4LQQB

Crystal structure of the cbk1(t743e)-mob2 kinase-coactivator complex in crystal form b
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
179
structure length
146
Chain Sequence
FVRTALVKGSFKTIVQLPKYVDLGEWIALNVFEFFTNLNQFYGVVAEYVIDLALTWINNKVNDKNLFPTKNGLPFPQQFSRDVQRIMVQMFRIFAHIYHHHFDKIVHLSLEAHWNSFFSHFISFAKEFKIIDRKEMAPLLPLIESF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase CBK1
publication title The Structure of an NDR/LATS Kinase-Mob Complex Reveals a Novel Kinase-Coactivator System and Substrate Docking Mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transferase activator
total genus 33
structure length 146
sequence length 179
chains with identical sequence E
ec nomenclature
pdb deposition date 2013-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 4lqqB00
1PI1A 4J1VA 5BRMA 5B6BA 1R3BA 5B5WA 4LQSB 5B5VA 4JIZA 5BRKA 2HJNA 4LQQB
chains in the Genus database with same CATH superfamily
3D2RA 4OO2A 2CX9A 2C12A 3BNJA 2ZO5A 3BNHA 1R3BA 3RKHA 4L3YA 2XS8A 4XVXA 3Q23A 5B5VA 1IVHA 2Q8GA 1X8ZA 1RJ4A 3KMLA 4M9AA 1EGEA 3FO3A 5M4NA 1T9GA 4KSFA 4X28A 4KTOA 3TZ2A 4LQSB 1JM6A 1OAHA 1UKWA 3EONA 3TZ0A 3L1TA 3MMOA 4FF3A 2BU5A 5GJWE 1RX0A 3MXLA 3FCJA 3N0RA 4E02A 1XFUA 3PFDA 3TORA 3OIBA 3SCEA 1XFZA 3GQTA 4U83A 3B96A 1X91A 1Y8NA 2D29A 3CE2A 4FF4A 2A1TA 4W9UA 3MPIA 3Q24A 3C2PA 2R02A 1PK0A 2BTZA 4MP7A 2DVLA 2BU6A 4IRNA 2C0UA 1GKXA 3LG1A 3VADA 2ZDYA 5M4PA 3TZ4A 1RJ1A 1RP3A 4P79A 1S26A 1GU6A 2OT4A 5K3JA 1XFWA 1X90A 1XFXA 2CJ6A 4RM7A 3P4TA 1GJVA 4H85A 3UU9A 3CRKA 4V25A 3MDEA 2YYKA 2PG0A 4E00A 4FF1A 1XG2B 2BU8A 4AKHA 4G97A 3BNFA 3Q0AA 3GM6A 2XQRB 2OEXA 2R03A 2JBRA 2BU7A 3SXQA 4DZYA 4IV6A 2LFWA 4E01A 4FZ4A 1U8VA 2YYJA 3MPJA 4F0XA 1LVCA 3MDDA 3AFFA 4ZYJA 2VIGA 4QICA 5J6AA 5J71A 3AFEA 4Q17A 3TTBA 1FS8A 2PO4A 4J1VA 1EGCA 2EBHX 2Z1QA 4G5EA 4JIOA 2E81A 1Y8OA 2VR0A 2WBIA 2OJQA 4X28C 3HWCA 1GKZA 3OWAA 2YYGA 1EGDA 3X0XA 4KCFA 1Y8PA 4H81A 2EC5A 4Q0TA 1SC5A 3D6BA 4L1FA 3D9EA 1FS7A 3D1IA 4L3XA 2JBSA 2HJNA 2CJ7A 2FONA 2R0NA 4N5FA 4L38A 4Q1OA 2VF1A 3SWOA 1BUCA 5K3IA 4JEKA 3EOMA 2FP1A 1W07A 4MPEA 2DDHA 5K3GA 4AKIA 1SK6A 4O5MA 4V26A 4NXLA 2JIFA 1UDYA 4H7QA 2JBTA 4ZXVA 2RFQA 3C46A 2QR4A 4AKGA 3M9VA 3VKGA 4JIZA 5BRKA 4MPCA 2R05A 3X29A 2YYMA 3CRLA 3D9FA 4MPNA 3OWMA 3LGQA 1K90A 4Q5CA 5BRMA 2FP2A 2Q8FA 2IX6A 1IS2A 1XFVA 2RDZA 3TZ5A 3X0YA 5K3HA 4HKSA 1XFYA 4KS9A 2IX5A 1QDBA 2REHA 4P13A 3UBRA 5B5WA 1SIRA 4MP2A 3D9GA 4LQQB 5M4MA 2ZDXA 2ZKJA 2F6LA 1FS9A 2XS1A 2YGWA 2AO2A 4HR3A 2EBFX 1K8TA 2ZAFA 4WJYA 3BNGA 3SF6A 5M4KA 2OR0A 2YYLA 2EBAA 4HKRA 2E0AA 3NF4A 4AI6A 4Q4UA 3C3LA 2Q8IA 5GJVE 1SIQA 1PI1A 1JQIA 2CJ5A 2CJ4A 2UXWA 3MKHA 4Q5BA 5B6BA 4KSAA 2Q8HA 2RF7A 4DOYA 2OEVA 3R7KA 4FF2A 1K93A 3II9A 2J7AA 2BU2A 3F29A 2R0MA 1R2JA 1WS9A 2CJ8A 3Q22A 1Y0VA 2E80A 4L3ZA 3D9DA 2AZEA 2YYIA 2PNRA 3GNCA 3S7WA 2GBBA 3VKHA
chains in the Genus database with same CATH topology
1PI1A 4J1VA 5BRMA 5B6BA 1R3BA 5B5WA 4LQSB 5B5VA 4JIZA 5BRKA 2HJNA 4LQQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI1 A;  4J1V A;  5BRM A;  5B6B A;  1R3B A;  5B5W A;  4LQS B;  5B5V A;  4JIZ A;  5BRK A;  2HJN A;  4LQQ B; 
#chains in the Genus database with same CATH topology
 3D2R A;  4OO2 A;  2CX9 A;  2C12 A;  3BNJ A;  2ZO5 A;  3BNH A;  1R3B A;  3RKH A;  4L3Y A;  2XS8 A;  4XVX A;  3Q23 A;  5B5V A;  1IVH A;  2Q8G A;  1X8Z A;  1RJ4 A;  3KML A;  4M9A A;  1EGE A;  3FO3 A;  5M4N A;  1T9G A;  4KSF A;  4X28 A;  4KTO A;  3TZ2 A;  4LQS B;  1JM6 A;  1OAH A;  1UKW A;  3EON A;  3TZ0 A;  3L1T A;  3MMO A;  4FF3 A;  2BU5 A;  5GJW E;  1RX0 A;  3MXL A;  3FCJ A;  3N0R A;  4E02 A;  1XFU A;  3PFD A;  3TOR A;  3OIB A;  3SCE A;  1XFZ A;  3GQT A;  4U83 A;  3B96 A;  1X91 A;  1Y8N A;  2D29 A;  3CE2 A;  4FF4 A;  2A1T A;  4W9U A;  3MPI A;  3Q24 A;  3C2P A;  2R02 A;  1PK0 A;  2BTZ A;  4MP7 A;  2DVL A;  2BU6 A;  4IRN A;  2C0U A;  1GKX A;  3LG1 A;  3VAD A;  2ZDY A;  5M4P A;  3TZ4 A;  1RJ1 A;  1RP3 A;  4P79 A;  1S26 A;  1GU6 A;  2OT4 A;  5K3J A;  1XFW A;  1X90 A;  1XFX A;  2CJ6 A;  4RM7 A;  3P4T A;  1GJV A;  4H85 A;  3UU9 A;  3CRK A;  4V25 A;  3MDE A;  2YYK A;  2PG0 A;  4E00 A;  4FF1 A;  1XG2 B;  2BU8 A;  4AKH A;  4G97 A;  3BNF A;  3Q0A A;  3GM6 A;  2XQR B;  2OEX A;  2R03 A;  2JBR A;  2BU7 A;  3SXQ A;  4DZY A;  4IV6 A;  2LFW A;  4E01 A;  4FZ4 A;  1U8V A;  2YYJ A;  3MPJ A;  4F0X A;  1LVC A;  3MDD A;  3AFF A;  4ZYJ A;  2VIG A;  4QIC A;  5J6A A;  5J71 A;  3AFE A;  4Q17 A;  3TTB A;  1FS8 A;  2PO4 A;  4J1V A;  1EGC A;  2EBH X;  2Z1Q A;  4G5E A;  4JIO A;  2E81 A;  1Y8O A;  2VR0 A;  2WBI A;  2OJQ A;  4X28 C;  3HWC A;  1GKZ A;  3OWA A;  2YYG A;  1EGD A;  3X0X A;  4KCF A;  1Y8P A;  4H81 A;  2EC5 A;  4Q0T A;  1SC5 A;  3D6B A;  4L1F A;  3D9E A;  1FS7 A;  3D1I A;  4L3X A;  2JBS A;  2HJN A;  2CJ7 A;  2FON A;  2R0N A;  4N5F A;  4L38 A;  4Q1O A;  2VF1 A;  3SWO A;  1BUC A;  5K3I A;  4JEK A;  3EOM A;  2FP1 A;  1W07 A;  4MPE A;  2DDH A;  5K3G A;  4AKI A;  1SK6 A;  4O5M A;  4V26 A;  4NXL A;  2JIF A;  1UDY A;  4H7Q A;  2JBT A;  4ZXV A;  2RFQ A;  3C46 A;  2QR4 A;  4AKG A;  3M9V A;  3VKG A;  4JIZ A;  5BRK A;  4MPC A;  2R05 A;  3X29 A;  2YYM A;  3CRL A;  3D9F A;  4MPN A;  3OWM A;  3LGQ A;  1K90 A;  4Q5C A;  5BRM A;  2FP2 A;  2Q8F A;  2IX6 A;  1IS2 A;  1XFV A;  2RDZ A;  3TZ5 A;  3X0Y A;  5K3H A;  4HKS A;  1XFY A;  4KS9 A;  2IX5 A;  1QDB A;  2REH A;  4P13 A;  3UBR A;  5B5W A;  1SIR A;  4MP2 A;  3D9G A;  4LQQ B;  5M4M A;  2ZDX A;  2ZKJ A;  2F6L A;  1FS9 A;  2XS1 A;  2YGW A;  2AO2 A;  4HR3 A;  2EBF X;  1K8T A;  2ZAF A;  4WJY A;  3BNG A;  3SF6 A;  5M4K A;  2OR0 A;  2YYL A;  2EBA A;  4HKR A;  2E0A A;  3NF4 A;  4AI6 A;  4Q4U A;  3C3L A;  2Q8I A;  5GJV E;  1SIQ A;  1PI1 A;  1JQI A;  2CJ5 A;  2CJ4 A;  2UXW A;  3MKH A;  4Q5B A;  5B6B A;  4KSA A;  2Q8H A;  2RF7 A;  4DOY A;  2OEV A;  3R7K A;  4FF2 A;  1K93 A;  3II9 A;  2J7A A;  2BU2 A;  3F29 A;  2R0M A;  1R2J A;  1WS9 A;  2CJ8 A;  3Q22 A;  1Y0V A;  2E80 A;  4L3Z A;  3D9D A;  2AZE A;  2YYI A;  2PNR A;  3GNC A;  3S7W A;  2GBB A;  3VKH A; 
#chains in the Genus database with same CATH homology
 1PI1 A;  4J1V A;  5BRM A;  5B6B A;  1R3B A;  5B5W A;  4LQS B;  5B5V A;  4JIZ A;  5BRK A;  2HJN A;  4LQQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...