2Q8FA

Structure of pyruvate dehydrogenase kinase isoform 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
383
structure length
365
Chain Sequence
b'GVPGQVDFYARFSPSPLSMKQFLDFGSCEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNADDWCVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 129
structure length 365
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8fA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8fA02
2XHTA 5CTXA 2Q8HA 1TH8A 2FYPA 2YJXA 2IORA 4XIQA 1I59A 4CE1A 2YKCA 1KIJA 2YKJA 5D6PA 5IDMA 3A0TA 3R4MA 1TILA 3T2SA 3RLQA 4GFNA 1UY9A 2XDSA 1I5DA 1UYMA 1ZWHA 1UYHA 3HYZA 4XTJA 2XJXA 2XJGA 4GT8A 2AKPA 4XE2A 1UYDA 1UYGA 1S14A 2IOPA 3OPDA 4L91A 5CPHA 2YGEA 2HKJA 1YT2A 3G7EA 4LWEA 2CCUA 2YEFA 4O04A 2IWXA 4I5SA 1R62A 3LPSA 1AM1A 2WI1A 4NH7A 1Z59A 3NMQA 2QG0A 2WI5A 3O2FA 2YK9A 1U2OA 3CRLA 3Q5JA 3TZ4A 3C11A 2UWDA 4E01A 4GEEA 3TTZA 4LWIA 2YI6A 4BIZA 3T10A 2O1WA 3O0IA 1H7SA 1Y4SA 2E0AA 1S16A 4EEHA 1UY6A 2YI5A 4AWQA 2YGFA 4CWNA 4CWSA 3HHUA 4P8OA 4HXZA 4CE2A 1GKZA 4E02A 2BYIA 1TC0A 1GJVA 4DZYA 4EGIA 1ID0A 3U67A 4LP0A 4KSGA 1U0ZA 1B62A 2YI0A 5M4MA 4L94A 1YC4A 4HY6A 4YKXA 5M4KA 2YEGA 4HYPA 3EHHA 1H7UA 3INXA 2FXSA 3JZ3A 2XHRA 2XDLA 3TZ5A 2YE5A 5BOCA 4XKAA 4MPEA 3DGEA 4JQLA 2XHXA 4I3HA 1B3QA 1Z5BA 2JKIA 1UYFA 1GKXA 4URLA 4URNA 3K60A 4R1FA 4YKYA 5D7CA 4ASAA 4BXIA 4H7QA 2CG9A 2IWSA 2YE4A 3B25A 4CWPA 2XCMA 2XJJA 4GQTA 4CWQA 4WUDA 4B7PA 3G75A 3KE6A 2YECA 4JAUA 2GFDA 3ZM7A 1BXDA 3RKZA 1YESA 5F5RA 3A0ZA 2QF6A 3B27A 3EKRA 2CCTA 2YKEA 4JAVA 3SL2A 1YETA 3EKOA 2Q8FA 2CCSA 2BYHA 2IOQA 5FNCA 4L93A 5GGZA 4WUBA 4ASFA 3GIGB 2YEHA 3D2RA 1YT0A 3CWVA 3FV5A 4X9LA 1YC1A 4ASBA 2YEAA 1MU5A 1Y8NA 1AMWA 3EHJA 2VCIA 4FCQA 2BT0A 4FCRA 3GIEA 4EFUA 2YEIA 1I5CA 4AS9A 3T0HA 4LWHA 1UY8A 1YS3A 2VCJA 4LWFA 5FWKA 1Y8OA 5M4NA 1UYEA 2BREA 2YE7A 4PL9A 5IDJA 1UY7A 4YKQA 2JJCA 4H85A 4BQGA 3FT8A 2YE2A 3IEDA 2YE6A 3PEHA 4K4OA 5M4HA 3U2DA 4XDMA 4KQVA 4LWGA 5CF0A 3OWDA 3QDDA 3R4NA 3CGZA 2WI7A 4PRVA 1L0OA 4URMA 1A4HA 1AJ6A 3TUHA 2EXLA 1TC6A 2VWCA 2Q2EB 2VW5A 3D0BA 3VHCA 3H4LA 3A0YA 3HEKA 1UYCA 1Z5CA 4P7AA 4KSHA 3FT5A 4XD8A 2O1UA 4XKOA 3RLPA 4EGKA 4QPJA 3A0WA 2XABA 3C0EA 4FMTA 1BGQA 3CGYA 2YI7A 1Y8PA 3OW6A 4O0BA 4DUHA 4W7TA 1TBWA 5BODA 3B24A 2FWYA 1YT1A 4R3AA 1YERA 2ESAA 3K98A 1UYIA 4L90A 4Q20A 3R92A 1MX0A 4KP4A 4EGHA 4KFGA 3OWBA 4O07A 4BIUA 4MPCA 5FNFA 1THNA 2QG2A 2Q8GA 3EHFA 4CE3A 1YSRA 4MPNA 1NHHA 1OSFA 3R91A 4BQJA 2IWUA 4XKKA 2O1VA 4EM7A 4U7NA 2ZDYA 3WQ9A 2WEQA 3QTFA 2ZDXA 2HG1A 3Q5LA 3K99A 2YKBA 5IN9A 4MB9A 3GIGA 3EHGA 5CTWA 4CWTA 2XX2A 2XX4A 2YK2A 2QFOA 2XDXA 1US7A 2BZ5A 1Z5AA 1I5BA 1B63A 3A0RA 3Q5KA 3T1KA 2BRCA 4V25A 1UYKA 2YKIA 1YC3A 3H80A 4V26A 4YKZA 2WERA 4MP2A 3ZXQA 4AWOA 4AWPA 1EA6A 3VHAA 2WI4A 4MP7A 4YKUA 3GIFA 4XCJA 2H8MA 5F3KA 2BU8A 2C2AA 5J6AA 2BSMA 4R3MA 1I5AA 3HZ1A 4HZ0A 5FNDA 2GQPA 4QPKA 1QZRA 3TZ0A 4GGLA 4GCZA 2PNRA 2XX5A 3G7BA 3HZ5A 4YKRA 3D36A 2FWZA 4XIRA 3TZ2A 1ZXMA 2YJWA 3VADA 2BU6A 1QY8A 2HCHA 1BYQA 1I58A 4EFTA 2XDUA 2CGFA 4EMVA 3CRKA 3OMUA 4O05A 3WHAA 2WI2A 2ZKJA 4NH9A 3ZKDA 1JM6A 4HZ5A 2ZBKB 1EI1A 2YEJA 4BAEA 3O6OA 4U7OA 4XITA 4LPBA 3U2KA 2YGAA 2CH4A 4CWRA 2XD6A 4HXWA 3B26A 4XCLA 4HY1A 4HYMA 4KTNA 2YEBA 2BU2A 4XC0A 3PEJA 2XDKA 3RLRA 1NHIA 3B28A 2XK2A 3T0ZA 3ZKBA 4PRXA 1PVGA 3MNRP 1ZXNA 4L8ZA 4B6CA 2WEPA 3HYYA 5CTUA 5C93A 2YE9A 2Q8IA 4CWOA 5J71A 3A0XA 2BU7A 4YKWA 1NHJA 4WUCA 2YE3A 4O09A 3INWA 1AH6A 5M4PA 2BU5A 3LNUA 4FCPA 5D7RA 5D7DA 1UYLA 1YSZA 4MOTA 4YKTA 3R4PA 4E00A 4ZVIA 2K5BA 3BMYA 1ZW9A 4NH8A 4FPPA 1QYEA 1Y4UA 5M4EA 3VHDA 3K97A 3R4OA 1KZNA 5CTYA 4CWFA 1AH8A 4PU9A 2H55A 4UROA 4JASA 2YEEA 2WI3A 4ASGA 4ZKIA 2WI6A 1BKNA 4MBCA 1TIDA 3BM9A 2YEDA 2YE8A 4XIPA 5L3JA 5D6QA 4H81A 4U93A 2BTZA 3ZXOA
chains in the Genus database with same CATH superfamily
4WJYA 3X29A 2UXWA 2XHTA 1FS8A 2EBAA 2Q8HA 1TH8A 5CTXA 2FYPA 2YJXA 2IORA 4XIQA 1I59A 1R3BA 4CE1A 4QICA 2YKCA 1KIJA 2YKJA 2RFQA 4Q17A 4E72A 2HJNA 5D6PA 5IDMA 2R0MA 3D9GA 3A0TA 3R4MA 1TILA 3T2SA 3RLQA 4N5FA 2GBBA 4GFNA 1XFVA 2JBSA 5K3HA 1UY9A 1IXMA 3HWCA 2XDSA 1I5DA 1UYMA 1ZWHA 1UYHA 3LGQA 3HYZA 4XTJA 1XFYA 2XJXA 2XJGA 4GT8A 2YYMA 2AKPA 3S7WA 1UYDA 3SWOA 1UYGA 1S14A 2PO4A 4XE2A 2IOPA 3OPDA 3D1IA 3Q23A 4L91A 5CPHA 3Q22A 2YGEA 4AKGA 2HKJA 1R2JA 1YT2A 3G7EA 4LWEA 5K3JA 2CCUA 3UBRA 2YEFA 4O04A 3MPIA 2IWXA 4I5SA 2XQRB 1R62A 2CJ8A 3LPSA 2FONA 1F51A 3GQTA 1AM1A 2WI1A 4NH7A 1Z59A 3NMQA 3KMLA 2QG0A 2WI5A 3O2FA 2YK9A 1U2OA 1XFXA 3CRLA 1OAHA 4KCFA 3MXLA 2AO2A 1IVHA 3Q5JA 3TZ4A 2R03A 3C11A 1WS9A 3NF4A 2UWDA 4E01A 3PFDA 2R02A 4JEKA 4GEEA 3TTZA 4LWIA 2YI6A 4BIZA 3T10A 2O1WA 3O0IA 1H7SA 1Y4SA 2E0AA 4HR3A 2JBRA 1S16A 4EEHA 1UY6A 4O5MA 2YI5A 4AWQA 2YGFA 4CWNA 4CWSA 3N0RA 2D29A 3HHUA 4P8OA 4HXZA 1RX0A 2C1IA 1GKZA 4E02A 2BYIA 4CE2A 1TC0A 2RDZA 3BNJA 1GJVA 4J1VA 4L38A 4DZYA 3D6BA 4EGIA 1ID0A 4KTOA 4NXLA 3U67A 1RJ4A 4LP0A 2DVLA 4KSGA 1U0ZA 3SF6A 1X90A 2VIGA 1B62A 5M4MA 2YI0A 1YC4A 1FS9A 4X28C 4L94A 4HY6A 3M9VA 4YKXA 2CX9A 5M4KA 5GJVE 3Q0AA 5JENA 4G5EA 4FF1A 2YEGA 3X0YA 4HYPA 2QR4A 3EHHA 1H7UA 3X0XA 3INXA 4P79A 3MKHA 4L3YA 3R7KA 2FXSA 3JZ3A 2XHRA 4IV6A 2XDLA 3TZ5A 2YE5A 5BOCA 4XKAA 4JIZA 4MPEA 4HKSA 3DGEA 4JQLA 2XHXA 4I3HA 3SXQA 1B3QA 1Z5BA 2JKIA 1UYFA 1GKXA 4URLA 4URNA 3K60A 4R1FA 4YKYA 5BRKA 5D7CA 4ASAA 4BXIA 4H7QA 1QDBA 2JIFA 2CG9A 2IWSA 2PG0A 2VF1A 2YE4A 4L3ZA 3B25A 4CWPA 2XCMA 2XJJA 4GQTA 4CWQA 4WUDA 1UKWA 4B7PA 3G75A 3KE6A 1UDYA 2YECA 4F0XA 4JAUA 2GFDA 3ZM7A 1BXDA 3RKZA 1YESA 5F5RA 3A0ZA 2QF6A 1XFUA 2EC5A 3B27A 3EKRA 2CCTA 2YKEA 4JAVA 3SL2A 1YETA 3EKOA 2Q8FA 2CCSA 2BYHA 2IOQA 5FNCA 4L93A 5GGZA 4WUBA 4ASFA 3GIGB 3OWMA 1SIRA 2YEHA 3D2RA 1YT0A 1IS2A 3CWVA 3FV5A 4X9LA 1YC1A 4ASBA 2YEAA 1MU5A 1Y8NA 4FF2A 1AMWA 2VCIA 3EHJA 4FCQA 2BT0A 1T9GA 4AS9A 2EBHX 3GIEA 4FCRA 3GM6A 4EFUA 2YEIA 2FP1A 3TTBA 1I5CA 3T0HA 4LWHA 1UY8A 5B5WA 1YS3A 2VCJA 4LWFA 3S5TA 5FWKA 1JQIA 1Y8OA 5M4NA 4XVXA 1UYEA 2BREA 4OO2A 3MMOA 2YE7A 4PL9A 5IDJA 1UY7A 4YKQA 2JJCA 4H85A 3B96A 3EONA 4BQGA 4W9UA 3FT8A 2YE2A 4AKIA 3IEDA 2YE6A 4FF4A 3CYGA 3PEHA 4K4OA 2C1GA 5M4HA 1K90A 3U2DA 4XDMA 4IRNA 2R0NA 2CJ5A 4KQVA 4LWGA 2XS1A 5CF0A 3OWDA 1LVCA 3MPJA 3QDDA 2FTKA 2AZEA 3R4NA 1FS7A 3AFFA 3OWAA 3CGZA 5BRMA 2WI7A 4PRVA 3OIBA 3CE2A 1L0OA 4URMA 1A4HA 3UU9A 2C0UA 1AJ6A 3TUHA 4Q5CA 1X91A 2EXLA 4U83A 3D9FA 3RKHA 1TC6A 2VWCA 2OEVA 2Q2EB 2VW5A 3P4TA 3D0BA 4X28A 3A0YA 3H4LA 1UYCA 5K3IA 3HEKA 3VHCA 3L1TA 1Z5CA 4P7AA 4KSHA 3FT5A 4XD8A 2O1UA 4XKOA 3RLPA 4EGKA 4QPJA 3A0WA 1EGDA 2XABA 3C0EA 4FMTA 1BGQA 3CGYA 5B5VA 2YI7A 1Y8PA 3OW6A 4O0BA 4ZYJA 2A1TA 4DUHA 4W7TA 1PK0A 1TBWA 5BODA 4P13A 3B24A 2FWYA 2HHIA 2FP2A 3FO3A 1YT1A 4R3AA 1YERA 2ESAA 3K98A 1UYIA 4L90A 4Q20A 3R92A 3C46A 4ZXVA 1MX0A 4AI6A 4KP4A 4EGHA 4KFGA 3OWBA 4O07A 2R05A 2YGWA 3BNFA 4BIUA 4MPCA 5FNFA 1THNA 2QG2A 4Q4UA 2Q8GA 3EHFA 4CE3A 3AFEA 1YSRA 4MPNA 1NHHA 1OSFA 3R91A 3LMMA 4BQJA 2YYIA 2IWUA 2IX5A 2J7AA 4XKKA 1W07A 2O1VA 4EM7A 4U7NA 2ZDYA 3WQ9A 2Z1QA 2OEXA 2WEQA 3QTFA 2ZDXA 2HG1A 3Q5LA 3K99A 2YKBA 5IN9A 4MB9A 3GIGA 3EHGA 5CTWA 4JIOA 4CWTA 1EGCA 2XX2A 2XX4A 2YK2A 4RM7A 3TORA 1Y0VA 2QFOA 4G97A 4DOYA 2ZO5A 4KS9A 2XDXA 1US7A 3II9A 2ZAFA 1K93A 5B6BA 2BZ5A 1RP3A 3C3LA 1Z5AA 1I5BA 4L1FA 1B63A 3A0RA 3VKHA 3Q5KA 2IX6A 3T1KA 2BRCA 4V25A 1UYKA 2YKIA 2EBFX 1YC3A 3H80A 1X8ZA 3BNHA 4V26A 4YKZA 4HKRA 2WERA 4MP2A 3ZXQA 4AWOA 1S26A 4FF3A 1EA6A 4AWPA 3VHAA 2WI4A 4MP7A 4YKUA 3GIFA 4XCJA 2H8MA 5F3KA 2BU8A 2C2AA 5J6AA 2BSMA 4R3MA 1I5AA 3HZ1A 4HZ0A 5FNDA 2GQPA 4QPKA 1QZRA 3TZ0A 2WBIA 2LFWA 2OR0A 4GGLA 4GCZA 2PNRA 2XX5A 3G7BA 3HZ5A 4YKRA 3D36A 2FWZA 4XIRA 3TZ2A 1ZXMA 2YJWA 3LG1A 3VADA 2BU6A 1QY8A 3D9DA 2HCHA 2YYGA 1BYQA 1I58A 4EFTA 1EGEA 1GU6A 3BNGA 2XDUA 2CGFA 4EMVA 3CRKA 3OMUA 4O05A 1SK6A 3VKGA 2YYJA 2ZKJA 1SC5A 2WI2A 4NH9A 3WHAA 2RF7A 3ZKDA 1JM6A 4M9AA 4HZ5A 2VR0A 2ZBKB 1EI1A 2YEJA 4BAEA 3O6OA 2DDHA 4U7OA 4XITA 4LPBA 3U2KA 2YGAA 2CJ4A 2C12A 5GJWE 2CH4A 4CWRA 4LQSB 4AKHA 1K8TA 2XD6A 4HXWA 3B26A 4XCLA 4HY1A 1PI1A 4HYMA 4KTNA 2YEBA 2BU2A 1XFWA 3F29A 4Q0TA 4XC0A 3PEJA 2REHA 2XDKA 3RLRA 1NHIA 3B28A 2XK2A 4Q1OA 1SIQA 3T0ZA 3ZKBA 4PRXA 1PVGA 1BUCA 4KSAA 3MNRP 1ZXNA 4L8ZA 4B6CA 3C2PA 2WEPA 3HYYA 3FCJA 2CJ6A 5C93A 5CTUA 2YE9A 2Q8IA 4CWOA 5J71A 3A0XA 2BU7A 4YKWA 1NHJA 2CJ7A 2XS8A 3MDEA 4WUCA 2YE3A 4O09A 3INWA 1AH6A 5M4PA 2BU5A 1XG2B 3LNUA 2OJQA 4FCPA 5D7RA 5D7DA 1UYLA 2JBTA 1YSZA 2F6LA 4MOTA 3R4PA 1U8VA 4E00A 4YKTA 4ZVIA 2K5BA 3SCEA 3BMYA 3GNCA 1ZW9A 4NH8A 4FPPA 1QYEA 1Y4UA 5M4EA 1RJ1A 3VHDA 3K97A 3R4OA 1KZNA 2OT4A 3Q24A 3EOMA 5CTYA 4CWFA 1XFZA 1AH8A 4PU9A 4Q5BA 2H55A 4JASA 4UROA 2E80A 2YEEA 2WI3A 3MDDA 4ASGA 4ZKIA 2WI6A 2E81A 1BKNA 3D9EA 2YYKA 4MBCA 2YYLA 1TIDA 3BM9A 4LQQB 2YEDA 2YE8A 4XIPA 5L3JA 4FZ4A 5D6QA 4H81A 4U93A 2BTZA 3ZXOA 4L3XA 4KSFA 5K3GA
chains in the Genus database with same CATH topology
2XHTA 5CTXA 2Q8HA 1TH8A 2FYPA 2YJXA 2IORA 4XIQA 1I59A 4CE1A 2YKCA 1KIJA 2YKJA 5D6PA 5IDMA 3A0TA 3R4MA 1TILA 3T2SA 3RLQA 4GFNA 1UY9A 2XDSA 1I5DA 1UYMA 1ZWHA 1UYHA 3HYZA 4XTJA 2XJXA 2XJGA 4GT8A 2AKPA 4XE2A 1UYDA 1UYGA 1S14A 2IOPA 3OPDA 4L91A 5CPHA 2YGEA 2HKJA 1YT2A 3G7EA 4LWEA 2CCUA 2YEFA 4O04A 2IWXA 4I5SA 1R62A 3LPSA 1AM1A 2WI1A 4NH7A 1Z59A 3NMQA 2QG0A 2WI5A 3O2FA 2YK9A 1U2OA 3CRLA 3Q5JA 3TZ4A 3C11A 2UWDA 4E01A 4GEEA 3TTZA 4LWIA 2YI6A 4BIZA 3T10A 2O1WA 3O0IA 1H7SA 1Y4SA 2E0AA 1S16A 4EEHA 1UY6A 2YI5A 4AWQA 2YGFA 4CWNA 4CWSA 3HHUA 4P8OA 4HXZA 4CE2A 1GKZA 4E02A 2BYIA 1TC0A 1GJVA 4DZYA 4EGIA 1ID0A 3U67A 4LP0A 4KSGA 1U0ZA 1B62A 2YI0A 5M4MA 4L94A 1YC4A 4HY6A 4YKXA 5M4KA 2YEGA 4HYPA 3EHHA 1H7UA 3INXA 2FXSA 3JZ3A 2XHRA 2XDLA 3TZ5A 2YE5A 5BOCA 4XKAA 4MPEA 3DGEA 4JQLA 2XHXA 4I3HA 1B3QA 1Z5BA 2JKIA 1UYFA 1GKXA 4URLA 4URNA 3K60A 4R1FA 4YKYA 5D7CA 4ASAA 4BXIA 4H7QA 2CG9A 2IWSA 2YE4A 3B25A 4CWPA 2XCMA 2XJJA 4GQTA 4CWQA 4WUDA 4B7PA 3G75A 3KE6A 2YECA 4JAUA 2GFDA 3ZM7A 1BXDA 3RKZA 1YESA 5F5RA 3A0ZA 2QF6A 3B27A 3EKRA 2CCTA 2YKEA 4JAVA 3SL2A 1YETA 3EKOA 2Q8FA 2CCSA 2BYHA 2IOQA 5FNCA 4L93A 5GGZA 4WUBA 4ASFA 3GIGB 2YEHA 3D2RA 1YT0A 3CWVA 3FV5A 4X9LA 1YC1A 4ASBA 2YEAA 1MU5A 1Y8NA 1AMWA 3EHJA 2VCIA 4FCQA 2BT0A 4FCRA 3GIEA 4EFUA 2YEIA 1I5CA 4AS9A 3T0HA 4LWHA 1UY8A 1YS3A 2VCJA 4LWFA 5FWKA 1Y8OA 5M4NA 1UYEA 2BREA 2YE7A 4PL9A 5IDJA 1UY7A 4YKQA 2JJCA 4H85A 4BQGA 3FT8A 2YE2A 3IEDA 2YE6A 3PEHA 4K4OA 5M4HA 3U2DA 4XDMA 4KQVA 4LWGA 5CF0A 3OWDA 3QDDA 3R4NA 3CGZA 2WI7A 4PRVA 1L0OA 4URMA 1A4HA 1AJ6A 3TUHA 2EXLA 1TC6A 2VWCA 2Q2EB 2VW5A 3D0BA 3VHCA 3H4LA 3A0YA 3HEKA 1UYCA 1Z5CA 4P7AA 4KSHA 3FT5A 4XD8A 2O1UA 4XKOA 3RLPA 4EGKA 4QPJA 3A0WA 2XABA 3C0EA 4FMTA 1BGQA 3CGYA 2YI7A 1Y8PA 3OW6A 4O0BA 4DUHA 4W7TA 1TBWA 5BODA 3B24A 2FWYA 1YT1A 4R3AA 1YERA 2ESAA 3K98A 1UYIA 4L90A 4Q20A 3R92A 1MX0A 4KP4A 4EGHA 4KFGA 3OWBA 4O07A 4BIUA 4MPCA 5FNFA 1THNA 2QG2A 2Q8GA 3EHFA 4CE3A 1YSRA 4MPNA 1NHHA 1OSFA 3R91A 4BQJA 2IWUA 4XKKA 2O1VA 4EM7A 4U7NA 2ZDYA 3WQ9A 2WEQA 3QTFA 2ZDXA 2HG1A 3Q5LA 3K99A 2YKBA 5IN9A 4MB9A 3GIGA 3EHGA 5CTWA 4CWTA 2XX2A 2XX4A 2YK2A 2QFOA 2XDXA 1US7A 2BZ5A 1Z5AA 1I5BA 1B63A 3A0RA 3Q5KA 3T1KA 2BRCA 4V25A 1UYKA 2YKIA 1YC3A 3H80A 4V26A 4YKZA 2WERA 4MP2A 3ZXQA 4AWOA 4AWPA 1EA6A 3VHAA 2WI4A 4MP7A 4YKUA 3GIFA 4XCJA 2H8MA 5F3KA 2BU8A 2C2AA 5J6AA 2BSMA 4R3MA 1I5AA 3HZ1A 4HZ0A 5FNDA 2GQPA 4QPKA 1QZRA 3TZ0A 4GGLA 4GCZA 2PNRA 2XX5A 3G7BA 3HZ5A 4YKRA 3D36A 2FWZA 4XIRA 3TZ2A 1ZXMA 2YJWA 3VADA 2BU6A 1QY8A 2HCHA 1BYQA 1I58A 4EFTA 2XDUA 2CGFA 4EMVA 3CRKA 3OMUA 4O05A 3WHAA 2WI2A 2ZKJA 4NH9A 3ZKDA 1JM6A 4HZ5A 2ZBKB 1EI1A 2YEJA 4BAEA 3O6OA 4U7OA 4XITA 4LPBA 3U2KA 2YGAA 2CH4A 4CWRA 2XD6A 4HXWA 3B26A 4XCLA 4HY1A 4HYMA 4KTNA 2YEBA 2BU2A 4XC0A 3PEJA 2XDKA 3RLRA 1NHIA 3B28A 2XK2A 3T0ZA 3ZKBA 4PRXA 1PVGA 3MNRP 1ZXNA 4L8ZA 4B6CA 2WEPA 3HYYA 5CTUA 5C93A 2YE9A 2Q8IA 4CWOA 5J71A 3A0XA 2BU7A 4YKWA 1NHJA 4WUCA 2YE3A 4O09A 3INWA 1AH6A 5M4PA 2BU5A 3LNUA 4FCPA 5D7RA 5D7DA 1UYLA 1YSZA 4MOTA 4YKTA 3R4PA 4E00A 4ZVIA 2K5BA 3BMYA 1ZW9A 4NH8A 4FPPA 1QYEA 1Y4UA 5M4EA 3VHDA 3K97A 3R4OA 1KZNA 5CTYA 4CWFA 1AH8A 4PU9A 2H55A 4UROA 4JASA 2YEEA 2WI3A 4ASGA 4ZKIA 2WI6A 1BKNA 4MBCA 1TIDA 3BM9A 2YEDA 2YE8A 4XIPA 5L3JA 5D6QA 4H81A 4U93A 2BTZA 3ZXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHT A;  5CTX A;  2Q8H A;  1TH8 A;  2FYP A;  2YJX A;  2IOR A;  4XIQ A;  1I59 A;  4CE1 A;  2YKC A;  1KIJ A;  2YKJ A;  5D6P A;  5IDM A;  3A0T A;  3R4M A;  1TIL A;  3T2S A;  3RLQ A;  4GFN A;  1UY9 A;  2XDS A;  1I5D A;  1UYM A;  1ZWH A;  1UYH A;  3HYZ A;  4XTJ A;  2XJX A;  2XJG A;  4GT8 A;  2AKP A;  4XE2 A;  1UYD A;  1UYG A;  1S14 A;  2IOP A;  3OPD A;  4L91 A;  5CPH A;  2YGE A;  2HKJ A;  1YT2 A;  3G7E A;  4LWE A;  2CCU A;  2YEF A;  4O04 A;  2IWX A;  4I5S A;  1R62 A;  3LPS A;  1AM1 A;  2WI1 A;  4NH7 A;  1Z59 A;  3NMQ A;  2QG0 A;  2WI5 A;  3O2F A;  2YK9 A;  1U2O A;  3CRL A;  3Q5J A;  3TZ4 A;  3C11 A;  2UWD A;  4E01 A;  4GEE A;  3TTZ A;  4LWI A;  2YI6 A;  4BIZ A;  3T10 A;  2O1W A;  3O0I A;  1H7S A;  1Y4S A;  2E0A A;  1S16 A;  4EEH A;  1UY6 A;  2YI5 A;  4AWQ A;  2YGF A;  4CWN A;  4CWS A;  3HHU A;  4P8O A;  4HXZ A;  4CE2 A;  1GKZ A;  4E02 A;  2BYI A;  1TC0 A;  1GJV A;  4DZY A;  4EGI A;  1ID0 A;  3U67 A;  4LP0 A;  4KSG A;  1U0Z A;  1B62 A;  2YI0 A;  5M4M A;  4L94 A;  1YC4 A;  4HY6 A;  4YKX A;  5M4K A;  2YEG A;  4HYP A;  3EHH A;  1H7U A;  3INX A;  2FXS A;  3JZ3 A;  2XHR A;  2XDL A;  3TZ5 A;  2YE5 A;  5BOC A;  4XKA A;  4MPE A;  3DGE A;  4JQL A;  2XHX A;  4I3H A;  1B3Q A;  1Z5B A;  2JKI A;  1UYF A;  1GKX A;  4URL A;  4URN A;  3K60 A;  4R1F A;  4YKY A;  5D7C A;  4ASA A;  4BXI A;  4H7Q A;  2CG9 A;  2IWS A;  2YE4 A;  3B25 A;  4CWP A;  2XCM A;  2XJJ A;  4GQT A;  4CWQ A;  4WUD A;  4B7P A;  3G75 A;  3KE6 A;  2YEC A;  4JAU A;  2GFD A;  3ZM7 A;  1BXD A;  3RKZ A;  1YES A;  5F5R A;  3A0Z A;  2QF6 A;  3B27 A;  3EKR A;  2CCT A;  2YKE A;  4JAV A;  3SL2 A;  1YET A;  3EKO A;  2Q8F A;  2CCS A;  2BYH A;  2IOQ A;  5FNC A;  4L93 A;  5GGZ A;  4WUB A;  4ASF A;  3GIG B;  2YEH A;  3D2R A;  1YT0 A;  3CWV A;  3FV5 A;  4X9L A;  1YC1 A;  4ASB A;  2YEA A;  1MU5 A;  1Y8N A;  1AMW A;  3EHJ A;  2VCI A;  4FCQ A;  2BT0 A;  4FCR A;  3GIE A;  4EFU A;  2YEI A;  1I5C A;  4AS9 A;  3T0H A;  4LWH A;  1UY8 A;  1YS3 A;  2VCJ A;  4LWF A;  5FWK A;  1Y8O A;  5M4N A;  1UYE A;  2BRE A;  2YE7 A;  4PL9 A;  5IDJ A;  1UY7 A;  4YKQ A;  2JJC A;  4H85 A;  4BQG A;  3FT8 A;  2YE2 A;  3IED A;  2YE6 A;  3PEH A;  4K4O A;  5M4H A;  3U2D A;  4XDM A;  4KQV A;  4LWG A;  5CF0 A;  3OWD A;  3QDD A;  3R4N A;  3CGZ A;  2WI7 A;  4PRV A;  1L0O A;  4URM A;  1A4H A;  1AJ6 A;  3TUH A;  2EXL A;  1TC6 A;  2VWC A;  2Q2E B;  2VW5 A;  3D0B A;  3VHC A;  3H4L A;  3A0Y A;  3HEK A;  1UYC A;  1Z5C A;  4P7A A;  4KSH A;  3FT5 A;  4XD8 A;  2O1U A;  4XKO A;  3RLP A;  4EGK A;  4QPJ A;  3A0W A;  2XAB A;  3C0E A;  4FMT A;  1BGQ A;  3CGY A;  2YI7 A;  1Y8P A;  3OW6 A;  4O0B A;  4DUH A;  4W7T A;  1TBW A;  5BOD A;  3B24 A;  2FWY A;  1YT1 A;  4R3A A;  1YER A;  2ESA A;  3K98 A;  1UYI A;  4L90 A;  4Q20 A;  3R92 A;  1MX0 A;  4KP4 A;  4EGH A;  4KFG A;  3OWB A;  4O07 A;  4BIU A;  4MPC A;  5FNF A;  1THN A;  2QG2 A;  2Q8G A;  3EHF A;  4CE3 A;  1YSR A;  4MPN A;  1NHH A;  1OSF A;  3R91 A;  4BQJ A;  2IWU A;  4XKK A;  2O1V A;  4EM7 A;  4U7N A;  2ZDY A;  3WQ9 A;  2WEQ A;  3QTF A;  2ZDX A;  2HG1 A;  3Q5L A;  3K99 A;  2YKB A;  5IN9 A;  4MB9 A;  3GIG A;  3EHG A;  5CTW A;  4CWT A;  2XX2 A;  2XX4 A;  2YK2 A;  2QFO A;  2XDX A;  1US7 A;  2BZ5 A;  1Z5A A;  1I5B A;  1B63 A;  3A0R A;  3Q5K A;  3T1K A;  2BRC A;  4V25 A;  1UYK A;  2YKI A;  1YC3 A;  3H80 A;  4V26 A;  4YKZ A;  2WER A;  4MP2 A;  3ZXQ A;  4AWO A;  4AWP A;  1EA6 A;  3VHA A;  2WI4 A;  4MP7 A;  4YKU A;  3GIF A;  4XCJ A;  2H8M A;  5F3K A;  2BU8 A;  2C2A A;  5J6A A;  2BSM A;  4R3M A;  1I5A A;  3HZ1 A;  4HZ0 A;  5FND A;  2GQP A;  4QPK A;  1QZR A;  3TZ0 A;  4GGL A;  4GCZ A;  2PNR A;  2XX5 A;  3G7B A;  3HZ5 A;  4YKR A;  3D36 A;  2FWZ A;  4XIR A;  3TZ2 A;  1ZXM A;  2YJW A;  3VAD A;  2BU6 A;  1QY8 A;  2HCH A;  1BYQ A;  1I58 A;  4EFT A;  2XDU A;  2CGF A;  4EMV A;  3CRK A;  3OMU A;  4O05 A;  3WHA A;  2WI2 A;  2ZKJ A;  4NH9 A;  3ZKD A;  1JM6 A;  4HZ5 A;  2ZBK B;  1EI1 A;  2YEJ A;  4BAE A;  3O6O A;  4U7O A;  4XIT A;  4LPB A;  3U2K A;  2YGA A;  2CH4 A;  4CWR A;  2XD6 A;  4HXW A;  3B26 A;  4XCL A;  4HY1 A;  4HYM A;  4KTN A;  2YEB A;  2BU2 A;  4XC0 A;  3PEJ A;  2XDK A;  3RLR A;  1NHI A;  3B28 A;  2XK2 A;  3T0Z A;  3ZKB A;  4PRX A;  1PVG A;  3MNR P;  1ZXN A;  4L8Z A;  4B6C A;  2WEP A;  3HYY A;  5CTU A;  5C93 A;  2YE9 A;  2Q8I A;  4CWO A;  5J71 A;  3A0X A;  2BU7 A;  4YKW A;  1NHJ A;  4WUC A;  2YE3 A;  4O09 A;  3INW A;  1AH6 A;  5M4P A;  2BU5 A;  3LNU A;  4FCP A;  5D7R A;  5D7D A;  1UYL A;  1YSZ A;  4MOT A;  4YKT A;  3R4P A;  4E00 A;  4ZVI A;  2K5B A;  3BMY A;  1ZW9 A;  4NH8 A;  4FPP A;  1QYE A;  1Y4U A;  5M4E A;  3VHD A;  3K97 A;  3R4O A;  1KZN A;  5CTY A;  4CWF A;  1AH8 A;  4PU9 A;  2H55 A;  4URO A;  4JAS A;  2YEE A;  2WI3 A;  4ASG A;  4ZKI A;  2WI6 A;  1BKN A;  4MBC A;  1TID A;  3BM9 A;  2YED A;  2YE8 A;  4XIP A;  5L3J A;  5D6Q A;  4H81 A;  4U93 A;  2BTZ A;  3ZXO A; 
#chains in the Genus database with same CATH topology
 4WJY A;  3X29 A;  2UXW A;  2XHT A;  1FS8 A;  2EBA A;  2Q8H A;  1TH8 A;  5CTX A;  2FYP A;  2YJX A;  2IOR A;  4XIQ A;  1I59 A;  1R3B A;  4CE1 A;  4QIC A;  2YKC A;  1KIJ A;  2YKJ A;  2RFQ A;  4Q17 A;  4E72 A;  2HJN A;  5D6P A;  5IDM A;  2R0M A;  3D9G A;  3A0T A;  3R4M A;  1TIL A;  3T2S A;  3RLQ A;  4N5F A;  2GBB A;  4GFN A;  1XFV A;  2JBS A;  5K3H A;  1UY9 A;  1IXM A;  3HWC A;  2XDS A;  1I5D A;  1UYM A;  1ZWH A;  1UYH A;  3LGQ A;  3HYZ A;  4XTJ A;  1XFY A;  2XJX A;  2XJG A;  4GT8 A;  2YYM A;  2AKP A;  3S7W A;  1UYD A;  3SWO A;  1UYG A;  1S14 A;  2PO4 A;  4XE2 A;  2IOP A;  3OPD A;  3D1I A;  3Q23 A;  4L91 A;  5CPH A;  3Q22 A;  2YGE A;  4AKG A;  2HKJ A;  1R2J A;  1YT2 A;  3G7E A;  4LWE A;  5K3J A;  2CCU A;  3UBR A;  2YEF A;  4O04 A;  3MPI A;  2IWX A;  4I5S A;  2XQR B;  1R62 A;  2CJ8 A;  3LPS A;  2FON A;  1F51 A;  3GQT A;  1AM1 A;  2WI1 A;  4NH7 A;  1Z59 A;  3NMQ A;  3KML A;  2QG0 A;  2WI5 A;  3O2F A;  2YK9 A;  1U2O A;  1XFX A;  3CRL A;  1OAH A;  4KCF A;  3MXL A;  2AO2 A;  1IVH A;  3Q5J A;  3TZ4 A;  2R03 A;  3C11 A;  1WS9 A;  3NF4 A;  2UWD A;  4E01 A;  3PFD A;  2R02 A;  4JEK A;  4GEE A;  3TTZ A;  4LWI A;  2YI6 A;  4BIZ A;  3T10 A;  2O1W A;  3O0I A;  1H7S A;  1Y4S A;  2E0A A;  4HR3 A;  2JBR A;  1S16 A;  4EEH A;  1UY6 A;  4O5M A;  2YI5 A;  4AWQ A;  2YGF A;  4CWN A;  4CWS A;  3N0R A;  2D29 A;  3HHU A;  4P8O A;  4HXZ A;  1RX0 A;  2C1I A;  1GKZ A;  4E02 A;  2BYI A;  4CE2 A;  1TC0 A;  2RDZ A;  3BNJ A;  1GJV A;  4J1V A;  4L38 A;  4DZY A;  3D6B A;  4EGI A;  1ID0 A;  4KTO A;  4NXL A;  3U67 A;  1RJ4 A;  4LP0 A;  2DVL A;  4KSG A;  1U0Z A;  3SF6 A;  1X90 A;  2VIG A;  1B62 A;  5M4M A;  2YI0 A;  1YC4 A;  1FS9 A;  4X28 C;  4L94 A;  4HY6 A;  3M9V A;  4YKX A;  2CX9 A;  5M4K A;  5GJV E;  3Q0A A;  5JEN A;  4G5E A;  4FF1 A;  2YEG A;  3X0Y A;  4HYP A;  2QR4 A;  3EHH A;  1H7U A;  3X0X A;  3INX A;  4P79 A;  3MKH A;  4L3Y A;  3R7K A;  2FXS A;  3JZ3 A;  2XHR A;  4IV6 A;  2XDL A;  3TZ5 A;  2YE5 A;  5BOC A;  4XKA A;  4JIZ A;  4MPE A;  4HKS A;  3DGE A;  4JQL A;  2XHX A;  4I3H A;  3SXQ A;  1B3Q A;  1Z5B A;  2JKI A;  1UYF A;  1GKX A;  4URL A;  4URN A;  3K60 A;  4R1F A;  4YKY A;  5BRK A;  5D7C A;  4ASA A;  4BXI A;  4H7Q A;  1QDB A;  2JIF A;  2CG9 A;  2IWS A;  2PG0 A;  2VF1 A;  2YE4 A;  4L3Z A;  3B25 A;  4CWP A;  2XCM A;  2XJJ A;  4GQT A;  4CWQ A;  4WUD A;  1UKW A;  4B7P A;  3G75 A;  3KE6 A;  1UDY A;  2YEC A;  4F0X A;  4JAU A;  2GFD A;  3ZM7 A;  1BXD A;  3RKZ A;  1YES A;  5F5R A;  3A0Z A;  2QF6 A;  1XFU A;  2EC5 A;  3B27 A;  3EKR A;  2CCT A;  2YKE A;  4JAV A;  3SL2 A;  1YET A;  3EKO A;  2Q8F A;  2CCS A;  2BYH A;  2IOQ A;  5FNC A;  4L93 A;  5GGZ A;  4WUB A;  4ASF A;  3GIG B;  3OWM A;  1SIR A;  2YEH A;  3D2R A;  1YT0 A;  1IS2 A;  3CWV A;  3FV5 A;  4X9L A;  1YC1 A;  4ASB A;  2YEA A;  1MU5 A;  1Y8N A;  4FF2 A;  1AMW A;  2VCI A;  3EHJ A;  4FCQ A;  2BT0 A;  1T9G A;  4AS9 A;  2EBH X;  3GIE A;  4FCR A;  3GM6 A;  4EFU A;  2YEI A;  2FP1 A;  3TTB A;  1I5C A;  3T0H A;  4LWH A;  1UY8 A;  5B5W A;  1YS3 A;  2VCJ A;  4LWF A;  3S5T A;  5FWK A;  1JQI A;  1Y8O A;  5M4N A;  4XVX A;  1UYE A;  2BRE A;  4OO2 A;  3MMO A;  2YE7 A;  4PL9 A;  5IDJ A;  1UY7 A;  4YKQ A;  2JJC A;  4H85 A;  3B96 A;  3EON A;  4BQG A;  4W9U A;  3FT8 A;  2YE2 A;  4AKI A;  3IED A;  2YE6 A;  4FF4 A;  3CYG A;  3PEH A;  4K4O A;  2C1G A;  5M4H A;  1K90 A;  3U2D A;  4XDM A;  4IRN A;  2R0N A;  2CJ5 A;  4KQV A;  4LWG A;  2XS1 A;  5CF0 A;  3OWD A;  1LVC A;  3MPJ A;  3QDD A;  2FTK A;  2AZE A;  3R4N A;  1FS7 A;  3AFF A;  3OWA A;  3CGZ A;  5BRM A;  2WI7 A;  4PRV A;  3OIB A;  3CE2 A;  1L0O A;  4URM A;  1A4H A;  3UU9 A;  2C0U A;  1AJ6 A;  3TUH A;  4Q5C A;  1X91 A;  2EXL A;  4U83 A;  3D9F A;  3RKH A;  1TC6 A;  2VWC A;  2OEV A;  2Q2E B;  2VW5 A;  3P4T A;  3D0B A;  4X28 A;  3A0Y A;  3H4L A;  1UYC A;  5K3I A;  3HEK A;  3VHC A;  3L1T A;  1Z5C A;  4P7A A;  4KSH A;  3FT5 A;  4XD8 A;  2O1U A;  4XKO A;  3RLP A;  4EGK A;  4QPJ A;  3A0W A;  1EGD A;  2XAB A;  3C0E A;  4FMT A;  1BGQ A;  3CGY A;  5B5V A;  2YI7 A;  1Y8P A;  3OW6 A;  4O0B A;  4ZYJ A;  2A1T A;  4DUH A;  4W7T A;  1PK0 A;  1TBW A;  5BOD A;  4P13 A;  3B24 A;  2FWY A;  2HHI A;  2FP2 A;  3FO3 A;  1YT1 A;  4R3A A;  1YER A;  2ESA A;  3K98 A;  1UYI A;  4L90 A;  4Q20 A;  3R92 A;  3C46 A;  4ZXV A;  1MX0 A;  4AI6 A;  4KP4 A;  4EGH A;  4KFG A;  3OWB A;  4O07 A;  2R05 A;  2YGW A;  3BNF A;  4BIU A;  4MPC A;  5FNF A;  1THN A;  2QG2 A;  4Q4U A;  2Q8G A;  3EHF A;  4CE3 A;  3AFE A;  1YSR A;  4MPN A;  1NHH A;  1OSF A;  3R91 A;  3LMM A;  4BQJ A;  2YYI A;  2IWU A;  2IX5 A;  2J7A A;  4XKK A;  1W07 A;  2O1V A;  4EM7 A;  4U7N A;  2ZDY A;  3WQ9 A;  2Z1Q A;  2OEX A;  2WEQ A;  3QTF A;  2ZDX A;  2HG1 A;  3Q5L A;  3K99 A;  2YKB A;  5IN9 A;  4MB9 A;  3GIG A;  3EHG A;  5CTW A;  4JIO A;  4CWT A;  1EGC A;  2XX2 A;  2XX4 A;  2YK2 A;  4RM7 A;  3TOR A;  1Y0V A;  2QFO A;  4G97 A;  4DOY A;  2ZO5 A;  4KS9 A;  2XDX A;  1US7 A;  3II9 A;  2ZAF A;  1K93 A;  5B6B A;  2BZ5 A;  1RP3 A;  3C3L A;  1Z5A A;  1I5B A;  4L1F A;  1B63 A;  3A0R A;  3VKH A;  3Q5K A;  2IX6 A;  3T1K A;  2BRC A;  4V25 A;  1UYK A;  2YKI A;  2EBF X;  1YC3 A;  3H80 A;  1X8Z A;  3BNH A;  4V26 A;  4YKZ A;  4HKR A;  2WER A;  4MP2 A;  3ZXQ A;  4AWO A;  1S26 A;  4FF3 A;  1EA6 A;  4AWP A;  3VHA A;  2WI4 A;  4MP7 A;  4YKU A;  3GIF A;  4XCJ A;  2H8M A;  5F3K A;  2BU8 A;  2C2A A;  5J6A A;  2BSM A;  4R3M A;  1I5A A;  3HZ1 A;  4HZ0 A;  5FND A;  2GQP A;  4QPK A;  1QZR A;  3TZ0 A;  2WBI A;  2LFW A;  2OR0 A;  4GGL A;  4GCZ A;  2PNR A;  2XX5 A;  3G7B A;  3HZ5 A;  4YKR A;  3D36 A;  2FWZ A;  4XIR A;  3TZ2 A;  1ZXM A;  2YJW A;  3LG1 A;  3VAD A;  2BU6 A;  1QY8 A;  3D9D A;  2HCH A;  2YYG A;  1BYQ A;  1I58 A;  4EFT A;  1EGE A;  1GU6 A;  3BNG A;  2XDU A;  2CGF A;  4EMV A;  3CRK A;  3OMU A;  4O05 A;  1SK6 A;  3VKG A;  2YYJ A;  2ZKJ A;  1SC5 A;  2WI2 A;  4NH9 A;  3WHA A;  2RF7 A;  3ZKD A;  1JM6 A;  4M9A A;  4HZ5 A;  2VR0 A;  2ZBK B;  1EI1 A;  2YEJ A;  4BAE A;  3O6O A;  2DDH A;  4U7O A;  4XIT A;  4LPB A;  3U2K A;  2YGA A;  2CJ4 A;  2C12 A;  5GJW E;  2CH4 A;  4CWR A;  4LQS B;  4AKH A;  1K8T A;  2XD6 A;  4HXW A;  3B26 A;  4XCL A;  4HY1 A;  1PI1 A;  4HYM A;  4KTN A;  2YEB A;  2BU2 A;  1XFW A;  3F29 A;  4Q0T A;  4XC0 A;  3PEJ A;  2REH A;  2XDK A;  3RLR A;  1NHI A;  3B28 A;  2XK2 A;  4Q1O A;  1SIQ A;  3T0Z A;  3ZKB A;  4PRX A;  1PVG A;  1BUC A;  4KSA A;  3MNR P;  1ZXN A;  4L8Z A;  4B6C A;  3C2P A;  2WEP A;  3HYY A;  3FCJ A;  2CJ6 A;  5C93 A;  5CTU A;  2YE9 A;  2Q8I A;  4CWO A;  5J71 A;  3A0X A;  2BU7 A;  4YKW A;  1NHJ A;  2CJ7 A;  2XS8 A;  3MDE A;  4WUC A;  2YE3 A;  4O09 A;  3INW A;  1AH6 A;  5M4P A;  2BU5 A;  1XG2 B;  3LNU A;  2OJQ A;  4FCP A;  5D7R A;  5D7D A;  1UYL A;  2JBT A;  1YSZ A;  2F6L A;  4MOT A;  3R4P A;  1U8V A;  4E00 A;  4YKT A;  4ZVI A;  2K5B A;  3SCE A;  3BMY A;  3GNC A;  1ZW9 A;  4NH8 A;  4FPP A;  1QYE A;  1Y4U A;  5M4E A;  1RJ1 A;  3VHD A;  3K97 A;  3R4O A;  1KZN A;  2OT4 A;  3Q24 A;  3EOM A;  5CTY A;  4CWF A;  1XFZ A;  1AH8 A;  4PU9 A;  4Q5B A;  2H55 A;  4JAS A;  4URO A;  2E80 A;  2YEE A;  2WI3 A;  3MDD A;  4ASG A;  4ZKI A;  2WI6 A;  2E81 A;  1BKN A;  3D9E A;  2YYK A;  4MBC A;  2YYL A;  1TID A;  3BM9 A;  4LQQ B;  2YED A;  2YE8 A;  4XIP A;  5L3J A;  4FZ4 A;  5D6Q A;  4H81 A;  4U93 A;  2BTZ A;  3ZXO A;  4L3X A;  4KSF A;  5K3G A; 
#chains in the Genus database with same CATH homology
 2XHT A;  5CTX A;  2Q8H A;  1TH8 A;  2FYP A;  2YJX A;  2IOR A;  4XIQ A;  1I59 A;  4CE1 A;  2YKC A;  1KIJ A;  2YKJ A;  5D6P A;  5IDM A;  3A0T A;  3R4M A;  1TIL A;  3T2S A;  3RLQ A;  4GFN A;  1UY9 A;  2XDS A;  1I5D A;  1UYM A;  1ZWH A;  1UYH A;  3HYZ A;  4XTJ A;  2XJX A;  2XJG A;  4GT8 A;  2AKP A;  4XE2 A;  1UYD A;  1UYG A;  1S14 A;  2IOP A;  3OPD A;  4L91 A;  5CPH A;  2YGE A;  2HKJ A;  1YT2 A;  3G7E A;  4LWE A;  2CCU A;  2YEF A;  4O04 A;  2IWX A;  4I5S A;  1R62 A;  3LPS A;  1AM1 A;  2WI1 A;  4NH7 A;  1Z59 A;  3NMQ A;  2QG0 A;  2WI5 A;  3O2F A;  2YK9 A;  1U2O A;  3CRL A;  3Q5J A;  3TZ4 A;  3C11 A;  2UWD A;  4E01 A;  4GEE A;  3TTZ A;  4LWI A;  2YI6 A;  4BIZ A;  3T10 A;  2O1W A;  3O0I A;  1H7S A;  1Y4S A;  2E0A A;  1S16 A;  4EEH A;  1UY6 A;  2YI5 A;  4AWQ A;  2YGF A;  4CWN A;  4CWS A;  3HHU A;  4P8O A;  4HXZ A;  4CE2 A;  1GKZ A;  4E02 A;  2BYI A;  1TC0 A;  1GJV A;  4DZY A;  4EGI A;  1ID0 A;  3U67 A;  4LP0 A;  4KSG A;  1U0Z A;  1B62 A;  2YI0 A;  5M4M A;  4L94 A;  1YC4 A;  4HY6 A;  4YKX A;  5M4K A;  2YEG A;  4HYP A;  3EHH A;  1H7U A;  3INX A;  2FXS A;  3JZ3 A;  2XHR A;  2XDL A;  3TZ5 A;  2YE5 A;  5BOC A;  4XKA A;  4MPE A;  3DGE A;  4JQL A;  2XHX A;  4I3H A;  1B3Q A;  1Z5B A;  2JKI A;  1UYF A;  1GKX A;  4URL A;  4URN A;  3K60 A;  4R1F A;  4YKY A;  5D7C A;  4ASA A;  4BXI A;  4H7Q A;  2CG9 A;  2IWS A;  2YE4 A;  3B25 A;  4CWP A;  2XCM A;  2XJJ A;  4GQT A;  4CWQ A;  4WUD A;  4B7P A;  3G75 A;  3KE6 A;  2YEC A;  4JAU A;  2GFD A;  3ZM7 A;  1BXD A;  3RKZ A;  1YES A;  5F5R A;  3A0Z A;  2QF6 A;  3B27 A;  3EKR A;  2CCT A;  2YKE A;  4JAV A;  3SL2 A;  1YET A;  3EKO A;  2Q8F A;  2CCS A;  2BYH A;  2IOQ A;  5FNC A;  4L93 A;  5GGZ A;  4WUB A;  4ASF A;  3GIG B;  2YEH A;  3D2R A;  1YT0 A;  3CWV A;  3FV5 A;  4X9L A;  1YC1 A;  4ASB A;  2YEA A;  1MU5 A;  1Y8N A;  1AMW A;  3EHJ A;  2VCI A;  4FCQ A;  2BT0 A;  4FCR A;  3GIE A;  4EFU A;  2YEI A;  1I5C A;  4AS9 A;  3T0H A;  4LWH A;  1UY8 A;  1YS3 A;  2VCJ A;  4LWF A;  5FWK A;  1Y8O A;  5M4N A;  1UYE A;  2BRE A;  2YE7 A;  4PL9 A;  5IDJ A;  1UY7 A;  4YKQ A;  2JJC A;  4H85 A;  4BQG A;  3FT8 A;  2YE2 A;  3IED A;  2YE6 A;  3PEH A;  4K4O A;  5M4H A;  3U2D A;  4XDM A;  4KQV A;  4LWG A;  5CF0 A;  3OWD A;  3QDD A;  3R4N A;  3CGZ A;  2WI7 A;  4PRV A;  1L0O A;  4URM A;  1A4H A;  1AJ6 A;  3TUH A;  2EXL A;  1TC6 A;  2VWC A;  2Q2E B;  2VW5 A;  3D0B A;  3VHC A;  3H4L A;  3A0Y A;  3HEK A;  1UYC A;  1Z5C A;  4P7A A;  4KSH A;  3FT5 A;  4XD8 A;  2O1U A;  4XKO A;  3RLP A;  4EGK A;  4QPJ A;  3A0W A;  2XAB A;  3C0E A;  4FMT A;  1BGQ A;  3CGY A;  2YI7 A;  1Y8P A;  3OW6 A;  4O0B A;  4DUH A;  4W7T A;  1TBW A;  5BOD A;  3B24 A;  2FWY A;  1YT1 A;  4R3A A;  1YER A;  2ESA A;  3K98 A;  1UYI A;  4L90 A;  4Q20 A;  3R92 A;  1MX0 A;  4KP4 A;  4EGH A;  4KFG A;  3OWB A;  4O07 A;  4BIU A;  4MPC A;  5FNF A;  1THN A;  2QG2 A;  2Q8G A;  3EHF A;  4CE3 A;  1YSR A;  4MPN A;  1NHH A;  1OSF A;  3R91 A;  4BQJ A;  2IWU A;  4XKK A;  2O1V A;  4EM7 A;  4U7N A;  2ZDY A;  3WQ9 A;  2WEQ A;  3QTF A;  2ZDX A;  2HG1 A;  3Q5L A;  3K99 A;  2YKB A;  5IN9 A;  4MB9 A;  3GIG A;  3EHG A;  5CTW A;  4CWT A;  2XX2 A;  2XX4 A;  2YK2 A;  2QFO A;  2XDX A;  1US7 A;  2BZ5 A;  1Z5A A;  1I5B A;  1B63 A;  3A0R A;  3Q5K A;  3T1K A;  2BRC A;  4V25 A;  1UYK A;  2YKI A;  1YC3 A;  3H80 A;  4V26 A;  4YKZ A;  2WER A;  4MP2 A;  3ZXQ A;  4AWO A;  4AWP A;  1EA6 A;  3VHA A;  2WI4 A;  4MP7 A;  4YKU A;  3GIF A;  4XCJ A;  2H8M A;  5F3K A;  2BU8 A;  2C2A A;  5J6A A;  2BSM A;  4R3M A;  1I5A A;  3HZ1 A;  4HZ0 A;  5FND A;  2GQP A;  4QPK A;  1QZR A;  3TZ0 A;  4GGL A;  4GCZ A;  2PNR A;  2XX5 A;  3G7B A;  3HZ5 A;  4YKR A;  3D36 A;  2FWZ A;  4XIR A;  3TZ2 A;  1ZXM A;  2YJW A;  3VAD A;  2BU6 A;  1QY8 A;  2HCH A;  1BYQ A;  1I58 A;  4EFT A;  2XDU A;  2CGF A;  4EMV A;  3CRK A;  3OMU A;  4O05 A;  3WHA A;  2WI2 A;  2ZKJ A;  4NH9 A;  3ZKD A;  1JM6 A;  4HZ5 A;  2ZBK B;  1EI1 A;  2YEJ A;  4BAE A;  3O6O A;  4U7O A;  4XIT A;  4LPB A;  3U2K A;  2YGA A;  2CH4 A;  4CWR A;  2XD6 A;  4HXW A;  3B26 A;  4XCL A;  4HY1 A;  4HYM A;  4KTN A;  2YEB A;  2BU2 A;  4XC0 A;  3PEJ A;  2XDK A;  3RLR A;  1NHI A;  3B28 A;  2XK2 A;  3T0Z A;  3ZKB A;  4PRX A;  1PVG A;  3MNR P;  1ZXN A;  4L8Z A;  4B6C A;  2WEP A;  3HYY A;  5CTU A;  5C93 A;  2YE9 A;  2Q8I A;  4CWO A;  5J71 A;  3A0X A;  2BU7 A;  4YKW A;  1NHJ A;  4WUC A;  2YE3 A;  4O09 A;  3INW A;  1AH6 A;  5M4P A;  2BU5 A;  3LNU A;  4FCP A;  5D7R A;  5D7D A;  1UYL A;  1YSZ A;  4MOT A;  4YKT A;  3R4P A;  4E00 A;  4ZVI A;  2K5B A;  3BMY A;  1ZW9 A;  4NH8 A;  4FPP A;  1QYE A;  1Y4U A;  5M4E A;  3VHD A;  3K97 A;  3R4O A;  1KZN A;  5CTY A;  4CWF A;  1AH8 A;  4PU9 A;  2H55 A;  4URO A;  4JAS A;  2YEE A;  2WI3 A;  4ASG A;  4ZKI A;  2WI6 A;  1BKN A;  4MBC A;  1TID A;  3BM9 A;  2YED A;  2YE8 A;  4XIP A;  5L3J A;  5D6Q A;  4H81 A;  4U93 A;  2BTZ A;  3ZXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...