A;  3UBR A;  2RDZ A;  1Y8N A;  2XS8 A;  3N0R A;  4L1F A;  3TTB A;  3VKG A;  3B96 A;  3OWM A;  2A1T A;  3D9E A;  2OT4 A;  4AKG A;  3Q24 A;  3D1I A;  2R02 A;  3RKH A;  1Y8P A;  1S26 A;  2YYL A;  4F0X A;  3Q23 A;  3D9G A;  4L3Z A;  3D9D A;  2Q8F A;  1RP3 A;  2OEX A;  4MPC A;  2OEV A;  2Q8G A;  3MPJ A;  2BU2 A;  2J7A A;  1EGD A;  3KML A;  4H85 A;  1T9G A;  2BTZ A;  2FP1 A;  4JIO A;  4Q5B A;  1X91 A;  1QDB A;  4Q4U A;  3L1T A;  4Q0T A;  3X0Y A;  3C46 A;  1K8T A;  4NXL A;  3MXL A;  2E81 A;  2YYG A;  2VIG A;  4U83 A;  2RF7 A;  2PG0 A;  3AFF A;  4Q17 A;  3R7K A;  2JBT A;  3CE2 A;  1XG2 B;  2VF1 A;  2JIF A;  3M9V A;  3MDD A;  4L3X A;  2CJ7 A;  5B5V A;  2BU7 A;  4KS9 A;  3CRL A;  4V26 A;  4KSA A;  2BU8 A;  4G5E A;  3UU9 A;  1SK6 A;  5BRM A;  4E01 A;  4MPE A;  4OO2 A;  2Q8I A;  2EC5 A;  1RJ1 A;  1UKW A;  2C12 A;  2Z1Q A;  2ZDY A;  4Q5C A;  1K90 A;  4L3Y A;  4V25 A;  2R05 A;  5GJW E;  3MDE A;  2IX6 A;  4RM7 A;  4QIC A;  1IVH A;  1R3B A;  2DVL A;  1RX0 A;  1XFV A;  4X28 C;  2YYI A;  4AKH A;  4FF4 A; 
#chains in the Genus database with same CATH homology
 2EBF X;  2FP1 A;  4HKS A;  2GBB A;  4G97 A;  3C3L A;  1K93 A;  3C46 A;  1XFW A;  4FF3 A;  4FF2 A;  1K8T A;  4AKI A;  3C2P A;  1XFX A;  1Y0V A;  2LFW A;  4HKR A;  2PO4 A;  1XFY A;  3CE2 A;  3Q0A A;  1PK0 A;  2EBH X;  1XFU A;  2VF1 A;  1XFZ A;  1SC5 A;  2QR4 A;  3Q22 A;  3N0R A;  4KS9 A;  4FF1 A;  3VKH A;  3VKG A;  2AO2 A;  4KSA A;  2FP2 A;  4AI6 A;  1SK6 A;  2YGW A;  2AZE A;  4AKG A;  5GJV E;  3Q24 A;  2EC5 A;  4P79 A;  1K90 A;  1LVC A;  1S26 A;  5GJW E;  4F0X A;  3Q23 A;  4KSF A;  1RP3 A;  2F6L A;  4FZ4 A;  4QIC A;  3X29 A;  1XFV A;  3KML A;  4AKH A;  4FF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...