2CJ6A

Crystal structure of a cell wall invertase inhibitor from tobacco (ph 7.5)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
146
structure length
146
Chain Sequence
NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Inhibitor
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell-Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
total genus 61
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj6A00
2XQRB 1X91A 2CJ4A 1X8ZA 2CJ8A 2CJ7A 2CJ5A 1RJ1A 1RJ4A 1XG2B 1X90A 2CJ6A
chains in the Genus database with same CATH superfamily
2A1TA 2XQRB 3MPJA 2EBAA 2EBHX 3FO3A 2LFWA 1GJVA 1K93A 1WS9A 3MPIA 4KCFA 2J7AA 5B6BA 4E01A 3Q23A 1RJ1A 4WJYA 4FZ4A 2OEXA 2R0NA 2C0UA 3L1TA 2BU2A 4LQQB 5K3JA 2C12A 1GU6A 3SXQA 4F0XA 2ZO5A 4XVXA 4FF3A 2ZKJA 4MPNA 4ZYJA 4Q1OA 1R2JA 4Q5BA 1SIQA 1Y0VA 3NF4A 2OR0A 3UU9A 3Q22A 2OT4A 1SC5A 2VR0A 3LGQA 4MP2A 4J1VA 3C3LA 2QR4A 3OIBA 2FP1A 4HKRA 3BNJA 2YYMA 2YYJA 2CX9A 1GKZA 2OJQA 2RFQA 2R05A 1GKXA 2VIGA 2E81A 2RF7A 3LG1A 3PFDA 4MPCA 3P4TA 1X91A 4MPEA 2Z1QA 4KTOA 4QICA 3TORA 3C2PA 2FP2A 3HWCA 3N0RA 4HR3A 3D9EA 3GM6A 2JIFA 4G5EA 3D9FA 1JM6A 4MP7A 2D29A 5J71A 1T9GA 1UKWA 4N5FA 3GNCA 2BU5A 3CE2A 1Y8OA 4OO2A 2Q8HA 2IX5A 2XS8A 1QDBA 2HJNA 2YYKA 3D2RA 5K3HA 1XFUA 1BUCA 2YYLA 3C46A 2IX6A 1XFWA 1SIRA 1EGDA 3SWOA 3BNHA 4AKHA 3VKHA 2PNRA 2XS1A 2GBBA 1XFXA 4G97A 3TZ0A 4E02A 1IS2A 4HKSA 4JIOA 3VKGA 3OWAA 4KSAA 2PG0A 5GJWE 1FS7A 3RKHA 2BTZA 1FS9A 3D1IA 2YYGA 3KMLA 3MDEA 1K90A 4Q0TA 3CRKA 3BNGA 4H81A 3CRLA 4L3YA 1S26A 4W9UA 1EGEA 3BNFA 4NXLA 3GQTA 4H85A 1RJ4A 2AZEA 1JQIA 2DDHA 2REHA 4FF4A 2RDZA 3TZ2A 2ZDXA 5J6AA 3AFFA 2PO4A 5K3IA 1X8ZA 3MDDA 3VADA 3MKHA 3Q24A 1X90A 4P13A 2AO2A 3MMOA 2CJ6A 2Q8GA 4RM7A 3SCEA 3UBRA 3F29A 3SF6A 3X29A 4L3ZA 4AKIA 3AFEA 2BU8A 1FS8A 3EONA 2WBIA 3D9GA 1PK0A 2CJ4A 1RP3A 1OAHA 4H7QA 3TZ4A 2VF1A 3M9VA 4Q17A 1U8VA 2BU7A 2F6LA 4IV6A 2JBRA 1UDYA 1PI1A 1RX0A 2UXWA 4O5MA 3X0YA 1Y8NA 3Q0AA 4L1FA 4JEKA 3TTBA 2ZAFA 4DZYA 4U83A 3II9A 4AI6A 1XFVA 2Q8IA 2E0AA 2E80A 1SK6A 2R02A 3B96A 4AKGA 4IRNA 4X28A 2OEVA 3D9DA 2CJ8A 2CJ7A 3MXLA 1W07A 3X0XA 1EGCA 4DOYA 1IVHA 3FCJA 5K3GA 2R0MA 3EOMA 2JBSA 2R03A 1LVCA 4FF1A 2JBTA 1XFYA 5BRMA 1R3BA 2EBFX 1XFZA 2BU6A 4V25A 5GJVE 2Q8FA 4ZXVA 4KSFA 4FF2A 2FONA 5M4MA 2ZDYA 2DVLA 5B5VA 2YGWA 4KS9A 4Q5CA 5BRKA 5M4NA 3OWMA 2YYIA 1Y8PA 4LQSB 4P79A 5B5WA 5M4KA 1K8TA 4Q4UA 3D6BA 5M4PA 2EC5A 4JIZA 4X28C 2CJ5A 4L3XA 4E00A 1XG2B 3TZ5A 3S7WA 4L38A 3R7KA 4M9AA 4V26A
chains in the Genus database with same CATH topology
2XQRB 1X91A 2CJ4A 1X8ZA 2CJ8A 2CJ7A 2CJ5A 1RJ1A 1RJ4A 1XG2B 1X90A 2CJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XQR B;  1X91 A;  2CJ4 A;  1X8Z A;  2CJ8 A;  2CJ7 A;  2CJ5 A;  1RJ1 A;  1RJ4 A;  1XG2 B;  1X90 A;  2CJ6 A; 
#chains in the Genus database with same CATH topology
 2A1T A;  2XQR B;  3MPJ A;  2EBA A;  2EBH X;  3FO3 A;  2LFW A;  1GJV A;  1K93 A;  1WS9 A;  3MPI A;  4KCF A;  2J7A A;  5B6B A;  4E01 A;  3Q23 A;  1RJ1 A;  4WJY A;  4FZ4 A;  2OEX A;  2R0N A;  2C0U A;  3L1T A;  2BU2 A;  4LQQ B;  5K3J A;  2C12 A;  1GU6 A;  3SXQ A;  4F0X A;  2ZO5 A;  4XVX A;  4FF3 A;  2ZKJ A;  4MPN A;  4ZYJ A;  4Q1O A;  1R2J A;  4Q5B A;  1SIQ A;  1Y0V A;  3NF4 A;  2OR0 A;  3UU9 A;  3Q22 A;  2OT4 A;  1SC5 A;  2VR0 A;  3LGQ A;  4MP2 A;  4J1V A;  3C3L A;  2QR4 A;  3OIB A;  2FP1 A;  4HKR A;  3BNJ A;  2YYM A;  2YYJ A;  2CX9 A;  1GKZ A;  2OJQ A;  2RFQ A;  2R05 A;  1GKX A;  2VIG A;  2E81 A;  2RF7 A;  3LG1 A;  3PFD A;  4MPC A;  3P4T A;  1X91 A;  4MPE A;  2Z1Q A;  4KTO A;  4QIC A;  3TOR A;  3C2P A;  2FP2 A;  3HWC A;  3N0R A;  4HR3 A;  3D9E A;  3GM6 A;  2JIF A;  4G5E A;  3D9F A;  1JM6 A;  4MP7 A;  2D29 A;  5J71 A;  1T9G A;  1UKW A;  4N5F A;  3GNC A;  2BU5 A;  3CE2 A;  1Y8O A;  4OO2 A;  2Q8H A;  2IX5 A;  2XS8 A;  1QDB A;  2HJN A;  2YYK A;  3D2R A;  5K3H A;  1XFU A;  1BUC A;  2YYL A;  3C46 A;  2IX6 A;  1XFW A;  1SIR A;  1EGD A;  3SWO A;  3BNH A;  4AKH A;  3VKH A;  2PNR A;  2XS1 A;  2GBB A;  1XFX A;  4G97 A;  3TZ0 A;  4E02 A;  1IS2 A;  4HKS A;  4JIO A;  3VKG A;  3OWA A;  4KSA A;  2PG0 A;  5GJW E;  1FS7 A;  3RKH A;  2BTZ A;  1FS9 A;  3D1I A;  2YYG A;  3KML A;  3MDE A;  1K90 A;  4Q0T A;  3CRK A;  3BNG A;  4H81 A;  3CRL A;  4L3Y A;  1S26 A;  4W9U A;  1EGE A;  3BNF A;  4NXL A;  3GQT A;  4H85 A;  1RJ4 A;  2AZE A;  1JQI A;  2DDH A;  2REH A;  4FF4 A;  2RDZ A;  3TZ2 A;  2ZDX A;  5J6A A;  3AFF A;  2PO4 A;  5K3I A;  1X8Z A;  3MDD A;  3VAD A;  3MKH A;  3Q24 A;  1X90 A;  4P13 A;  2AO2 A;  3MMO A;  2CJ6 A;  2Q8G A;  4RM7 A;  3SCE A;  3UBR A;  3F29 A;  3SF6 A;  3X29 A;  4L3Z A;  4AKI A;  3AFE A;  2BU8 A;  1FS8 A;  3EON A;  2WBI A;  3D9G A;  1PK0 A;  2CJ4 A;  1RP3 A;  1OAH A;  4H7Q A;  3TZ4 A;  2VF1 A;  3M9V A;  4Q17 A;  1U8V A;  2BU7 A;  2F6L A;  4IV6 A;  2JBR A;  1UDY A;  1PI1 A;  1RX0 A;  2UXW A;  4O5M A;  3X0Y A;  1Y8N A;  3Q0A A;  4L1F A;  4JEK A;  3TTB A;  2ZAF A;  4DZY A;  4U83 A;  3II9 A;  4AI6 A;  1XFV A;  2Q8I A;  2E0A A;  2E80 A;  1SK6 A;  2R02 A;  3B96 A;  4AKG A;  4IRN A;  4X28 A;  2OEV A;  3D9D A;  2CJ8 A;  2CJ7 A;  3MXL A;  1W07 A;  3X0X A;  1EGC A;  4DOY A;  1IVH A;  3FCJ A;  5K3G A;  2R0M A;  3EOM A;  2JBS A;  2R03 A;  1LVC A;  4FF1 A;  2JBT A;  1XFY A;  5BRM A;  1R3B A;  2EBF X;  1XFZ A;  2BU6 A;  4V25 A;  5GJV E;  2Q8F A;  4ZXV A;  4KSF A;  4FF2 A;  2FON A;  5M4M A;  2ZDY A;  2DVL A;  5B5V A;  2YGW A;  4KS9 A;  4Q5C A;  5BRK A;  5M4N A;  3OWM A;  2YYI A;  1Y8P A;  4LQS B;  4P79 A;  5B5W A;  5M4K A;  1K8T A;  4Q4U A;  3D6B A;  5M4P A;  2EC5 A;  4JIZ A;  4X28 C;  2CJ5 A;  4L3X A;  4E00 A;  1XG2 B;  3TZ5 A;  3S7W A;  4L38 A;  3R7K A;  4M9A A;  4V26 A; 
#chains in the Genus database with same CATH homology
 2XQR B;  1X91 A;  2CJ4 A;  1X8Z A;  2CJ8 A;  2CJ7 A;  2CJ5 A;  1RJ1 A;  1RJ4 A;  1XG2 B;  1X90 A;  2CJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...