1XG2B

Crystal structure of the complex between pectin methylesterase and its inhibitor protein
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
151
structure length
151
Chain Sequence
FENHLISEICPKTRNPSLCLQALESDPRSASKDLKGLGQFSIDIAQASAKQTSKIIASLTNQATDPKLKGRYETCSENYADAIDSLGQAKQFLTSGDYNSLNIYASAAFDGAGTCEDSFEGPPNIPTQLHQADLKLEDLCDIVLVISNLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Pectinesterase 1
publication title Structural Basis for the Interaction between Pectin Methylesterase and a Specific Inhibitor Protein
pubmed doi rcsb
source organism Actinidia chinensis
total genus 66
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 1xg2B00
1X8ZA 1X90A 2CJ7A 2CJ8A 2CJ4A 1RJ4A 1XG2B 2CJ5A 1RJ1A 2CJ6A 1X91A 2XQRB
chains in the Genus database with same CATH superfamily
2CX9A 3OIBA 1X8ZA 2AZEA 2DDHA 4MPEA 1SC5A 5J6AA 2ZDYA 1UDYA 3BNFA 4L3XA 5GJVE 3N0RA 4V25A 4ZYJA 2C12A 3PFDA 3BNGA 3Q23A 1Y8PA 1K90A 3NF4A 4AKHA 1PK0A 1JQIA 3MXLA 2CJ4A 3R7KA 1K8TA 3MKHA 2JBSA 3CRKA 3M9VA 4X28C 4LQQB 1XFUA 5K3IA 2OEXA 1PI1A 4G97A 3S7WA 4RM7A 1R2JA 3MDDA 1SK6A 2HJNA 2ZDXA 4KSAA 2FP2A 4FZ4A 4Q17A 4G5EA 1U8VA 2YYMA 3VADA 5M4PA 3Q24A 3D9DA 3KMLA 4MP7A 2CJ5A 4JEKA 4M9AA 4KTOA 1S26A 2XS8A 3CRLA 2BU8A 4P79A 1FS8A 3HWCA 1X91A 2Q8GA 3CE2A 3D2RA 4L3ZA 1RP3A 4HKRA 2ZAFA 2BU7A 2WBIA 2RDZA 5K3HA 1BUCA 5B6BA 1XFYA 4L38A 2YYLA 4N5FA 2JBTA 3LGQA 3MDEA 5BRKA 2R0MA 1FS9A 4IV6A 2PG0A 2Q8HA 3MPIA 3TZ4A 2BU5A 3MPJA 3UU9A 3SWOA 3D1IA 1W07A 2CJ6A 4MP2A 3D9EA 2XQRB 1XFZA 4DZYA 2VIGA 2R05A 4L1FA 4KSFA 3X0YA 2OR0A 4P13A 1SIQA 3X29A 4Q5CA 1RJ4A 2VR0A 3C2PA 1EGDA 1EGCA 1UKWA 5M4MA 4AI6A 4H81A 4AKGA 2LFWA 1R3BA 1WS9A 1Y8NA 2F6LA 1QDBA 2C0UA 4IRNA 2RF7A 2OEVA 2R0NA 1XFXA 3OWMA 4F0XA 4U83A 4HR3A 3L1TA 2QR4A 2BU2A 4AKIA 2IX6A 4XVXA 1RX0A 5J71A 1T9GA 4KS9A 5M4KA 4O5MA 3C3LA 2CJ8A 4MPCA 1LVCA 2BU6A 3TTBA 3C46A 3SF6A 2Q8IA 3TORA 3F29A 3MMOA 4MPNA 4NXLA 5B5WA 2UXWA 1IS2A 1SIRA 2YYIA 3FO3A 4Q1OA 4Q4UA 1IVHA 1Y0VA 1XFVA 3SXQA 4Q0TA 2JIFA 2ZO5A 5B5VA 3EONA 2YGWA 2IX5A 1GKXA 1RJ1A 2E81A 3AFFA 4FF4A 3AFEA 2PNRA 2Z1QA 3GNCA 3BNJA 3LG1A 4FF1A 3II9A 1K93A 2FP1A 4Q5BA 1GJVA 1Y8OA 2EBHX 4ZXVA 2REHA 4LQSB 2Q8FA 4FF3A 4WJYA 3VKGA 4FF2A 3D9GA 3EOMA 3UBRA 3SCEA 3BNHA 1JM6A 3OWAA 4H7QA 4OO2A 4E01A 3GQTA 3Q0AA 1OAHA 3X0XA 1GU6A 2DVLA 1XFWA 2FONA 4L3YA 2VF1A 2E80A 4KCFA 2R03A 5GJWE 2BTZA 4V26A 1FS7A 2ZKJA 1GKZA 2EBFX 2GBBA 2JBRA 2R02A 4W9UA 5K3JA 5K3GA 2AO2A 2XS1A 5M4NA 2YYJA 2OJQA 2YYGA 4E00A 4DOYA 2D29A 4QICA 1EGEA 1XG2B 2RFQA 4JIOA 3TZ5A 3VKHA 4J1VA 2EC5A 2OT4A 4X28A 3TZ0A 2YYKA 3D6BA 1X90A 2CJ7A 2EBAA 4JIZA 2J7AA 3RKHA 4E02A 2E0AA 3B96A 4H85A 4HKSA 3Q22A 2PO4A 3P4TA 3FCJA 3D9FA 3GM6A 5BRMA 3TZ2A 2A1TA
chains in the Genus database with same CATH topology
1X8ZA 1X90A 2CJ7A 2CJ8A 2CJ4A 1RJ4A 1XG2B 2CJ5A 1RJ1A 2CJ6A 1X91A 2XQRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Z A;  1X90 A;  2CJ7 A;  2CJ8 A;  2CJ4 A;  1RJ4 A;  1XG2 B;  2CJ5 A;  1RJ1 A;  2CJ6 A;  1X91 A;  2XQR B; 
#chains in the Genus database with same CATH topology
 2CX9 A;  3OIB A;  1X8Z A;  2AZE A;  2DDH A;  4MPE A;  1SC5 A;  5J6A A;  2ZDY A;  1UDY A;  3BNF A;  4L3X A;  5GJV E;  3N0R A;  4V25 A;  4ZYJ A;  2C12 A;  3PFD A;  3BNG A;  3Q23 A;  1Y8P A;  1K90 A;  3NF4 A;  4AKH A;  1PK0 A;  1JQI A;  3MXL A;  2CJ4 A;  3R7K A;  1K8T A;  3MKH A;  2JBS A;  3CRK A;  3M9V A;  4X28 C;  4LQQ B;  1XFU A;  5K3I A;  2OEX A;  1PI1 A;  4G97 A;  3S7W A;  4RM7 A;  1R2J A;  3MDD A;  1SK6 A;  2HJN A;  2ZDX A;  4KSA A;  2FP2 A;  4FZ4 A;  4Q17 A;  4G5E A;  1U8V A;  2YYM A;  3VAD A;  5M4P A;  3Q24 A;  3D9D A;  3KML A;  4MP7 A;  2CJ5 A;  4JEK A;  4M9A A;  4KTO A;  1S26 A;  2XS8 A;  3CRL A;  2BU8 A;  4P79 A;  1FS8 A;  3HWC A;  1X91 A;  2Q8G A;  3CE2 A;  3D2R A;  4L3Z A;  1RP3 A;  4HKR A;  2ZAF A;  2BU7 A;  2WBI A;  2RDZ A;  5K3H A;  1BUC A;  5B6B A;  1XFY A;  4L38 A;  2YYL A;  4N5F A;  2JBT A;  3LGQ A;  3MDE A;  5BRK A;  2R0M A;  1FS9 A;  4IV6 A;  2PG0 A;  2Q8H A;  3MPI A;  3TZ4 A;  2BU5 A;  3MPJ A;  3UU9 A;  3SWO A;  3D1I A;  1W07 A;  2CJ6 A;  4MP2 A;  3D9E A;  2XQR B;  1XFZ A;  4DZY A;  2VIG A;  2R05 A;  4L1F A;  4KSF A;  3X0Y A;  2OR0 A;  4P13 A;  1SIQ A;  3X29 A;  4Q5C A;  1RJ4 A;  2VR0 A;  3C2P A;  1EGD A;  1EGC A;  1UKW A;  5M4M A;  4AI6 A;  4H81 A;  4AKG A;  2LFW A;  1R3B A;  1WS9 A;  1Y8N A;  2F6L A;  1QDB A;  2C0U A;  4IRN A;  2RF7 A;  2OEV A;  2R0N A;  1XFX A;  3OWM A;  4F0X A;  4U83 A;  4HR3 A;  3L1T A;  2QR4 A;  2BU2 A;  4AKI A;  2IX6 A;  4XVX A;  1RX0 A;  5J71 A;  1T9G A;  4KS9 A;  5M4K A;  4O5M A;  3C3L A;  2CJ8 A;  4MPC A;  1LVC A;  2BU6 A;  3TTB A;  3C46 A;  3SF6 A;  2Q8I A;  3TOR A;  3F29 A;  3MMO A;  4MPN A;  4NXL A;  5B5W A;  2UXW A;  1IS2 A;  1SIR A;  2YYI A;  3FO3 A;  4Q1O A;  4Q4U A;  1IVH A;  1Y0V A;  1XFV A;  3SXQ A;  4Q0T A;  2JIF A;  2ZO5 A;  5B5V A;  3EON A;  2YGW A;  2IX5 A;  1GKX A;  1RJ1 A;  2E81 A;  3AFF A;  4FF4 A;  3AFE A;  2PNR A;  2Z1Q A;  3GNC A;  3BNJ A;  3LG1 A;  4FF1 A;  3II9 A;  1K93 A;  2FP1 A;  4Q5B A;  1GJV A;  1Y8O A;  2EBH X;  4ZXV A;  2REH A;  4LQS B;  2Q8F A;  4FF3 A;  4WJY A;  3VKG A;  4FF2 A;  3D9G A;  3EOM A;  3UBR A;  3SCE A;  3BNH A;  1JM6 A;  3OWA A;  4H7Q A;  4OO2 A;  4E01 A;  3GQT A;  3Q0A A;  1OAH A;  3X0X A;  1GU6 A;  2DVL A;  1XFW A;  2FON A;  4L3Y A;  2VF1 A;  2E80 A;  4KCF A;  2R03 A;  5GJW E;  2BTZ A;  4V26 A;  1FS7 A;  2ZKJ A;  1GKZ A;  2EBF X;  2GBB A;  2JBR A;  2R02 A;  4W9U A;  5K3J A;  5K3G A;  2AO2 A;  2XS1 A;  5M4N A;  2YYJ A;  2OJQ A;  2YYG A;  4E00 A;  4DOY A;  2D29 A;  4QIC A;  1EGE A;  1XG2 B;  2RFQ A;  4JIO A;  3TZ5 A;  3VKH A;  4J1V A;  2EC5 A;  2OT4 A;  4X28 A;  3TZ0 A;  2YYK A;  3D6B A;  1X90 A;  2CJ7 A;  2EBA A;  4JIZ A;  2J7A A;  3RKH A;  4E02 A;  2E0A A;  3B96 A;  4H85 A;  4HKS A;  3Q22 A;  2PO4 A;  3P4T A;  3FCJ A;  3D9F A;  3GM6 A;  5BRM A;  3TZ2 A;  2A1T A; 
#chains in the Genus database with same CATH homology
 1X8Z A;  1X90 A;  2CJ7 A;  2CJ8 A;  2CJ4 A;  1RJ4 A;  1XG2 B;  2CJ5 A;  1RJ1 A;  2CJ6 A;  1X91 A;  2XQR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...