2CJ6A

Crystal structure of a cell wall invertase inhibitor from tobacco (ph 7.5)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell-Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Inhibitor
total genus 61
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj6A00
1X8ZA 1RJ4A 1X91A 2CJ5A 1RJ1A 2CJ7A 2XQRB 2CJ6A 2CJ8A 1X90A 1XG2B 2CJ4A
chains in the Genus database with same CATH superfamily
5GJWE 4H7QA 3GQTA 4ZXVA 1QDBA 2OEVA 4Q17A 1RJ1A 3P4TA 4N5FA 4RM7A 2Q8GA 1SC5A 1Y8OA 2FP2A 4X28A 3X29A 4E00A 5M4MA 3C2PA 1RJ4A 2DDHA 1BUCA 4U83A 2R03A 2BU6A 5M4NA 2EC5A 1XFZA 3C3LA 2QR4A 2C12A 2J7AA 4G5EA 4O5MA 1W07A 4FZ4A 3RKHA 3EONA 2YYJA 5J71A 3D9FA 1SIRA 3FCJA 4J1VA 4P79A 3TTBA 5K3GA 1EGDA 2PNRA 4KSAA 1JM6A 5BRKA 4KTOA 4AKIA 2YYMA 1XG2B 3OWAA 2IX5A 2JBRA 3GM6A 4AKHA 5B5WA 3VKGA 3D9DA 2XQRB 2OEXA 2AZEA 4L38A 1LVCA 2R02A 4X28C 3TZ5A 3Q22A 2XS1A 2R0MA 3TORA 3MMOA 1GU6A 2VR0A 1EGCA 1SIQA 3Q0AA 1R2JA 4H81A 1UDYA 2D29A 2OJQA 2BU7A 3LG1A 2F6LA 1XFYA 2RFQA 3MDEA 3SXQA 1FS7A 4L3YA 1PK0A 4Q5BA 3D2RA 3R7KA 3D6BA 5B6BA 2Q8IA 2AO2A 2CJ4A 2EBFX 1WS9A 4IV6A 4H85A 4L3XA 4LQQB 2DVLA 4XVXA 3VADA 3Q24A 4KCFA 3S7WA 4AI6A 2ZAFA 2BU8A 2XS8A 2ZKJA 4JIOA 3LGQA 2OR0A 2CJ8A 2R0NA 4MPNA 5K3HA 5M4KA 2IX6A 2RF7A 3CRKA 1OAHA 4MPEA 5M4PA 4KSFA 2E0AA 2PG0A 2GBBA 3SF6A 1IVHA 1S26A 1XFUA 2ZDXA 3X0XA 3CRLA 5BRMA 3TZ4A 3BNFA 1K93A 2BU2A 4V26A 4FF1A 4L3ZA 4AKGA 2CX9A 2E81A 3MPIA 3CE2A 4G97A 4F0XA 3MDDA 3MXLA 4JIZA 3D9EA 3OIBA 1K8TA 3AFFA 1T9GA 3KMLA 2JBTA 1GJVA 4QICA 1K90A 1XFWA 2ZDYA 4HR3A 3TZ2A 2C0UA 1EGEA 4WJYA 4FF2A 2CJ5A 3F29A 3SCEA 4IRNA 1Y8NA 4HKSA 1RX0A 3MPJA 4NXLA 4FF3A 3UU9A 4E01A 2YYKA 5K3JA 2UXWA 1Y8PA 2CJ7A 2RDZA 2YYLA 4M9AA 4Q4UA 2WBIA 3HWCA 3OWMA 1SK6A 3UBRA 1GKZA 2Z1QA 4OO2A 4W9UA 2BU5A 2HJNA 2PO4A 2LFWA 2VF1A 3AFEA 3D9GA 3C46A 2BTZA 4LQSB 2YYGA 1X8ZA 3D1IA 4V25A 2YGWA 3BNHA 3B96A 2Q8FA 1FS8A 2YYIA 5GJVE 3Q23A 2CJ6A 2REHA 2EBAA 1IS2A 1XFVA 3SWOA 2FP1A 2ZO5A 2E80A 1PI1A 1R3BA 2JIFA 1U8VA 5J6AA 4MP2A 2Q8HA 3GNCA 4Q5CA 3X0YA 4DOYA 1FS9A 4E02A 1XFXA 5K3IA 3BNGA 4HKRA 1RP3A 1UKWA 4FF4A 4MP7A 1X91A 3FO3A 4ZYJA 1Y0VA 3TZ0A 3N0RA 2FONA 3MKHA 4L1FA 4Q1OA 3EOMA 1JQIA 2R05A 4JEKA 4P13A 2EBHX 2A1TA 3L1TA 4KS9A 4Q0TA 5B5VA 4DZYA 4MPCA 2OT4A 2JBSA 3II9A 1GKXA 2VIGA 3PFDA 3VKHA 3BNJA 1X90A 3M9VA 3NF4A
chains in the Genus database with same CATH topology
1X8ZA 1RJ4A 1X91A 2CJ5A 1RJ1A 2CJ7A 2XQRB 2CJ6A 2CJ8A 1X90A 1XG2B 2CJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Z A;  1RJ4 A;  1X91 A;  2CJ5 A;  1RJ1 A;  2CJ7 A;  2XQR B;  2CJ6 A;  2CJ8 A;  1X90 A;  1XG2 B;  2CJ4 A; 
#chains in the Genus database with same CATH topology
 5GJW E;  4H7Q A;  3GQT A;  4ZXV A;  1QDB A;  2OEV A;  4Q17 A;  1RJ1 A;  3P4T A;  4N5F A;  4RM7 A;  2Q8G A;  1SC5 A;  1Y8O A;  2FP2 A;  4X28 A;  3X29 A;  4E00 A;  5M4M A;  3C2P A;  1RJ4 A;  2DDH A;  1BUC A;  4U83 A;  2R03 A;  2BU6 A;  5M4N A;  2EC5 A;  1XFZ A;  3C3L A;  2QR4 A;  2C12 A;  2J7A A;  4G5E A;  4O5M A;  1W07 A;  4FZ4 A;  3RKH A;  3EON A;  2YYJ A;  5J71 A;  3D9F A;  1SIR A;  3FCJ A;  4J1V A;  4P79 A;  3TTB A;  5K3G A;  1EGD A;  2PNR A;  4KSA A;  1JM6 A;  5BRK A;  4KTO A;  4AKI A;  2YYM A;  1XG2 B;  3OWA A;  2IX5 A;  2JBR A;  3GM6 A;  4AKH A;  5B5W A;  3VKG A;  3D9D A;  2XQR B;  2OEX A;  2AZE A;  4L38 A;  1LVC A;  2R02 A;  4X28 C;  3TZ5 A;  3Q22 A;  2XS1 A;  2R0M A;  3TOR A;  3MMO A;  1GU6 A;  2VR0 A;  1EGC A;  1SIQ A;  3Q0A A;  1R2J A;  4H81 A;  1UDY A;  2D29 A;  2OJQ A;  2BU7 A;  3LG1 A;  2F6L A;  1XFY A;  2RFQ A;  3MDE A;  3SXQ A;  1FS7 A;  4L3Y A;  1PK0 A;  4Q5B A;  3D2R A;  3R7K A;  3D6B A;  5B6B A;  2Q8I A;  2AO2 A;  2CJ4 A;  2EBF X;  1WS9 A;  4IV6 A;  4H85 A;  4L3X A;  4LQQ B;  2DVL A;  4XVX A;  3VAD A;  3Q24 A;  4KCF A;  3S7W A;  4AI6 A;  2ZAF A;  2BU8 A;  2XS8 A;  2ZKJ A;  4JIO A;  3LGQ A;  2OR0 A;  2CJ8 A;  2R0N A;  4MPN A;  5K3H A;  5M4K A;  2IX6 A;  2RF7 A;  3CRK A;  1OAH A;  4MPE A;  5M4P A;  4KSF A;  2E0A A;  2PG0 A;  2GBB A;  3SF6 A;  1IVH A;  1S26 A;  1XFU A;  2ZDX A;  3X0X A;  3CRL A;  5BRM A;  3TZ4 A;  3BNF A;  1K93 A;  2BU2 A;  4V26 A;  4FF1 A;  4L3Z A;  4AKG A;  2CX9 A;  2E81 A;  3MPI A;  3CE2 A;  4G97 A;  4F0X A;  3MDD A;  3MXL A;  4JIZ A;  3D9E A;  3OIB A;  1K8T A;  3AFF A;  1T9G A;  3KML A;  2JBT A;  1GJV A;  4QIC A;  1K90 A;  1XFW A;  2ZDY A;  4HR3 A;  3TZ2 A;  2C0U A;  1EGE A;  4WJY A;  4FF2 A;  2CJ5 A;  3F29 A;  3SCE A;  4IRN A;  1Y8N A;  4HKS A;  1RX0 A;  3MPJ A;  4NXL A;  4FF3 A;  3UU9 A;  4E01 A;  2YYK A;  5K3J A;  2UXW A;  1Y8P A;  2CJ7 A;  2RDZ A;  2YYL A;  4M9A A;  4Q4U A;  2WBI A;  3HWC A;  3OWM A;  1SK6 A;  3UBR A;  1GKZ A;  2Z1Q A;  4OO2 A;  4W9U A;  2BU5 A;  2HJN A;  2PO4 A;  2LFW A;  2VF1 A;  3AFE A;  3D9G A;  3C46 A;  2BTZ A;  4LQS B;  2YYG A;  1X8Z A;  3D1I A;  4V25 A;  2YGW A;  3BNH A;  3B96 A;  2Q8F A;  1FS8 A;  2YYI A;  5GJV E;  3Q23 A;  2CJ6 A;  2REH A;  2EBA A;  1IS2 A;  1XFV A;  3SWO A;  2FP1 A;  2ZO5 A;  2E80 A;  1PI1 A;  1R3B A;  2JIF A;  1U8V A;  5J6A A;  4MP2 A;  2Q8H A;  3GNC A;  4Q5C A;  3X0Y A;  4DOY A;  1FS9 A;  4E02 A;  1XFX A;  5K3I A;  3BNG A;  4HKR A;  1RP3 A;  1UKW A;  4FF4 A;  4MP7 A;  1X91 A;  3FO3 A;  4ZYJ A;  1Y0V A;  3TZ0 A;  3N0R A;  2FON A;  3MKH A;  4L1F A;  4Q1O A;  3EOM A;  1JQI A;  2R05 A;  4JEK A;  4P13 A;  2EBH X;  2A1T A;  3L1T A;  4KS9 A;  4Q0T A;  5B5V A;  4DZY A;  4MPC A;  2OT4 A;  2JBS A;  3II9 A;  1GKX A;  2VIG A;  3PFD A;  3VKH A;  3BNJ A;  1X90 A;  3M9V A;  3NF4 A; 
#chains in the Genus database with same CATH homology
 1X8Z A;  1RJ4 A;  1X91 A;  2CJ5 A;  1RJ1 A;  2CJ7 A;  2XQR B;  2CJ6 A;  2CJ8 A;  1X90 A;  1XG2 B;  2CJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...