2Q8FA

Structure of pyruvate dehydrogenase kinase isoform 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
383
structure length
365
Chain Sequence
GVPGQVDFYARFSPSPLSMKQFLDFGSCEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNADDWCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
total genus 129
structure length 365
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8fA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8fA02
2YEBA 2XK2A 3SL2A 4R1FA 2GFDA 3R4MA 5IDJA 1GKZA 1MX0A 3EHHA 1I58A 4U7OA 2YE7A 2YECA 5CPHA 2BRCA 2CG9A 2XHRA 3PEHA 3FT5A 2UWDA 3CRKA 1PVGA 1YT2A 3DGEA 4CWNA 4LWGA 5D6QA 2IOPA 3TTZA 4GGLA 2BU8A 2XCMA 3D2RA 1Y8PA 3VADA 3T0ZA 4XIPA 1QY8A 1Y4SA 4XD8A 1UYEA 3T0HA 3ZKDA 3ZXQA 1TH8A 3K99A 3LNUA 1JM6A 2YE9A 4P8OA 3O0IA 5D7CA 3WQ9A 1TC6A 4MPEA 1UYLA 2IWUA 2YI6A 2HG1A 2XJXA 3ZKBA 4ASBA 4AWOA 4WUBA 4CE3A 4MPNA 2BSMA 2CH4A 2QG2A 2XDUA 2YE6A 2YGAA 4CWQA 4BIZA 4MPCA 1Z5AA 3IEDA 4H81A 4MP7A 4QPJA 2H55A 2YKBA 2Q8IA 1I5CA 3G75A 4FCQA 1I5BA 5L3JA 2IOQA 3ZM7A 4FCPA 4KFGA 1R62A 2K5BA 1GJVA 3D0BA 3BMYA 2XDLA 1Z59A 4KSGA 2YEDA 1ZXNA 1UYFA 2BU2A 1H7UA 4P7AA 4LWIA 2XDKA 4XKKA 4HXWA 2VW5A 2JJCA 2IWXA 4O0BA 5CTWA 2XJJA 5M4KA 2BYHA 5C93A 4XTJA 5BOCA 4GEEA 2ESAA 1UYMA 3CWVA 2Q8HA 3TUHA 1UY8A 4HY1A 3R4NA 1GKXA 5J6AA 2YI5A 1H7SA 4EEHA 3OPDA 3MNRP 4B7PA 4EGKA 4LWHA 4ASAA 2HKJA 3B28A 1ID0A 5CTYA 5FNFA 2VCIA 3FT8A 4PL9A 1YT0A 5CTXA 2YEJA 4YKQA 5D6PA 5IN9A 2FWZA 4K4OA 4FPPA 1UYHA 2HCHA 4YKTA 1YETA 2YE4A 4CWFA 2XDSA 4EFUA 2ZBKB 4E01A 2YJXA 4KSHA 4MBCA 1EI1A 4H7QA 2YGEA 4U7NA 2Q8GA 5D7DA 2FWYA 1BGQA 1EA6A 2YKEA 4NH9A 2XDXA 2YEIA 1I5DA 3CGYA 4KTNA 4YKWA 3B26A 5J71A 1ZXMA 3LPSA 4WUCA 4XCJA 4O04A 2YEHA 2BZ5A 2CGFA 1L0OA 2YEFA 2WEQA 3K60A 3B25A 3Q5JA 2XX5A 3EKOA 4URMA 4E02A 1UYGA 2YE5A 1UYCA 3EHFA 4URLA 2YKIA 2CCUA 4MP2A 4WUDA 4AWQA 3QTFA 2BT0A 3TZ0A 3HZ5A 4QPKA 2WI3A 3VHCA 4ASFA 5D7RA 2YKJA 4HZ0A 2C2AA 1TC0A 4XCLA 2O1WA 3HZ1A 5CTUA 1I5AA 4V26A 1TILA 2XD6A 4CWSA 1AH6A 4ASGA 3Q5KA 3B24A 4L94A 2WI1A 3H4LA 3Q5LA 4XIRA 2YKCA 2XHXA 4R3AA 4KQVA 4AS9A 4O07A 4V25A 4DZYA 3A0TA 2GQPA 3INXA 3U67A 2IWSA 2YK2A 1OSFA 4XKAA 4KP4A 5FNDA 3KE6A 3TZ2A 4GQTA 2VWCA 2Q2EB 3H80A 3HEKA 1Y8OA 2WI6A 4CWRA 4BAEA 2QFOA 2BYIA 3R4PA 1NHHA 2YEGA 2PNRA 1Y4UA 1ZW9A 4FCRA 1KZNA 2YK9A 2ZDYA 1U0ZA 4ZKIA 3A0RA 3HHUA 3T2SA 4XITA 4LP0A 2WI2A 2E0AA 3TZ4A 4W7TA 4L8ZA 4JASA 4XC0A 4ZVIA 5M4NA 1YESA 2VCJA 1AJ6A 2WEPA 4YKZA 2QG0A 4O09A 5F3KA 3T1KA 3QDDA 3JZ3A 2WERA 2XJGA 1UY9A 3G7EA 3RKZA 4CWTA 2CCTA 2XHTA 3GIEA 4I3HA 4XIQA 2JKIA 5FWKA 3O6OA 2WI5A 2CCSA 4LPBA 1YC3A 1YC4A 1B3QA 4YKRA 3NMQA 3VHAA 3TZ5A 4EFTA 2BU7A 1YT1A 1UY6A 4L91A 1TBWA 5F5RA 2YI0A 2BU5A 1BKNA 4CWPA 4HY6A 1A4HA 3A0ZA 1S14A 5BODA 3EKRA 4X9LA 4GFNA 4LWFA 1AH8A 3K98A 4UROA 1B63A 4L93A 1B62A 3EHGA 4HXZA 3U2KA 1AMWA 5M4HA 4LWEA 2XX2A 3A0YA 1U2OA 4MOTA 4BXIA 3HYYA 4PU9A 4GT8A 4CWOA 2BU6A 2BTZA 3G7BA 2AKPA 3BM9A 1UYKA 4HZ5A 5M4PA 3A0XA 3INWA 4EM7A 5IDMA 1NHIA 3O2FA 3OMUA 3PEJA 2XX4A 3R91A 3RLQA 1UYDA 4JAUA 3RLPA 1YSZA 3ZXOA 3GIGB 4NH8A 4EMVA 4YKUA 4O05A 2YEAA 1I59A 3D36A 4NH7A 1YSRA 1NHJA 4DUHA 2YJWA 4MB9A 4HYPA 1BYQA 3C11A 4EGHA 3OWBA 4L90A 2XABA 1UY7A 3C0EA 3A0WA 3EHJA 2O1UA 4XDMA 3WHAA 1UYIA 2YE8A 4CE1A 3GIGA 2FYPA 1US7A 2YE2A 4B6CA 2ZDXA 3FV5A 1MU5A 2YE3A 4U93A 1Z5CA 5GGZA 4H85A 2Q8FA 4BQGA 4AWPA 4Q20A 4PRVA 4R3MA 2YGFA 4XE2A 1YS3A 3U2DA 3CGZA 4YKYA 2BREA 1Z5BA 5FNCA 3OW6A 4GCZA 4URNA 4E00A 4XKOA 4JQLA 5M4EA 4PRXA 3K97A 4BIUA 4I5SA 1YC1A 3GIFA 2O1VA 4EGIA 3CRLA 1KIJA 1QZRA 2IORA 4BQJA 5M4MA 1Y8NA 1QYEA 3R92A 1S16A 1AM1A 5CF0A 2ZKJA 3HYZA 2WI7A 4HYMA 1YERA 4FMTA 2YI7A 1THNA 2YEEA 3RLRA 4CE2A 1ZWHA 2EXLA 2QF6A 1TIDA 2FXSA 3OWDA 2H8MA 4YKXA 2WI4A 3VHDA 4JAVA 3B27A 1BXDA 3T10A 3R4OA
chains in the Genus database with same CATH superfamily
2YEBA 2YYMA 1F51A 3Q22A 2XK2A 3SL2A 4R1FA 2RF7A 4Q5BA 2GFDA 3R4MA 5IDJA 1GKZA 1MX0A 3EHHA 1I58A 4U7OA 4FF2A 4Q17A 2YE7A 1FS7A 2YECA 2BRCA 5CPHA 2CG9A 2XHRA 2R03A 3PEHA 3FT5A 2UWDA 3CRKA 3X0XA 1PVGA 1YT2A 4QICA 3DGEA 3BNHA 4CWNA 3EONA 3MXLA 4LWGA 5D6QA 2IOPA 3TTZA 4J1VA 4GGLA 2BU8A 2XCMA 1RJ4A 1PK0A 3D2RA 1Y8PA 2C12A 3VADA 3VKHA 3LGQA 3T0ZA 4XIPA 1QY8A 2HJNA 1Y4SA 3CYGA 4XD8A 1UYEA 3C3LA 2VIGA 4L38A 3T0HA 3ZKDA 3ZXQA 1TH8A 3K99A 1JM6A 2IX5A 3FO3A 3LNUA 2YE9A 5JENA 4P8OA 4M9AA 3O0IA 4U83A 5D7CA 3WQ9A 1TC6A 2OR0A 2AO2A 4MPEA 1UYLA 2IWUA 2YI6A 2JBTA 2HG1A 3GQTA 2XJXA 3ZKBA 3II9A 4ASBA 4AWOA 4WUBA 4CE3A 4MPNA 2BSMA 2CH4A 2QG2A 2XDUA 2YE6A 2YGAA 4CWQA 4BIZA 4MPCA 4FF1A 2R0NA 1Z5AA 3IEDA 4H81A 4MP7A 4QPJA 1R2JA 2OJQA 2H55A 2YKBA 2Q8IA 1I5CA 3G75A 4FCQA 1I5BA 5L3JA 2R0MA 2RFQA 2IOQA 3ZM7A 4FCPA 4KFGA 3OIBA 1R62A 2K5BA 1GJVA 3D0BA 3BMYA 2XDLA 4AI6A 1Z59A 4KSGA 2YEDA 4Q5CA 1ZXNA 2JBSA 1UYFA 1WS9A 2E81A 2REHA 2BU2A 1H7UA 4P7AA 4LWIA 4FF4A 2XS8A 2XDKA 2FONA 4XKKA 4P79A 4HXWA 2VW5A 2JJCA 2IWXA 4O0BA 5CTWA 2XJJA 1SIRA 5M4KA 2BYHA 5C93A 4XTJA 5BOCA 4GEEA 2CJ6A 2D29A 2ESAA 1UYMA 3CWVA 2Q8HA 3TUHA 1UY8A 4HY1A 3R4NA 1GKXA 4HKSA 5J6AA 2YI5A 1H7SA 4EEHA 3OPDA 1XFZA 3MNRP 2YGWA 4B7PA 4EGKA 4XVXA 4LWHA 4ASAA 2HKJA 3B28A 1ID0A 5CTYA 4X28A 5FNFA 2EBHX 3F29A 2VCIA 3AFEA 3FT8A 1X8ZA 4PL9A 3S7WA 1YT0A 5CTXA 2YEJA 4YKQA 3D9EA 4ZXVA 3D1IA 3Q0AA 5D6PA 2YYJA 2FWZA 5IN9A 1PI1A 4K4OA 4FPPA 1UYHA 1XG2B 3MMOA 2HCHA 4YKTA 1YETA 2YE4A 4CWFA 4KCFA 2UXWA 2XDSA 4EFUA 2J7AA 3LMMA 3BNFA 2ZBKB 4E01A 2YJXA 4KSHA 4MBCA 1EI1A 4H7QA 2YGEA 4U7NA 2Q8GA 5D7DA 2FWYA 1BGQA 1EA6A 3C2PA 3MPIA 2YKEA 4NH9A 2XDXA 2YEIA 1I5DA 3CGYA 4KTNA 4YKWA 4F0XA 3B26A 5J71A 1ZXMA 3LPSA 4WUCA 4XCJA 4O04A 2R05A 2YEHA 2BZ5A 2CGFA 5BRKA 1L0OA 2YEFA 2WEQA 3K60A 1BUCA 3B25A 2DDHA 2ZO5A 3Q5JA 2XX5A 3EKOA 4URMA 4NXLA 4E02A 1UYGA 2YE5A 1UYCA 1K90A 3EHFA 4URLA 3N0RA 2YKIA 2C0UA 2LFWA 2CCUA 4MP2A 4WUDA 4AKIA 4AWQA 3QTFA 2BT0A 3TZ0A 3HZ5A 3BNGA 4QPKA 2WI3A 3VHCA 4ASFA 5D7RA 2YKJA 4HZ0A 2C2AA 1TC0A 4XCLA 2O1WA 3D6BA 3HZ1A 2YYKA 5CTUA 1I5AA 1EGEA 4V26A 3D9FA 1TILA 2XD6A 4CWSA 1AH6A 4ASGA 3Q5KA 3Q24A 3B24A 4L94A 2WI1A 2FP2A 1SC5A 1UDYA 2OT4A 4ZYJA 3H4LA 3Q5LA 4XIRA 2YKCA 1SIQA 2XHXA 4R3AA 4KQVA 2YYGA 4AS9A 2XS1A 4O07A 3VKGA 4V25A 4DZYA 2EC5A 3A0TA 2GQPA 2QR4A 4L3XA 3INXA 3U67A 1R3BA 2IWSA 4AKHA 4JIOA 2RDZA 2YK2A 1JQIA 1OSFA 4XKAA 4KP4A 5FNDA 1RP3A 1XFXA 3TZ2A 3KE6A 4GQTA 1XFYA 2C1IA 2FP1A 2VWCA 2Q2EB 4IV6A 3H80A 2CJ8A 3HEKA 1Y8OA 3PFDA 4JIZA 2R02A 2WI6A 2PG0A 4CWRA 4KSAA 4BAEA 2QFOA 4DOYA 2BYIA 3R4PA 1NHHA 2YEGA 2YYIA 2PNRA 1Y4UA 1ZW9A 4FCRA 1KZNA 2YK9A 2ZDYA 1S26A 1U0ZA 1EGCA 4ZKIA 3A0RA 5GJWE 3HHUA 3T2SA 2FTKA 4XITA 4LP0A 2WI2A 2E0AA 1GU6A 3TZ4A 4W7TA 1T9GA 4L8ZA 4JASA 4XC0A 4ZVIA 5M4NA 4KSFA 1YESA 5GJVE 2VCJA 1AJ6A 1K8TA 2WEPA 4YKZA 2QG0A 4L3ZA 4O09A 2JIFA 1IS2A 5F3KA 3T1KA 3QDDA 3JZ3A 2WERA 5B6BA 2XJGA 1UY9A 3G7EA 3MDDA 3RKZA 4CWTA 2CCTA 2Z1QA 5K3HA 2XHTA 3GIEA 4I3HA 4XIQA 2JKIA 5FWKA 3MKHA 3O6OA 1SK6A 2WI5A 2CCSA 3MPJA 4LPBA 1YC3A 4LQQB 3TTBA 1B3QA 1YC4A 4YKRA 3NMQA 3VHAA 3TZ5A 4EFTA 2BU7A 1IXMA 1YT1A 1UY6A 4L91A 1TBWA 5F5RA 2YI0A 2BU5A 1QDBA 1BKNA 4CWPA 4HY6A 3M9VA 1A4HA 3A0ZA 1S14A 5BODA 3EKRA 2DVLA 4X9LA 4WJYA 4GFNA 4LWFA 2CJ4A 3UBRA 1AH8A 3K98A 1IVHA 4FF3A 4L3YA 4UROA 1B63A 4L93A 1B62A 3EHGA 4HXZA 3EOMA 3C46A 2CJ5A 1AMWA 3U2KA 5M4HA 4LWEA 3L1TA 3X0YA 5BRMA 2XX2A 4OO2A 4JEKA 3A0YA 1FS9A 1U2OA 5B5WA 4G5EA 4MOTA 4BXIA 2GBBA 4P13A 3HYYA 4PU9A 1XFVA 3GM6A 4GT8A 3HWCA 4CWOA 2OEVA 2BU6A 4O5MA 4HKRA 2BTZA 4IRNA 3G7BA 2AKPA 3BM9A 4G97A 1UYKA 4HZ5A 2EBAA 3OWAA 5M4PA 3A0XA 3LG1A 3INWA 4EM7A 4KS9A 1NHIA 3O2FA 3OMUA 5IDMA 3KMLA 3PEJA 2XX4A 3R91A 3RLQA 1UYDA 4JAUA 3RLPA 1YSZA 3ZXOA 3S5TA 3GIGB 4NH8A 2YYLA 4EMVA 4YKUA 1EGDA 4Q4UA 4O05A 3B96A 2YEAA 3RKHA 1I59A 3D36A 4NH7A 1YSRA 2JBRA 3D9GA 3SWOA 1NHJA 1XFWA 3D9DA 4DUHA 2YJWA 4MB9A 4HYPA 3CE2A 1BYQA 2VF1A 3C11A 3AFFA 3OWBA 4EGHA 4L90A 2IX6A 2XABA 4W9UA 3OWMA 4X28C 3SF6A 1UY7A 3C0EA 5K3GA 3A0WA 3Q23A 3EHJA 4Q1OA 2O1UA 4XDMA 3WHAA 1UYIA 2YE8A 4CE1A 3GIGA 2FYPA 1US7A 2YE2A 4B6CA 2E80A 2C1GA 2ZDXA 3FV5A 4KTOA 1MU5A 2CX9A 2YE3A 1RX0A 4FZ4A 5K3IA 4U93A 3BNJA 3X29A 1Z5CA 5GGZA 1X91A 4H85A 2Q8FA 1W07A 2ZAFA 4AWPA 1U8VA 4BQGA 2OEXA 5K3JA 4Q20A 2AZEA 4PRVA 4R3MA 2YGFA 2A1TA 1LVCA 2CJ7A 4XE2A 1RJ1A 1UKWA 1YS3A 3U2DA 3CGZA 4YKYA 3GNCA 2BREA 1Z5BA 1X90A 5FNCA 1Y0VA 3OW6A 4GCZA 4URNA 4E00A 4XKOA 4JQLA 5M4EA 4PRXA 3K97A 4BIUA 4I5SA 3TORA 1YC1A 3GIFA 2O1VA 4EGIA 3R7KA 3CRLA 4RM7A 1KIJA 1QZRA 2IORA 4BQJA 5M4MA 1Y8NA 1XFUA 1QYEA 2WBIA 3P4TA 3R92A 4HR3A 1S16A 1AM1A 2EBFX 4E72A 5B5VA 4L1FA 5CF0A 2ZKJA 4N5FA 3HYZA 2WI7A 4HYMA 3UU9A 1YERA 3SXQA 4FMTA 1OAHA 2YI7A 1THNA 1FS8A 2YEEA 3RLRA 2VR0A 1K93A 4CE2A 1ZWHA 4Q0TA 2F6LA 2EXLA 3NF4A 2QF6A 2PO4A 4LQSB 1TIDA 2FXSA 3OWDA 2H8MA 2HHIA 4YKXA 2WI4A 4AKGA 3MDEA 3VHDA 4JAVA 3B27A 3FCJA 1BXDA 3T10A 2XQRB 3SCEA 3R4OA
chains in the Genus database with same CATH topology
2YEBA 2XK2A 3SL2A 4R1FA 2GFDA 3R4MA 5IDJA 1GKZA 1MX0A 3EHHA 1I58A 4U7OA 2YE7A 2YECA 5CPHA 2BRCA 2CG9A 2XHRA 3PEHA 3FT5A 2UWDA 3CRKA 1PVGA 1YT2A 3DGEA 4CWNA 4LWGA 5D6QA 2IOPA 3TTZA 4GGLA 2BU8A 2XCMA 3D2RA 1Y8PA 3VADA 3T0ZA 4XIPA 1QY8A 1Y4SA 4XD8A 1UYEA 3T0HA 3ZKDA 3ZXQA 1TH8A 3K99A 3LNUA 1JM6A 2YE9A 4P8OA 3O0IA 5D7CA 3WQ9A 1TC6A 4MPEA 1UYLA 2IWUA 2YI6A 2HG1A 2XJXA 3ZKBA 4ASBA 4AWOA 4WUBA 4CE3A 4MPNA 2BSMA 2CH4A 2QG2A 2XDUA 2YE6A 2YGAA 4CWQA 4BIZA 4MPCA 1Z5AA 3IEDA 4H81A 4MP7A 4QPJA 2H55A 2YKBA 2Q8IA 1I5CA 3G75A 4FCQA 1I5BA 5L3JA 2IOQA 3ZM7A 4FCPA 4KFGA 1R62A 2K5BA 1GJVA 3D0BA 3BMYA 2XDLA 1Z59A 4KSGA 2YEDA 1ZXNA 1UYFA 2BU2A 1H7UA 4P7AA 4LWIA 2XDKA 4XKKA 4HXWA 2VW5A 2JJCA 2IWXA 4O0BA 5CTWA 2XJJA 5M4KA 2BYHA 5C93A 4XTJA 5BOCA 4GEEA 2ESAA 1UYMA 3CWVA 2Q8HA 3TUHA 1UY8A 4HY1A 3R4NA 1GKXA 5J6AA 2YI5A 1H7SA 4EEHA 3OPDA 3MNRP 4B7PA 4EGKA 4LWHA 4ASAA 2HKJA 3B28A 1ID0A 5CTYA 5FNFA 2VCIA 3FT8A 4PL9A 1YT0A 5CTXA 2YEJA 4YKQA 5D6PA 5IN9A 2FWZA 4K4OA 4FPPA 1UYHA 2HCHA 4YKTA 1YETA 2YE4A 4CWFA 2XDSA 4EFUA 2ZBKB 4E01A 2YJXA 4KSHA 4MBCA 1EI1A 4H7QA 2YGEA 4U7NA 2Q8GA 5D7DA 2FWYA 1BGQA 1EA6A 2YKEA 4NH9A 2XDXA 2YEIA 1I5DA 3CGYA 4KTNA 4YKWA 3B26A 5J71A 1ZXMA 3LPSA 4WUCA 4XCJA 4O04A 2YEHA 2BZ5A 2CGFA 1L0OA 2YEFA 2WEQA 3K60A 3B25A 3Q5JA 2XX5A 3EKOA 4URMA 4E02A 1UYGA 2YE5A 1UYCA 3EHFA 4URLA 2YKIA 2CCUA 4MP2A 4WUDA 4AWQA 3QTFA 2BT0A 3TZ0A 3HZ5A 4QPKA 2WI3A 3VHCA 4ASFA 5D7RA 2YKJA 4HZ0A 2C2AA 1TC0A 4XCLA 2O1WA 3HZ1A 5CTUA 1I5AA 4V26A 1TILA 2XD6A 4CWSA 1AH6A 4ASGA 3Q5KA 3B24A 4L94A 2WI1A 3H4LA 3Q5LA 4XIRA 2YKCA 2XHXA 4R3AA 4KQVA 4AS9A 4O07A 4V25A 4DZYA 3A0TA 2GQPA 3INXA 3U67A 2IWSA 2YK2A 1OSFA 4XKAA 4KP4A 5FNDA 3KE6A 3TZ2A 4GQTA 2VWCA 2Q2EB 3H80A 3HEKA 1Y8OA 2WI6A 4CWRA 4BAEA 2QFOA 2BYIA 3R4PA 1NHHA 2YEGA 2PNRA 1Y4UA 1ZW9A 4FCRA 1KZNA 2YK9A 2ZDYA 1U0ZA 4ZKIA 3A0RA 3HHUA 3T2SA 4XITA 4LP0A 2WI2A 2E0AA 3TZ4A 4W7TA 4L8ZA 4JASA 4XC0A 4ZVIA 5M4NA 1YESA 2VCJA 1AJ6A 2WEPA 4YKZA 2QG0A 4O09A 5F3KA 3T1KA 3QDDA 3JZ3A 2WERA 2XJGA 1UY9A 3G7EA 3RKZA 4CWTA 2CCTA 2XHTA 3GIEA 4I3HA 4XIQA 2JKIA 5FWKA 3O6OA 2WI5A 2CCSA 4LPBA 1YC3A 1YC4A 1B3QA 4YKRA 3NMQA 3VHAA 3TZ5A 4EFTA 2BU7A 1YT1A 1UY6A 4L91A 1TBWA 5F5RA 2YI0A 2BU5A 1BKNA 4CWPA 4HY6A 1A4HA 3A0ZA 1S14A 5BODA 3EKRA 4X9LA 4GFNA 4LWFA 1AH8A 3K98A 4UROA 1B63A 4L93A 1B62A 3EHGA 4HXZA 3U2KA 1AMWA 5M4HA 4LWEA 2XX2A 3A0YA 1U2OA 4MOTA 4BXIA 3HYYA 4PU9A 4GT8A 4CWOA 2BU6A 2BTZA 3G7BA 2AKPA 3BM9A 1UYKA 4HZ5A 5M4PA 3A0XA 3INWA 4EM7A 5IDMA 1NHIA 3O2FA 3OMUA 3PEJA 2XX4A 3R91A 3RLQA 1UYDA 4JAUA 3RLPA 1YSZA 3ZXOA 3GIGB 4NH8A 4EMVA 4YKUA 4O05A 2YEAA 1I59A 3D36A 4NH7A 1YSRA 1NHJA 4DUHA 2YJWA 4MB9A 4HYPA 1BYQA 3C11A 4EGHA 3OWBA 4L90A 2XABA 1UY7A 3C0EA 3A0WA 3EHJA 2O1UA 4XDMA 3WHAA 1UYIA 2YE8A 4CE1A 3GIGA 2FYPA 1US7A 2YE2A 4B6CA 2ZDXA 3FV5A 1MU5A 2YE3A 4U93A 1Z5CA 5GGZA 4H85A 2Q8FA 4BQGA 4AWPA 4Q20A 4PRVA 4R3MA 2YGFA 4XE2A 1YS3A 3U2DA 3CGZA 4YKYA 2BREA 1Z5BA 5FNCA 3OW6A 4GCZA 4URNA 4E00A 4XKOA 4JQLA 5M4EA 4PRXA 3K97A 4BIUA 4I5SA 1YC1A 3GIFA 2O1VA 4EGIA 3CRLA 1KIJA 1QZRA 2IORA 4BQJA 5M4MA 1Y8NA 1QYEA 3R92A 1S16A 1AM1A 5CF0A 2ZKJA 3HYZA 2WI7A 4HYMA 1YERA 4FMTA 2YI7A 1THNA 2YEEA 3RLRA 4CE2A 1ZWHA 2EXLA 2QF6A 1TIDA 2FXSA 3OWDA 2H8MA 4YKXA 2WI4A 3VHDA 4JAVA 3B27A 1BXDA 3T10A 3R4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEB A;  2XK2 A;  3SL2 A;  4R1F A;  2GFD A;  3R4M A;  5IDJ A;  1GKZ A;  1MX0 A;  3EHH A;  1I58 A;  4U7O A;  2YE7 A;  2YEC A;  5CPH A;  2BRC A;  2CG9 A;  2XHR A;  3PEH A;  3FT5 A;  2UWD A;  3CRK A;  1PVG A;  1YT2 A;  3DGE A;  4CWN A;  4LWG A;  5D6Q A;  2IOP A;  3TTZ A;  4GGL A;  2BU8 A;  2XCM A;  3D2R A;  1Y8P A;  3VAD A;  3T0Z A;  4XIP A;  1QY8 A;  1Y4S A;  4XD8 A;  1UYE A;  3T0H A;  3ZKD A;  3ZXQ A;  1TH8 A;  3K99 A;  3LNU A;  1JM6 A;  2YE9 A;  4P8O A;  3O0I A;  5D7C A;  3WQ9 A;  1TC6 A;  4MPE A;  1UYL A;  2IWU A;  2YI6 A;  2HG1 A;  2XJX A;  3ZKB A;  4ASB A;  4AWO A;  4WUB A;  4CE3 A;  4MPN A;  2BSM A;  2CH4 A;  2QG2 A;  2XDU A;  2YE6 A;  2YGA A;  4CWQ A;  4BIZ A;  4MPC A;  1Z5A A;  3IED A;  4H81 A;  4MP7 A;  4QPJ A;  2H55 A;  2YKB A;  2Q8I A;  1I5C A;  3G75 A;  4FCQ A;  1I5B A;  5L3J A;  2IOQ A;  3ZM7 A;  4FCP A;  4KFG A;  1R62 A;  2K5B A;  1GJV A;  3D0B A;  3BMY A;  2XDL A;  1Z59 A;  4KSG A;  2YED A;  1ZXN A;  1UYF A;  2BU2 A;  1H7U A;  4P7A A;  4LWI A;  2XDK A;  4XKK A;  4HXW A;  2VW5 A;  2JJC A;  2IWX A;  4O0B A;  5CTW A;  2XJJ A;  5M4K A;  2BYH A;  5C93 A;  4XTJ A;  5BOC A;  4GEE A;  2ESA A;  1UYM A;  3CWV A;  2Q8H A;  3TUH A;  1UY8 A;  4HY1 A;  3R4N A;  1GKX A;  5J6A A;  2YI5 A;  1H7S A;  4EEH A;  3OPD A;  3MNR P;  4B7P A;  4EGK A;  4LWH A;  4ASA A;  2HKJ A;  3B28 A;  1ID0 A;  5CTY A;  5FNF A;  2VCI A;  3FT8 A;  4PL9 A;  1YT0 A;  5CTX A;  2YEJ A;  4YKQ A;  5D6P A;  5IN9 A;  2FWZ A;  4K4O A;  4FPP A;  1UYH A;  2HCH A;  4YKT A;  1YET A;  2YE4 A;  4CWF A;  2XDS A;  4EFU A;  2ZBK B;  4E01 A;  2YJX A;  4KSH A;  4MBC A;  1EI1 A;  4H7Q A;  2YGE A;  4U7N A;  2Q8G A;  5D7D A;  2FWY A;  1BGQ A;  1EA6 A;  2YKE A;  4NH9 A;  2XDX A;  2YEI A;  1I5D A;  3CGY A;  4KTN A;  4YKW A;  3B26 A;  5J71 A;  1ZXM A;  3LPS A;  4WUC A;  4XCJ A;  4O04 A;  2YEH A;  2BZ5 A;  2CGF A;  1L0O A;  2YEF A;  2WEQ A;  3K60 A;  3B25 A;  3Q5J A;  2XX5 A;  3EKO A;  4URM A;  4E02 A;  1UYG A;  2YE5 A;  1UYC A;  3EHF A;  4URL A;  2YKI A;  2CCU A;  4MP2 A;  4WUD A;  4AWQ A;  3QTF A;  2BT0 A;  3TZ0 A;  3HZ5 A;  4QPK A;  2WI3 A;  3VHC A;  4ASF A;  5D7R A;  2YKJ A;  4HZ0 A;  2C2A A;  1TC0 A;  4XCL A;  2O1W A;  3HZ1 A;  5CTU A;  1I5A A;  4V26 A;  1TIL A;  2XD6 A;  4CWS A;  1AH6 A;  4ASG A;  3Q5K A;  3B24 A;  4L94 A;  2WI1 A;  3H4L A;  3Q5L A;  4XIR A;  2YKC A;  2XHX A;  4R3A A;  4KQV A;  4AS9 A;  4O07 A;  4V25 A;  4DZY A;  3A0T A;  2GQP A;  3INX A;  3U67 A;  2IWS A;  2YK2 A;  1OSF A;  4XKA A;  4KP4 A;  5FND A;  3KE6 A;  3TZ2 A;  4GQT A;  2VWC A;  2Q2E B;  3H80 A;  3HEK A;  1Y8O A;  2WI6 A;  4CWR A;  4BAE A;  2QFO A;  2BYI A;  3R4P A;  1NHH A;  2YEG A;  2PNR A;  1Y4U A;  1ZW9 A;  4FCR A;  1KZN A;  2YK9 A;  2ZDY A;  1U0Z A;  4ZKI A;  3A0R A;  3HHU A;  3T2S A;  4XIT A;  4LP0 A;  2WI2 A;  2E0A A;  3TZ4 A;  4W7T A;  4L8Z A;  4JAS A;  4XC0 A;  4ZVI A;  5M4N A;  1YES A;  2VCJ A;  1AJ6 A;  2WEP A;  4YKZ A;  2QG0 A;  4O09 A;  5F3K A;  3T1K A;  3QDD A;  3JZ3 A;  2WER A;  2XJG A;  1UY9 A;  3G7E A;  3RKZ A;  4CWT A;  2CCT A;  2XHT A;  3GIE A;  4I3H A;  4XIQ A;  2JKI A;  5FWK A;  3O6O A;  2WI5 A;  2CCS A;  4LPB A;  1YC3 A;  1YC4 A;  1B3Q A;  4YKR A;  3NMQ A;  3VHA A;  3TZ5 A;  4EFT A;  2BU7 A;  1YT1 A;  1UY6 A;  4L91 A;  1TBW A;  5F5R A;  2YI0 A;  2BU5 A;  1BKN A;  4CWP A;  4HY6 A;  1A4H A;  3A0Z A;  1S14 A;  5BOD A;  3EKR A;  4X9L A;  4GFN A;  4LWF A;  1AH8 A;  3K98 A;  4URO A;  1B63 A;  4L93 A;  1B62 A;  3EHG A;  4HXZ A;  3U2K A;  1AMW A;  5M4H A;  4LWE A;  2XX2 A;  3A0Y A;  1U2O A;  4MOT A;  4BXI A;  3HYY A;  4PU9 A;  4GT8 A;  4CWO A;  2BU6 A;  2BTZ A;  3G7B A;  2AKP A;  3BM9 A;  1UYK A;  4HZ5 A;  5M4P A;  3A0X A;  3INW A;  4EM7 A;  5IDM A;  1NHI A;  3O2F A;  3OMU A;  3PEJ A;  2XX4 A;  3R91 A;  3RLQ A;  1UYD A;  4JAU A;  3RLP A;  1YSZ A;  3ZXO A;  3GIG B;  4NH8 A;  4EMV A;  4YKU A;  4O05 A;  2YEA A;  1I59 A;  3D36 A;  4NH7 A;  1YSR A;  1NHJ A;  4DUH A;  2YJW A;  4MB9 A;  4HYP A;  1BYQ A;  3C11 A;  4EGH A;  3OWB A;  4L90 A;  2XAB A;  1UY7 A;  3C0E A;  3A0W A;  3EHJ A;  2O1U A;  4XDM A;  3WHA A;  1UYI A;  2YE8 A;  4CE1 A;  3GIG A;  2FYP A;  1US7 A;  2YE2 A;  4B6C A;  2ZDX A;  3FV5 A;  1MU5 A;  2YE3 A;  4U93 A;  1Z5C A;  5GGZ A;  4H85 A;  2Q8F A;  4BQG A;  4AWP A;  4Q20 A;  4PRV A;  4R3M A;  2YGF A;  4XE2 A;  1YS3 A;  3U2D A;  3CGZ A;  4YKY A;  2BRE A;  1Z5B A;  5FNC A;  3OW6 A;  4GCZ A;  4URN A;  4E00 A;  4XKO A;  4JQL A;  5M4E A;  4PRX A;  3K97 A;  4BIU A;  4I5S A;  1YC1 A;  3GIF A;  2O1V A;  4EGI A;  3CRL A;  1KIJ A;  1QZR A;  2IOR A;  4BQJ A;  5M4M A;  1Y8N A;  1QYE A;  3R92 A;  1S16 A;  1AM1 A;  5CF0 A;  2ZKJ A;  3HYZ A;  2WI7 A;  4HYM A;  1YER A;  4FMT A;  2YI7 A;  1THN A;  2YEE A;  3RLR A;  4CE2 A;  1ZWH A;  2EXL A;  2QF6 A;  1TID A;  2FXS A;  3OWD A;  2H8M A;  4YKX A;  2WI4 A;  3VHD A;  4JAV A;  3B27 A;  1BXD A;  3T10 A;  3R4O A; 
#chains in the Genus database with same CATH topology
 2YEB A;  2YYM A;  1F51 A;  3Q22 A;  2XK2 A;  3SL2 A;  4R1F A;  2RF7 A;  4Q5B A;  2GFD A;  3R4M A;  5IDJ A;  1GKZ A;  1MX0 A;  3EHH A;  1I58 A;  4U7O A;  4FF2 A;  4Q17 A;  2YE7 A;  1FS7 A;  2YEC A;  2BRC A;  5CPH A;  2CG9 A;  2XHR A;  2R03 A;  3PEH A;  3FT5 A;  2UWD A;  3CRK A;  3X0X A;  1PVG A;  1YT2 A;  4QIC A;  3DGE A;  3BNH A;  4CWN A;  3EON A;  3MXL A;  4LWG A;  5D6Q A;  2IOP A;  3TTZ A;  4J1V A;  4GGL A;  2BU8 A;  2XCM A;  1RJ4 A;  1PK0 A;  3D2R A;  1Y8P A;  2C12 A;  3VAD A;  3VKH A;  3LGQ A;  3T0Z A;  4XIP A;  1QY8 A;  2HJN A;  1Y4S A;  3CYG A;  4XD8 A;  1UYE A;  3C3L A;  2VIG A;  4L38 A;  3T0H A;  3ZKD A;  3ZXQ A;  1TH8 A;  3K99 A;  1JM6 A;  2IX5 A;  3FO3 A;  3LNU A;  2YE9 A;  5JEN A;  4P8O A;  4M9A A;  3O0I A;  4U83 A;  5D7C A;  3WQ9 A;  1TC6 A;  2OR0 A;  2AO2 A;  4MPE A;  1UYL A;  2IWU A;  2YI6 A;  2JBT A;  2HG1 A;  3GQT A;  2XJX A;  3ZKB A;  3II9 A;  4ASB A;  4AWO A;  4WUB A;  4CE3 A;  4MPN A;  2BSM A;  2CH4 A;  2QG2 A;  2XDU A;  2YE6 A;  2YGA A;  4CWQ A;  4BIZ A;  4MPC A;  4FF1 A;  2R0N A;  1Z5A A;  3IED A;  4H81 A;  4MP7 A;  4QPJ A;  1R2J A;  2OJQ A;  2H55 A;  2YKB A;  2Q8I A;  1I5C A;  3G75 A;  4FCQ A;  1I5B A;  5L3J A;  2R0M A;  2RFQ A;  2IOQ A;  3ZM7 A;  4FCP A;  4KFG A;  3OIB A;  1R62 A;  2K5B A;  1GJV A;  3D0B A;  3BMY A;  2XDL A;  4AI6 A;  1Z59 A;  4KSG A;  2YED A;  4Q5C A;  1ZXN A;  2JBS A;  1UYF A;  1WS9 A;  2E81 A;  2REH A;  2BU2 A;  1H7U A;  4P7A A;  4LWI A;  4FF4 A;  2XS8 A;  2XDK A;  2FON A;  4XKK A;  4P79 A;  4HXW A;  2VW5 A;  2JJC A;  2IWX A;  4O0B A;  5CTW A;  2XJJ A;  1SIR A;  5M4K A;  2BYH A;  5C93 A;  4XTJ A;  5BOC A;  4GEE A;  2CJ6 A;  2D29 A;  2ESA A;  1UYM A;  3CWV A;  2Q8H A;  3TUH A;  1UY8 A;  4HY1 A;  3R4N A;  1GKX A;  4HKS A;  5J6A A;  2YI5 A;  1H7S A;  4EEH A;  3OPD A;  1XFZ A;  3MNR P;  2YGW A;  4B7P A;  4EGK A;  4XVX A;  4LWH A;  4ASA A;  2HKJ A;  3B28 A;  1ID0 A;  5CTY A;  4X28 A;  5FNF A;  2EBH X;  3F29 A;  2VCI A;  3AFE A;  3FT8 A;  1X8Z A;  4PL9 A;  3S7W A;  1YT0 A;  5CTX A;  2YEJ A;  4YKQ A;  3D9E A;  4ZXV A;  3D1I A;  3Q0A A;  5D6P A;  2YYJ A;  2FWZ A;  5IN9 A;  1PI1 A;  4K4O A;  4FPP A;  1UYH A;  1XG2 B;  3MMO A;  2HCH A;  4YKT A;  1YET A;  2YE4 A;  4CWF A;  4KCF A;  2UXW A;  2XDS A;  4EFU A;  2J7A A;  3LMM A;  3BNF A;  2ZBK B;  4E01 A;  2YJX A;  4KSH A;  4MBC A;  1EI1 A;  4H7Q A;  2YGE A;  4U7N A;  2Q8G A;  5D7D A;  2FWY A;  1BGQ A;  1EA6 A;  3C2P A;  3MPI A;  2YKE A;  4NH9 A;  2XDX A;  2YEI A;  1I5D A;  3CGY A;  4KTN A;  4YKW A;  4F0X A;  3B26 A;  5J71 A;  1ZXM A;  3LPS A;  4WUC A;  4XCJ A;  4O04 A;  2R05 A;  2YEH A;  2BZ5 A;  2CGF A;  5BRK A;  1L0O A;  2YEF A;  2WEQ A;  3K60 A;  1BUC A;  3B25 A;  2DDH A;  2ZO5 A;  3Q5J A;  2XX5 A;  3EKO A;  4URM A;  4NXL A;  4E02 A;  1UYG A;  2YE5 A;  1UYC A;  1K90 A;  3EHF A;  4URL A;  3N0R A;  2YKI A;  2C0U A;  2LFW A;  2CCU A;  4MP2 A;  4WUD A;  4AKI A;  4AWQ A;  3QTF A;  2BT0 A;  3TZ0 A;  3HZ5 A;  3BNG A;  4QPK A;  2WI3 A;  3VHC A;  4ASF A;  5D7R A;  2YKJ A;  4HZ0 A;  2C2A A;  1TC0 A;  4XCL A;  2O1W A;  3D6B A;  3HZ1 A;  2YYK A;  5CTU A;  1I5A A;  1EGE A;  4V26 A;  3D9F A;  1TIL A;  2XD6 A;  4CWS A;  1AH6 A;  4ASG A;  3Q5K A;  3Q24 A;  3B24 A;  4L94 A;  2WI1 A;  2FP2 A;  1SC5 A;  1UDY A;  2OT4 A;  4ZYJ A;  3H4L A;  3Q5L A;  4XIR A;  2YKC A;  1SIQ A;  2XHX A;  4R3A A;  4KQV A;  2YYG A;  4AS9 A;  2XS1 A;  4O07 A;  3VKG A;  4V25 A;  4DZY A;  2EC5 A;  3A0T A;  2GQP A;  2QR4 A;  4L3X A;  3INX A;  3U67 A;  1R3B A;  2IWS A;  4AKH A;  4JIO A;  2RDZ A;  2YK2 A;  1JQI A;  1OSF A;  4XKA A;  4KP4 A;  5FND A;  1RP3 A;  1XFX A;  3TZ2 A;  3KE6 A;  4GQT A;  1XFY A;  2C1I A;  2FP1 A;  2VWC A;  2Q2E B;  4IV6 A;  3H80 A;  2CJ8 A;  3HEK A;  1Y8O A;  3PFD A;  4JIZ A;  2R02 A;  2WI6 A;  2PG0 A;  4CWR A;  4KSA A;  4BAE A;  2QFO A;  4DOY A;  2BYI A;  3R4P A;  1NHH A;  2YEG A;  2YYI A;  2PNR A;  1Y4U A;  1ZW9 A;  4FCR A;  1KZN A;  2YK9 A;  2ZDY A;  1S26 A;  1U0Z A;  1EGC A;  4ZKI A;  3A0R A;  5GJW E;  3HHU A;  3T2S A;  2FTK A;  4XIT A;  4LP0 A;  2WI2 A;  2E0A A;  1GU6 A;  3TZ4 A;  4W7T A;  1T9G A;  4L8Z A;  4JAS A;  4XC0 A;  4ZVI A;  5M4N A;  4KSF A;  1YES A;  5GJV E;  2VCJ A;  1AJ6 A;  1K8T A;  2WEP A;  4YKZ A;  2QG0 A;  4L3Z A;  4O09 A;  2JIF A;  1IS2 A;  5F3K A;  3T1K A;  3QDD A;  3JZ3 A;  2WER A;  5B6B A;  2XJG A;  1UY9 A;  3G7E A;  3MDD A;  3RKZ A;  4CWT A;  2CCT A;  2Z1Q A;  5K3H A;  2XHT A;  3GIE A;  4I3H A;  4XIQ A;  2JKI A;  5FWK A;  3MKH A;  3O6O A;  1SK6 A;  2WI5 A;  2CCS A;  3MPJ A;  4LPB A;  1YC3 A;  4LQQ B;  3TTB A;  1B3Q A;  1YC4 A;  4YKR A;  3NMQ A;  3VHA A;  3TZ5 A;  4EFT A;  2BU7 A;  1IXM A;  1YT1 A;  1UY6 A;  4L91 A;  1TBW A;  5F5R A;  2YI0 A;  2BU5 A;  1QDB A;  1BKN A;  4CWP A;  4HY6 A;  3M9V A;  1A4H A;  3A0Z A;  1S14 A;  5BOD A;  3EKR A;  2DVL A;  4X9L A;  4WJY A;  4GFN A;  4LWF A;  2CJ4 A;  3UBR A;  1AH8 A;  3K98 A;  1IVH A;  4FF3 A;  4L3Y A;  4URO A;  1B63 A;  4L93 A;  1B62 A;  3EHG A;  4HXZ A;  3EOM A;  3C46 A;  2CJ5 A;  1AMW A;  3U2K A;  5M4H A;  4LWE A;  3L1T A;  3X0Y A;  5BRM A;  2XX2 A;  4OO2 A;  4JEK A;  3A0Y A;  1FS9 A;  1U2O A;  5B5W A;  4G5E A;  4MOT A;  4BXI A;  2GBB A;  4P13 A;  3HYY A;  4PU9 A;  1XFV A;  3GM6 A;  4GT8 A;  3HWC A;  4CWO A;  2OEV A;  2BU6 A;  4O5M A;  4HKR A;  2BTZ A;  4IRN A;  3G7B A;  2AKP A;  3BM9 A;  4G97 A;  1UYK A;  4HZ5 A;  2EBA A;  3OWA A;  5M4P A;  3A0X A;  3LG1 A;  3INW A;  4EM7 A;  4KS9 A;  1NHI A;  3O2F A;  3OMU A;  5IDM A;  3KML A;  3PEJ A;  2XX4 A;  3R91 A;  3RLQ A;  1UYD A;  4JAU A;  3RLP A;  1YSZ A;  3ZXO A;  3S5T A;  3GIG B;  4NH8 A;  2YYL A;  4EMV A;  4YKU A;  1EGD A;  4Q4U A;  4O05 A;  3B96 A;  2YEA A;  3RKH A;  1I59 A;  3D36 A;  4NH7 A;  1YSR A;  2JBR A;  3D9G A;  3SWO A;  1NHJ A;  1XFW A;  3D9D A;  4DUH A;  2YJW A;  4MB9 A;  4HYP A;  3CE2 A;  1BYQ A;  2VF1 A;  3C11 A;  3AFF A;  3OWB A;  4EGH A;  4L90 A;  2IX6 A;  2XAB A;  4W9U A;  3OWM A;  4X28 C;  3SF6 A;  1UY7 A;  3C0E A;  5K3G A;  3A0W A;  3Q23 A;  3EHJ A;  4Q1O A;  2O1U A;  4XDM A;  3WHA A;  1UYI A;  2YE8 A;  4CE1 A;  3GIG A;  2FYP A;  1US7 A;  2YE2 A;  4B6C A;  2E80 A;  2C1G A;  2ZDX A;  3FV5 A;  4KTO A;  1MU5 A;  2CX9 A;  2YE3 A;  1RX0 A;  4FZ4 A;  5K3I A;  4U93 A;  3BNJ A;  3X29 A;  1Z5C A;  5GGZ A;  1X91 A;  4H85 A;  2Q8F A;  1W07 A;  2ZAF A;  4AWP A;  1U8V A;  4BQG A;  2OEX A;  5K3J A;  4Q20 A;  2AZE A;  4PRV A;  4R3M A;  2YGF A;  2A1T A;  1LVC A;  2CJ7 A;  4XE2 A;  1RJ1 A;  1UKW A;  1YS3 A;  3U2D A;  3CGZ A;  4YKY A;  3GNC A;  2BRE A;  1Z5B A;  1X90 A;  5FNC A;  1Y0V A;  3OW6 A;  4GCZ A;  4URN A;  4E00 A;  4XKO A;  4JQL A;  5M4E A;  4PRX A;  3K97 A;  4BIU A;  4I5S A;  3TOR A;  1YC1 A;  3GIF A;  2O1V A;  4EGI A;  3R7K A;  3CRL A;  4RM7 A;  1KIJ A;  1QZR A;  2IOR A;  4BQJ A;  5M4M A;  1Y8N A;  1XFU A;  1QYE A;  2WBI A;  3P4T A;  3R92 A;  4HR3 A;  1S16 A;  1AM1 A;  2EBF X;  4E72 A;  5B5V A;  4L1F A;  5CF0 A;  2ZKJ A;  4N5F A;  3HYZ A;  2WI7 A;  4HYM A;  3UU9 A;  1YER A;  3SXQ A;  4FMT A;  1OAH A;  2YI7 A;  1THN A;  1FS8 A;  2YEE A;  3RLR A;  2VR0 A;  1K93 A;  4CE2 A;  1ZWH A;  4Q0T A;  2F6L A;  2EXL A;  3NF4 A;  2QF6 A;  2PO4 A;  4LQS B;  1TID A;  2FXS A;  3OWD A;  2H8M A;  2HHI A;  4YKX A;  2WI4 A;  4AKG A;  3MDE A;  3VHD A;  4JAV A;  3B27 A;  3FCJ A;  1BXD A;  3T10 A;  2XQR B;  3SCE A;  3R4O A; 
#chains in the Genus database with same CATH homology
 2YEB A;  2XK2 A;  3SL2 A;  4R1F A;  2GFD A;  3R4M A;  5IDJ A;  1GKZ A;  1MX0 A;  3EHH A;  1I58 A;  4U7O A;  2YE7 A;  2YEC A;  5CPH A;  2BRC A;  2CG9 A;  2XHR A;  3PEH A;  3FT5 A;  2UWD A;  3CRK A;  1PVG A;  1YT2 A;  3DGE A;  4CWN A;  4LWG A;  5D6Q A;  2IOP A;  3TTZ A;  4GGL A;  2BU8 A;  2XCM A;  3D2R A;  1Y8P A;  3VAD A;  3T0Z A;  4XIP A;  1QY8 A;  1Y4S A;  4XD8 A;  1UYE A;  3T0H A;  3ZKD A;  3ZXQ A;  1TH8 A;  3K99 A;  3LNU A;  1JM6 A;  2YE9 A;  4P8O A;  3O0I A;  5D7C A;  3WQ9 A;  1TC6 A;  4MPE A;  1UYL A;  2IWU A;  2YI6 A;  2HG1 A;  2XJX A;  3ZKB A;  4ASB A;  4AWO A;  4WUB A;  4CE3 A;  4MPN A;  2BSM A;  2CH4 A;  2QG2 A;  2XDU A;  2YE6 A;  2YGA A;  4CWQ A;  4BIZ A;  4MPC A;  1Z5A A;  3IED A;  4H81 A;  4MP7 A;  4QPJ A;  2H55 A;  2YKB A;  2Q8I A;  1I5C A;  3G75 A;  4FCQ A;  1I5B A;  5L3J A;  2IOQ A;  3ZM7 A;  4FCP A;  4KFG A;  1R62 A;  2K5B A;  1GJV A;  3D0B A;  3BMY A;  2XDL A;  1Z59 A;  4KSG A;  2YED A;  1ZXN A;  1UYF A;  2BU2 A;  1H7U A;  4P7A A;  4LWI A;  2XDK A;  4XKK A;  4HXW A;  2VW5 A;  2JJC A;  2IWX A;  4O0B A;  5CTW A;  2XJJ A;  5M4K A;  2BYH A;  5C93 A;  4XTJ A;  5BOC A;  4GEE A;  2ESA A;  1UYM A;  3CWV A;  2Q8H A;  3TUH A;  1UY8 A;  4HY1 A;  3R4N A;  1GKX A;  5J6A A;  2YI5 A;  1H7S A;  4EEH A;  3OPD A;  3MNR P;  4B7P A;  4EGK A;  4LWH A;  4ASA A;  2HKJ A;  3B28 A;  1ID0 A;  5CTY A;  5FNF A;  2VCI A;  3FT8 A;  4PL9 A;  1YT0 A;  5CTX A;  2YEJ A;  4YKQ A;  5D6P A;  5IN9 A;  2FWZ A;  4K4O A;  4FPP A;  1UYH A;  2HCH A;  4YKT A;  1YET A;  2YE4 A;  4CWF A;  2XDS A;  4EFU A;  2ZBK B;  4E01 A;  2YJX A;  4KSH A;  4MBC A;  1EI1 A;  4H7Q A;  2YGE A;  4U7N A;  2Q8G A;  5D7D A;  2FWY A;  1BGQ A;  1EA6 A;  2YKE A;  4NH9 A;  2XDX A;  2YEI A;  1I5D A;  3CGY A;  4KTN A;  4YKW A;  3B26 A;  5J71 A;  1ZXM A;  3LPS A;  4WUC A;  4XCJ A;  4O04 A;  2YEH A;  2BZ5 A;  2CGF A;  1L0O A;  2YEF A;  2WEQ A;  3K60 A;  3B25 A;  3Q5J A;  2XX5 A;  3EKO A;  4URM A;  4E02 A;  1UYG A;  2YE5 A;  1UYC A;  3EHF A;  4URL A;  2YKI A;  2CCU A;  4MP2 A;  4WUD A;  4AWQ A;  3QTF A;  2BT0 A;  3TZ0 A;  3HZ5 A;  4QPK A;  2WI3 A;  3VHC A;  4ASF A;  5D7R A;  2YKJ A;  4HZ0 A;  2C2A A;  1TC0 A;  4XCL A;  2O1W A;  3HZ1 A;  5CTU A;  1I5A A;  4V26 A;  1TIL A;  2XD6 A;  4CWS A;  1AH6 A;  4ASG A;  3Q5K A;  3B24 A;  4L94 A;  2WI1 A;  3H4L A;  3Q5L A;  4XIR A;  2YKC A;  2XHX A;  4R3A A;  4KQV A;  4AS9 A;  4O07 A;  4V25 A;  4DZY A;  3A0T A;  2GQP A;  3INX A;  3U67 A;  2IWS A;  2YK2 A;  1OSF A;  4XKA A;  4KP4 A;  5FND A;  3KE6 A;  3TZ2 A;  4GQT A;  2VWC A;  2Q2E B;  3H80 A;  3HEK A;  1Y8O A;  2WI6 A;  4CWR A;  4BAE A;  2QFO A;  2BYI A;  3R4P A;  1NHH A;  2YEG A;  2PNR A;  1Y4U A;  1ZW9 A;  4FCR A;  1KZN A;  2YK9 A;  2ZDY A;  1U0Z A;  4ZKI A;  3A0R A;  3HHU A;  3T2S A;  4XIT A;  4LP0 A;  2WI2 A;  2E0A A;  3TZ4 A;  4W7T A;  4L8Z A;  4JAS A;  4XC0 A;  4ZVI A;  5M4N A;  1YES A;  2VCJ A;  1AJ6 A;  2WEP A;  4YKZ A;  2QG0 A;  4O09 A;  5F3K A;  3T1K A;  3QDD A;  3JZ3 A;  2WER A;  2XJG A;  1UY9 A;  3G7E A;  3RKZ A;  4CWT A;  2CCT A;  2XHT A;  3GIE A;  4I3H A;  4XIQ A;  2JKI A;  5FWK A;  3O6O A;  2WI5 A;  2CCS A;  4LPB A;  1YC3 A;  1YC4 A;  1B3Q A;  4YKR A;  3NMQ A;  3VHA A;  3TZ5 A;  4EFT A;  2BU7 A;  1YT1 A;  1UY6 A;  4L91 A;  1TBW A;  5F5R A;  2YI0 A;  2BU5 A;  1BKN A;  4CWP A;  4HY6 A;  1A4H A;  3A0Z A;  1S14 A;  5BOD A;  3EKR A;  4X9L A;  4GFN A;  4LWF A;  1AH8 A;  3K98 A;  4URO A;  1B63 A;  4L93 A;  1B62 A;  3EHG A;  4HXZ A;  3U2K A;  1AMW A;  5M4H A;  4LWE A;  2XX2 A;  3A0Y A;  1U2O A;  4MOT A;  4BXI A;  3HYY A;  4PU9 A;  4GT8 A;  4CWO A;  2BU6 A;  2BTZ A;  3G7B A;  2AKP A;  3BM9 A;  1UYK A;  4HZ5 A;  5M4P A;  3A0X A;  3INW A;  4EM7 A;  5IDM A;  1NHI A;  3O2F A;  3OMU A;  3PEJ A;  2XX4 A;  3R91 A;  3RLQ A;  1UYD A;  4JAU A;  3RLP A;  1YSZ A;  3ZXO A;  3GIG B;  4NH8 A;  4EMV A;  4YKU A;  4O05 A;  2YEA A;  1I59 A;  3D36 A;  4NH7 A;  1YSR A;  1NHJ A;  4DUH A;  2YJW A;  4MB9 A;  4HYP A;  1BYQ A;  3C11 A;  4EGH A;  3OWB A;  4L90 A;  2XAB A;  1UY7 A;  3C0E A;  3A0W A;  3EHJ A;  2O1U A;  4XDM A;  3WHA A;  1UYI A;  2YE8 A;  4CE1 A;  3GIG A;  2FYP A;  1US7 A;  2YE2 A;  4B6C A;  2ZDX A;  3FV5 A;  1MU5 A;  2YE3 A;  4U93 A;  1Z5C A;  5GGZ A;  4H85 A;  2Q8F A;  4BQG A;  4AWP A;  4Q20 A;  4PRV A;  4R3M A;  2YGF A;  4XE2 A;  1YS3 A;  3U2D A;  3CGZ A;  4YKY A;  2BRE A;  1Z5B A;  5FNC A;  3OW6 A;  4GCZ A;  4URN A;  4E00 A;  4XKO A;  4JQL A;  5M4E A;  4PRX A;  3K97 A;  4BIU A;  4I5S A;  1YC1 A;  3GIF A;  2O1V A;  4EGI A;  3CRL A;  1KIJ A;  1QZR A;  2IOR A;  4BQJ A;  5M4M A;  1Y8N A;  1QYE A;  3R92 A;  1S16 A;  1AM1 A;  5CF0 A;  2ZKJ A;  3HYZ A;  2WI7 A;  4HYM A;  1YER A;  4FMT A;  2YI7 A;  1THN A;  2YEE A;  3RLR A;  4CE2 A;  1ZWH A;  2EXL A;  2QF6 A;  1TID A;  2FXS A;  3OWD A;  2H8M A;  4YKX A;  2WI4 A;  3VHD A;  4JAV A;  3B27 A;  1BXD A;  3T10 A;  3R4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...