2CJ4A

Crystal structure of a cell wall invertase inhibitor from tobacco at ph 4.6
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
147
structure length
147
Chain Sequence
NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Inhibitor
total genus 62
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj4A00
1X8ZA 2CJ5A 2CJ8A 1X91A 2XQRB 1X90A 1XG2B 1RJ1A 2CJ4A 2CJ6A 1RJ4A 2CJ7A
chains in the Genus database with same CATH superfamily
4DZYA 2CJ5A 4L3XA 1LVCA 4LQQB 3BNGA 2RF7A 1OAHA 4MPCA 4KS9A 1XFWA 2BU8A 3MKHA 2RFQA 3D9DA 2PNRA 2E81A 2EBAA 3BNFA 4JIOA 4Q0TA 4RM7A 2XQRB 3Q0AA 3BNHA 4P79A 3MDEA 2IX5A 2D29A 4L3YA 5J6AA 2YYMA 3VKGA 4F0XA 2EBHX 3SF6A 2BTZA 3TZ0A 2YGWA 3D9GA 4G5EA 3LGQA 4JEKA 4M9AA 3MXLA 3D1IA 3OWMA 2RDZA 1R3BA 2YYGA 3EOMA 1GKXA 2YYKA 2C12A 3N0RA 3UBRA 2VF1A 3R7KA 3TORA 3TZ2A 4E01A 3Q24A 2FONA 1SIRA 1XFXA 4HKSA 1XFYA 3CE2A 1WS9A 3MPIA 4J1VA 4L38A 2BU2A 3Q23A 4IV6A 1UKWA 2ZDYA 2Q8GA 2JBSA 5K3GA 4G97A 2OT4A 3M9VA 1RJ4A 3AFEA 2E80A 2FP2A 4WJYA 2AZEA 2QR4A 2XS1A 4P13A 4H85A 1XG2B 4X28A 2CJ4A 2EC5A 2ZO5A 2YYIA 4JIZA 4NXLA 4ZXVA 5K3HA 1BUCA 4L3ZA 3KMLA 3NF4A 3PFDA 3Q22A 3B96A 5BRMA 4AKHA 3FO3A 1EGDA 4MPEA 2ZAFA 1X91A 3MPJA 1RP3A 3RKHA 4FF2A 2JBTA 1S26A 2Q8IA 1XFVA 3TZ5A 3P4TA 3X0XA 2OEXA 4MP7A 4MP2A 1GU6A 1EGEA 1GJVA 2FP1A 4Q5BA 4XVXA 1R2JA 3MMOA 4HR3A 4AKGA 1GKZA 1FS8A 4V25A 3II9A 3FCJA 3D9FA 1QDBA 4O5MA 4U83A 1FS7A 5B5VA 5K3JA 3SWOA 3X29A 1RJ1A 4E00A 1K90A 3CRLA 3TZ4A 4AI6A 2PO4A 5K3IA 5GJWE 1EGCA 1K93A 2JBRA 4H81A 3VADA 1UDYA 2Q8FA 1XFZA 2C0UA 2JIFA 4KTOA 3C46A 3L1TA 3X0YA 4N5FA 1FS9A 4W9UA 3SCEA 1SC5A 1Y8OA 3SXQA 3D9EA 3GQTA 4L1FA 1JM6A 3MDDA 3OIBA 5M4MA 4FF1A 3D2RA 4KCFA 2J7AA 2XS8A 2Z1QA 1Y8PA 2DDHA 3S7WA 4Q17A 2VIGA 3C2PA 1W07A 3UU9A 4LQSB 1Y0VA 3GNCA 2OR0A 4KSFA 2Q8HA 5BRKA 2CJ6A 2YYJA 2VR0A 3HWCA 3CRKA 4HKRA 2E0AA 2OJQA 3F29A 4OO2A 4V26A 2EBFX 1SK6A 2R02A 1T9GA 2WBIA 4Q1OA 4Q4UA 5B6BA 1U8VA 5M4PA 4E02A 3EONA 1K8TA 2HJNA 4MPNA 4H7QA 3LG1A 2UXWA 2AO2A 5M4KA 4ZYJA 1SIQA 1IVHA 2BU7A 3GM6A 2OEVA 2F6LA 4IRNA 2CJ7A 5M4NA 2IX6A 1IS2A 1PI1A 1Y8NA 1X90A 2CX9A 2BU6A 2REHA 4Q5CA 3TTBA 5J71A 2DVLA 4FF4A 4AKIA 4KSAA 1XFUA 1X8ZA 2R0NA 3D6BA 4FZ4A 4X28C 2CJ8A 2R05A 2GBBA 5GJVE 3C3LA 5B5WA 2ZKJA 3VKHA 3OWAA 1RX0A 3AFFA 1JQIA 2R03A 2R0MA 2LFWA 3BNJA 1PK0A 2BU5A 4QICA 2YYLA 2A1TA 2PG0A 4FF3A 2ZDXA 4DOYA
chains in the Genus database with same CATH topology
1X8ZA 2CJ5A 2CJ8A 1X91A 2XQRB 1X90A 1XG2B 1RJ1A 2CJ4A 2CJ6A 1RJ4A 2CJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Z A;  2CJ5 A;  2CJ8 A;  1X91 A;  2XQR B;  1X90 A;  1XG2 B;  1RJ1 A;  2CJ4 A;  2CJ6 A;  1RJ4 A;  2CJ7 A; 
#chains in the Genus database with same CATH topology
 4DZY A;  2CJ5 A;  4L3X A;  1LVC A;  4LQQ B;  3BNG A;  2RF7 A;  1OAH A;  4MPC A;  4KS9 A;  1XFW A;  2BU8 A;  3MKH A;  2RFQ A;  3D9D A;  2PNR A;  2E81 A;  2EBA A;  3BNF A;  4JIO A;  4Q0T A;  4RM7 A;  2XQR B;  3Q0A A;  3BNH A;  4P79 A;  3MDE A;  2IX5 A;  2D29 A;  4L3Y A;  5J6A A;  2YYM A;  3VKG A;  4F0X A;  2EBH X;  3SF6 A;  2BTZ A;  3TZ0 A;  2YGW A;  3D9G A;  4G5E A;  3LGQ A;  4JEK A;  4M9A A;  3MXL A;  3D1I A;  3OWM A;  2RDZ A;  1R3B A;  2YYG A;  3EOM A;  1GKX A;  2YYK A;  2C12 A;  3N0R A;  3UBR A;  2VF1 A;  3R7K A;  3TOR A;  3TZ2 A;  4E01 A;  3Q24 A;  2FON A;  1SIR A;  1XFX A;  4HKS A;  1XFY A;  3CE2 A;  1WS9 A;  3MPI A;  4J1V A;  4L38 A;  2BU2 A;  3Q23 A;  4IV6 A;  1UKW A;  2ZDY A;  2Q8G A;  2JBS A;  5K3G A;  4G97 A;  2OT4 A;  3M9V A;  1RJ4 A;  3AFE A;  2E80 A;  2FP2 A;  4WJY A;  2AZE A;  2QR4 A;  2XS1 A;  4P13 A;  4H85 A;  1XG2 B;  4X28 A;  2CJ4 A;  2EC5 A;  2ZO5 A;  2YYI A;  4JIZ A;  4NXL A;  4ZXV A;  5K3H A;  1BUC A;  4L3Z A;  3KML A;  3NF4 A;  3PFD A;  3Q22 A;  3B96 A;  5BRM A;  4AKH A;  3FO3 A;  1EGD A;  4MPE A;  2ZAF A;  1X91 A;  3MPJ A;  1RP3 A;  3RKH A;  4FF2 A;  2JBT A;  1S26 A;  2Q8I A;  1XFV A;  3TZ5 A;  3P4T A;  3X0X A;  2OEX A;  4MP7 A;  4MP2 A;  1GU6 A;  1EGE A;  1GJV A;  2FP1 A;  4Q5B A;  4XVX A;  1R2J A;  3MMO A;  4HR3 A;  4AKG A;  1GKZ A;  1FS8 A;  4V25 A;  3II9 A;  3FCJ A;  3D9F A;  1QDB A;  4O5M A;  4U83 A;  1FS7 A;  5B5V A;  5K3J A;  3SWO A;  3X29 A;  1RJ1 A;  4E00 A;  1K90 A;  3CRL A;  3TZ4 A;  4AI6 A;  2PO4 A;  5K3I A;  5GJW E;  1EGC A;  1K93 A;  2JBR A;  4H81 A;  3VAD A;  1UDY A;  2Q8F A;  1XFZ A;  2C0U A;  2JIF A;  4KTO A;  3C46 A;  3L1T A;  3X0Y A;  4N5F A;  1FS9 A;  4W9U A;  3SCE A;  1SC5 A;  1Y8O A;  3SXQ A;  3D9E A;  3GQT A;  4L1F A;  1JM6 A;  3MDD A;  3OIB A;  5M4M A;  4FF1 A;  3D2R A;  4KCF A;  2J7A A;  2XS8 A;  2Z1Q A;  1Y8P A;  2DDH A;  3S7W A;  4Q17 A;  2VIG A;  3C2P A;  1W07 A;  3UU9 A;  4LQS B;  1Y0V A;  3GNC A;  2OR0 A;  4KSF A;  2Q8H A;  5BRK A;  2CJ6 A;  2YYJ A;  2VR0 A;  3HWC A;  3CRK A;  4HKR A;  2E0A A;  2OJQ A;  3F29 A;  4OO2 A;  4V26 A;  2EBF X;  1SK6 A;  2R02 A;  1T9G A;  2WBI A;  4Q1O A;  4Q4U A;  5B6B A;  1U8V A;  5M4P A;  4E02 A;  3EON A;  1K8T A;  2HJN A;  4MPN A;  4H7Q A;  3LG1 A;  2UXW A;  2AO2 A;  5M4K A;  4ZYJ A;  1SIQ A;  1IVH A;  2BU7 A;  3GM6 A;  2OEV A;  2F6L A;  4IRN A;  2CJ7 A;  5M4N A;  2IX6 A;  1IS2 A;  1PI1 A;  1Y8N A;  1X90 A;  2CX9 A;  2BU6 A;  2REH A;  4Q5C A;  3TTB A;  5J71 A;  2DVL A;  4FF4 A;  4AKI A;  4KSA A;  1XFU A;  1X8Z A;  2R0N A;  3D6B A;  4FZ4 A;  4X28 C;  2CJ8 A;  2R05 A;  2GBB A;  5GJV E;  3C3L A;  5B5W A;  2ZKJ A;  3VKH A;  3OWA A;  1RX0 A;  3AFF A;  1JQI A;  2R03 A;  2R0M A;  2LFW A;  3BNJ A;  1PK0 A;  2BU5 A;  4QIC A;  2YYL A;  2A1T A;  2PG0 A;  4FF3 A;  2ZDX A;  4DOY A; 
#chains in the Genus database with same CATH homology
 1X8Z A;  2CJ5 A;  2CJ8 A;  1X91 A;  2XQR B;  1X90 A;  1XG2 B;  1RJ1 A;  2CJ4 A;  2CJ6 A;  1RJ4 A;  2CJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...