2CJ4A

Crystal structure of a cell wall invertase inhibitor from tobacco at ph 4.6
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
147
structure length
147
Chain Sequence
NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Inhibitor
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
total genus 62
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj4A00
1RJ4A 1XG2B 1X8ZA 2CJ4A 1X90A 2CJ8A 2CJ5A 1RJ1A 2CJ6A 2XQRB 1X91A 2CJ7A
chains in the Genus database with same CATH superfamily
1UDYA 3L1TA 3OWMA 4P79A 2Q8GA 2JIFA 4G5EA 2JBTA 4V25A 1EGEA 2BU8A 1QDBA 3KMLA 4NXLA 4AKIA 5B5VA 3D9EA 4G97A 4M9AA 4AKGA 4AI6A 4Q17A 4L3YA 5BRKA 4Q1OA 3D9GA 4Q5BA 2XS8A 3Q24A 2EBAA 2YGWA 2YYMA 4KSFA 4LQQB 3TZ2A 4RM7A 1PK0A 1JQIA 1Y8OA 2F6LA 2C12A 2EC5A 4L3ZA 4F0XA 2PG0A 3OIBA 2R03A 3CRKA 2OEXA 2VIGA 4DOYA 2UXWA 1BUCA 3Q22A 2R0NA 3GNCA 3VKGA 3AFEA 3MPIA 1EGCA 2FP2A 2AO2A 2R05A 2R0MA 4JIOA 3GM6A 2FONA 3SF6A 2YYGA 3D9DA 1GU6A 2ZKJA 3LGQA 2C0UA 5BRMA 3TORA 1U8VA 5K3GA 2JBRA 4E02A 3OWAA 2DDHA 4L1FA 5B5WA 3C46A 1K90A 1JM6A 2R02A 4LQSB 4ZYJA 4KS9A 1XFWA 3N0RA 2YYLA 5J71A 1R3BA 2XQRB 4FF2A 5M4MA 1OAHA 2PO4A 3D2RA 4MPEA 4Q0TA 3D6BA 5J6AA 3SCEA 3VKHA 3TZ0A 3BNFA 1T9GA 3B96A 4XVXA 2OT4A 2IX6A 2YYIA 2IX5A 4N5FA 3TTBA 4E01A 4KCFA 5GJVE 1UKWA 2FP1A 4H7QA 2E0AA 3HWCA 3TZ4A 2WBIA 3X29A 3P4TA 4FF1A 2ZDYA 1X90A 4X28A 5M4KA 4DZYA 3SWOA 2QR4A 2PNRA 2EBFX 2Q8IA 3D1IA 2HJNA 1SIRA 2EBHX 2VR0A 3MPJA 2Q8FA 3VADA 3C3LA 4IV6A 3RKHA 1Y8PA 3Q0AA 2BTZA 1GKXA 1FS9A 3FO3A 4MP2A 2DVLA 2XS1A 3S7WA 1Y8NA 2BU5A 4ZXVA 2REHA 3F29A 2E81A 2BU2A 1IVHA 1EGDA 2CJ4A 2D29A 2ZO5A 4JEKA 4QICA 5K3JA 4L38A 2CJ7A 4JIZA 2BU6A 3PFDA 2LFWA 4KTOA 1X8ZA 4AKHA 5K3HA 2BU7A 3GQTA 2A1TA 4J1VA 2CX9A 3BNHA 4E00A 1XFUA 1PI1A 1Y0VA 4L3XA 4W9UA 1FS7A 1WS9A 1SIQA 4V26A 4X28C 3NF4A 4U83A 2GBBA 1XFVA 2CJ6A 2ZDXA 4WJYA 3R7KA 1GJVA 1XG2B 1XFZA 3FCJA 3UBRA 2CJ8A 4H81A 5B6BA 2OR0A 3UU9A 3LG1A 2Z1QA 3CRLA 3SXQA 1XFYA 1W07A 3CE2A 4H85A 2Q8HA 3BNGA 5M4NA 5GJWE 3MMOA 4MPCA 3BNJA 3MDDA 3EOMA 2RFQA 1R2JA 4HKSA 3X0YA 5K3IA 1RX0A 4KSAA 2OEVA 1SK6A 1S26A 2RF7A 3AFFA 1LVCA 3II9A 3TZ5A 3C2PA 5M4PA 3MDEA 1RJ1A 4OO2A 4Q5CA 3Q23A 2E80A 1IS2A 1SC5A 3EONA 1K93A 1RJ4A 3MKHA 2ZAFA 4HKRA 4IRNA 4P13A 2OJQA 4FF3A 1GKZA 2YYKA 1K8TA 1RP3A 4O5MA 4FZ4A 2RDZA 4MP7A 2AZEA 1X91A 1FS8A 2YYJA 1XFXA 3M9VA 3X0XA 2JBSA 2VF1A 4MPNA 4HR3A 4FF4A 2CJ5A 4Q4UA 3MXLA 3D9FA 2J7AA
chains in the Genus database with same CATH topology
1RJ4A 1XG2B 1X8ZA 2CJ4A 1X90A 2CJ8A 2CJ5A 1RJ1A 2CJ6A 2XQRB 1X91A 2CJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJ4 A;  1XG2 B;  1X8Z A;  2CJ4 A;  1X90 A;  2CJ8 A;  2CJ5 A;  1RJ1 A;  2CJ6 A;  2XQR B;  1X91 A;  2CJ7 A; 
#chains in the Genus database with same CATH topology
 1UDY A;  3L1T A;  3OWM A;  4P79 A;  2Q8G A;  2JIF A;  4G5E A;  2JBT A;  4V25 A;  1EGE A;  2BU8 A;  1QDB A;  3KML A;  4NXL A;  4AKI A;  5B5V A;  3D9E A;  4G97 A;  4M9A A;  4AKG A;  4AI6 A;  4Q17 A;  4L3Y A;  5BRK A;  4Q1O A;  3D9G A;  4Q5B A;  2XS8 A;  3Q24 A;  2EBA A;  2YGW A;  2YYM A;  4KSF A;  4LQQ B;  3TZ2 A;  4RM7 A;  1PK0 A;  1JQI A;  1Y8O A;  2F6L A;  2C12 A;  2EC5 A;  4L3Z A;  4F0X A;  2PG0 A;  3OIB A;  2R03 A;  3CRK A;  2OEX A;  2VIG A;  4DOY A;  2UXW A;  1BUC A;  3Q22 A;  2R0N A;  3GNC A;  3VKG A;  3AFE A;  3MPI A;  1EGC A;  2FP2 A;  2AO2 A;  2R05 A;  2R0M A;  4JIO A;  3GM6 A;  2FON A;  3SF6 A;  2YYG A;  3D9D A;  1GU6 A;  2ZKJ A;  3LGQ A;  2C0U A;  5BRM A;  3TOR A;  1U8V A;  5K3G A;  2JBR A;  4E02 A;  3OWA A;  2DDH A;  4L1F A;  5B5W A;  3C46 A;  1K90 A;  1JM6 A;  2R02 A;  4LQS B;  4ZYJ A;  4KS9 A;  1XFW A;  3N0R A;  2YYL A;  5J71 A;  1R3B A;  2XQR B;  4FF2 A;  5M4M A;  1OAH A;  2PO4 A;  3D2R A;  4MPE A;  4Q0T A;  3D6B A;  5J6A A;  3SCE A;  3VKH A;  3TZ0 A;  3BNF A;  1T9G A;  3B96 A;  4XVX A;  2OT4 A;  2IX6 A;  2YYI A;  2IX5 A;  4N5F A;  3TTB A;  4E01 A;  4KCF A;  5GJV E;  1UKW A;  2FP1 A;  4H7Q A;  2E0A A;  3HWC A;  3TZ4 A;  2WBI A;  3X29 A;  3P4T A;  4FF1 A;  2ZDY A;  1X90 A;  4X28 A;  5M4K A;  4DZY A;  3SWO A;  2QR4 A;  2PNR A;  2EBF X;  2Q8I A;  3D1I A;  2HJN A;  1SIR A;  2EBH X;  2VR0 A;  3MPJ A;  2Q8F A;  3VAD A;  3C3L A;  4IV6 A;  3RKH A;  1Y8P A;  3Q0A A;  2BTZ A;  1GKX A;  1FS9 A;  3FO3 A;  4MP2 A;  2DVL A;  2XS1 A;  3S7W A;  1Y8N A;  2BU5 A;  4ZXV A;  2REH A;  3F29 A;  2E81 A;  2BU2 A;  1IVH A;  1EGD A;  2CJ4 A;  2D29 A;  2ZO5 A;  4JEK A;  4QIC A;  5K3J A;  4L38 A;  2CJ7 A;  4JIZ A;  2BU6 A;  3PFD A;  2LFW A;  4KTO A;  1X8Z A;  4AKH A;  5K3H A;  2BU7 A;  3GQT A;  2A1T A;  4J1V A;  2CX9 A;  3BNH A;  4E00 A;  1XFU A;  1PI1 A;  1Y0V A;  4L3X A;  4W9U A;  1FS7 A;  1WS9 A;  1SIQ A;  4V26 A;  4X28 C;  3NF4 A;  4U83 A;  2GBB A;  1XFV A;  2CJ6 A;  2ZDX A;  4WJY A;  3R7K A;  1GJV A;  1XG2 B;  1XFZ A;  3FCJ A;  3UBR A;  2CJ8 A;  4H81 A;  5B6B A;  2OR0 A;  3UU9 A;  3LG1 A;  2Z1Q A;  3CRL A;  3SXQ A;  1XFY A;  1W07 A;  3CE2 A;  4H85 A;  2Q8H A;  3BNG A;  5M4N A;  5GJW E;  3MMO A;  4MPC A;  3BNJ A;  3MDD A;  3EOM A;  2RFQ A;  1R2J A;  4HKS A;  3X0Y A;  5K3I A;  1RX0 A;  4KSA A;  2OEV A;  1SK6 A;  1S26 A;  2RF7 A;  3AFF A;  1LVC A;  3II9 A;  3TZ5 A;  3C2P A;  5M4P A;  3MDE A;  1RJ1 A;  4OO2 A;  4Q5C A;  3Q23 A;  2E80 A;  1IS2 A;  1SC5 A;  3EON A;  1K93 A;  1RJ4 A;  3MKH A;  2ZAF A;  4HKR A;  4IRN A;  4P13 A;  2OJQ A;  4FF3 A;  1GKZ A;  2YYK A;  1K8T A;  1RP3 A;  4O5M A;  4FZ4 A;  2RDZ A;  4MP7 A;  2AZE A;  1X91 A;  1FS8 A;  2YYJ A;  1XFX A;  3M9V A;  3X0X A;  2JBS A;  2VF1 A;  4MPN A;  4HR3 A;  4FF4 A;  2CJ5 A;  4Q4U A;  3MXL A;  3D9F A;  2J7A A; 
#chains in the Genus database with same CATH homology
 1RJ4 A;  1XG2 B;  1X8Z A;  2CJ4 A;  1X90 A;  2CJ8 A;  2CJ5 A;  1RJ1 A;  2CJ6 A;  2XQR B;  1X91 A;  2CJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...