2CJ6A

Crystal structure of a cell wall invertase inhibitor from tobacco (ph 7.5)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
b'NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell-Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Inhibitor
total genus 61
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj6A00
1RJ4A 1X8ZA 1X90A 1XG2B 1X91A 2CJ8A 1RJ1A 2XQRB 2CJ4A 2CJ7A 2CJ5A 2CJ6A
chains in the Genus database with same CATH superfamily
4MPCA 4ZYJA 2IX6A 3MPIA 2JBSA 4ZXVA 4QICA 3Q23A 3FO3A 2XQRB 4G97A 3TZ0A 5K3HA 2Z1QA 1XFZA 3Q24A 3RKHA 1U8VA 1X90A 1JQIA 3B96A 3KMLA 1IVHA 4IRNA 1K90A 3X0YA 2WBIA 2Q8IA 5BRMA 3D9DA 1EGDA 1FS9A 1BUCA 2EBFX 5B5VA 3TORA 4KSAA 1Y8PA 3MMOA 5BRKA 5K3IA 2UXWA 2CJ5A 3FCJA 2GBBA 3EOMA 2YYIA 1WS9A 2EBHX 2JBRA 2PO4A 4W9UA 4X28C 3TZ4A 3VKHA 3II9A 1Y8OA 3D9GA 3M9VA 3UU9A 3S7WA 2AO2A 4P13A 4L3ZA 1K93A 2FONA 4F0XA 2R03A 1PK0A 2BU2A 2VR0A 3OWAA 1EGEA 4FZ4A 3CRKA 1R3BA 3D2RA 3TZ2A 2YYLA 1GJVA 4L3YA 4M9AA 5M4KA 1GU6A 2E80A 4AKIA 4XVXA 3SXQA 1RJ4A 2Q8FA 4V26A 1Y0VA 3UBRA 2ZDXA 3LG1A 1RP3A 1S26A 1SK6A 2D29A 1R2JA 2PNRA 4MPEA 3SF6A 3D9EA 5K3GA 4Q5BA 2PG0A 3N0RA 1EGCA 2DVLA 1LVCA 1QDBA 3LGQA 1GKXA 4X28A 4AKGA 2RF7A 3CE2A 2YYGA 3GQTA 3BNFA 4FF1A 1GKZA 4H81A 4L3XA 2BU5A 2HJNA 4E00A 3AFFA 4MP2A 2Q8GA 2OR0A 4G5EA 4U83A 4AI6A 4FF4A 2E0AA 2YGWA 3MKHA 4KCFA 1RX0A 1OAHA 3R7KA 3P4TA 3VKGA 3MDDA 4MP7A 4LQQB 4Q4UA 3HWCA 2CJ8A 1SIRA 1XFYA 4AKHA 2FP2A 4P79A 2JBTA 3C3LA 2C0UA 3MXLA 3GNCA 2CX9A 3F29A 2F6LA 2EC5A 4KTOA 4LQSB 3X29A 4RM7A 2OEVA 3CRLA 2IX5A 5GJWE 2CJ6A 1FS7A 2JIFA 4WJYA 1T9GA 2AZEA 3D6BA 4L1FA 2OT4A 4Q17A 2Q8HA 4KS9A 3SCEA 5K3JA 2BU6A 3C46A 4FF2A 4E01A 5M4MA 1UKWA 2J7AA 2YYKA 2BTZA 5M4NA 4E02A 3AFEA 3C2PA 2BU8A 2VF1A 3NF4A 5J6AA 4V25A 1UDYA 4DZYA 1SIQA 1SC5A 4HKRA 3OIBA 4H85A 4IV6A 3EONA 4Q5CA 3VADA 2DDHA 2CJ7A 1W07A 1XFXA 2RFQA 5GJVE 3BNGA 3D1IA 1IS2A 1XG2B 1X91A 2E81A 2R05A 2YYJA 4NXLA 2BU7A 4DOYA 2A1TA 3TTBA 1Y8NA 2ZO5A 4J1VA 2CJ4A 4FF3A 2QR4A 2R0MA 1JM6A 1XFUA 4JEKA 1X8ZA 2RDZA 2ZKJA 3BNJA 3X0XA 2ZDYA 3Q0AA 5J71A 1FS8A 1PI1A 4L38A 2VIGA 3SWOA 1K8TA 3GM6A 3L1TA 4HKSA 2XS8A 3BNHA 2C12A 4OO2A 4O5MA 4Q1OA 1RJ1A 3D9FA 4JIOA 3MPJA 4JIZA 4N5FA 2XS1A 3Q22A 2OEXA 2R02A 1XFWA 1XFVA 4KSFA 3TZ5A 2FP1A 3MDEA 3PFDA 4HR3A 2YYMA 4MPNA 2LFWA 4Q0TA 5M4PA 2REHA 5B5WA 2EBAA 3OWMA 2ZAFA 2R0NA 5B6BA 2OJQA 4H7QA
chains in the Genus database with same CATH topology
1RJ4A 1X8ZA 1X90A 1XG2B 1X91A 2CJ8A 1RJ1A 2XQRB 2CJ4A 2CJ7A 2CJ5A 2CJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJ4 A;  1X8Z A;  1X90 A;  1XG2 B;  1X91 A;  2CJ8 A;  1RJ1 A;  2XQR B;  2CJ4 A;  2CJ7 A;  2CJ5 A;  2CJ6 A; 
#chains in the Genus database with same CATH topology
 4MPC A;  4ZYJ A;  2IX6 A;  3MPI A;  2JBS A;  4ZXV A;  4QIC A;  3Q23 A;  3FO3 A;  2XQR B;  4G97 A;  3TZ0 A;  5K3H A;  2Z1Q A;  1XFZ A;  3Q24 A;  3RKH A;  1U8V A;  1X90 A;  1JQI A;  3B96 A;  3KML A;  1IVH A;  4IRN A;  1K90 A;  3X0Y A;  2WBI A;  2Q8I A;  5BRM A;  3D9D A;  1EGD A;  1FS9 A;  1BUC A;  2EBF X;  5B5V A;  3TOR A;  4KSA A;  1Y8P A;  3MMO A;  5BRK A;  5K3I A;  2UXW A;  2CJ5 A;  3FCJ A;  2GBB A;  3EOM A;  2YYI A;  1WS9 A;  2EBH X;  2JBR A;  2PO4 A;  4W9U A;  4X28 C;  3TZ4 A;  3VKH A;  3II9 A;  1Y8O A;  3D9G A;  3M9V A;  3UU9 A;  3S7W A;  2AO2 A;  4P13 A;  4L3Z A;  1K93 A;  2FON A;  4F0X A;  2R03 A;  1PK0 A;  2BU2 A;  2VR0 A;  3OWA A;  1EGE A;  4FZ4 A;  3CRK A;  1R3B A;  3D2R A;  3TZ2 A;  2YYL A;  1GJV A;  4L3Y A;  4M9A A;  5M4K A;  1GU6 A;  2E80 A;  4AKI A;  4XVX A;  3SXQ A;  1RJ4 A;  2Q8F A;  4V26 A;  1Y0V A;  3UBR A;  2ZDX A;  3LG1 A;  1RP3 A;  1S26 A;  1SK6 A;  2D29 A;  1R2J A;  2PNR A;  4MPE A;  3SF6 A;  3D9E A;  5K3G A;  4Q5B A;  2PG0 A;  3N0R A;  1EGC A;  2DVL A;  1LVC A;  1QDB A;  3LGQ A;  1GKX A;  4X28 A;  4AKG A;  2RF7 A;  3CE2 A;  2YYG A;  3GQT A;  3BNF A;  4FF1 A;  1GKZ A;  4H81 A;  4L3X A;  2BU5 A;  2HJN A;  4E00 A;  3AFF A;  4MP2 A;  2Q8G A;  2OR0 A;  4G5E A;  4U83 A;  4AI6 A;  4FF4 A;  2E0A A;  2YGW A;  3MKH A;  4KCF A;  1RX0 A;  1OAH A;  3R7K A;  3P4T A;  3VKG A;  3MDD A;  4MP7 A;  4LQQ B;  4Q4U A;  3HWC A;  2CJ8 A;  1SIR A;  1XFY A;  4AKH A;  2FP2 A;  4P79 A;  2JBT A;  3C3L A;  2C0U A;  3MXL A;  3GNC A;  2CX9 A;  3F29 A;  2F6L A;  2EC5 A;  4KTO A;  4LQS B;  3X29 A;  4RM7 A;  2OEV A;  3CRL A;  2IX5 A;  5GJW E;  2CJ6 A;  1FS7 A;  2JIF A;  4WJY A;  1T9G A;  2AZE A;  3D6B A;  4L1F A;  2OT4 A;  4Q17 A;  2Q8H A;  4KS9 A;  3SCE A;  5K3J A;  2BU6 A;  3C46 A;  4FF2 A;  4E01 A;  5M4M A;  1UKW A;  2J7A A;  2YYK A;  2BTZ A;  5M4N A;  4E02 A;  3AFE A;  3C2P A;  2BU8 A;  2VF1 A;  3NF4 A;  5J6A A;  4V25 A;  1UDY A;  4DZY A;  1SIQ A;  1SC5 A;  4HKR A;  3OIB A;  4H85 A;  4IV6 A;  3EON A;  4Q5C A;  3VAD A;  2DDH A;  2CJ7 A;  1W07 A;  1XFX A;  2RFQ A;  5GJV E;  3BNG A;  3D1I A;  1IS2 A;  1XG2 B;  1X91 A;  2E81 A;  2R05 A;  2YYJ A;  4NXL A;  2BU7 A;  4DOY A;  2A1T A;  3TTB A;  1Y8N A;  2ZO5 A;  4J1V A;  2CJ4 A;  4FF3 A;  2QR4 A;  2R0M A;  1JM6 A;  1XFU A;  4JEK A;  1X8Z A;  2RDZ A;  2ZKJ A;  3BNJ A;  3X0X A;  2ZDY A;  3Q0A A;  5J71 A;  1FS8 A;  1PI1 A;  4L38 A;  2VIG A;  3SWO A;  1K8T A;  3GM6 A;  3L1T A;  4HKS A;  2XS8 A;  3BNH A;  2C12 A;  4OO2 A;  4O5M A;  4Q1O A;  1RJ1 A;  3D9F A;  4JIO A;  3MPJ A;  4JIZ A;  4N5F A;  2XS1 A;  3Q22 A;  2OEX A;  2R02 A;  1XFW A;  1XFV A;  4KSF A;  3TZ5 A;  2FP1 A;  3MDE A;  3PFD A;  4HR3 A;  2YYM A;  4MPN A;  2LFW A;  4Q0T A;  5M4P A;  2REH A;  5B5W A;  2EBA A;  3OWM A;  2ZAF A;  2R0N A;  5B6B A;  2OJQ A;  4H7Q A; 
#chains in the Genus database with same CATH homology
 1RJ4 A;  1X8Z A;  1X90 A;  1XG2 B;  1X91 A;  2CJ8 A;  1RJ1 A;  2XQR B;  2CJ4 A;  2CJ7 A;  2CJ5 A;  2CJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...