2Q8FA

Structure of pyruvate dehydrogenase kinase isoform 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
383
structure length
365
Chain Sequence
GVPGQVDFYARFSPSPLSMKQFLDFGSCEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNADDWCVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 1
publication title Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 129
structure length 365
sequence length 383
ec nomenclature ec 2.7.11.2: [Pyruvate dehydrogenase (acetyl-transferring)] kinase.
pdb deposition date 2007-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
A PF10436 BCDHK_Adom3 Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.20 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Alpha-ketoacid/pyruvate dehydrogenase kinase, N-terminal domain 2q8fA01
3.30.565.10 Alpha Beta 2-Layer Sandwich Heat Shock Protein 90 Histidine kinase-like ATPase, C-terminal domain 2q8fA02
4YKXA 2AKPA 1TC0A 1Z5BA 3EKOA 3LNUA 4LWIA 3GIGA 2YJWA 4W7TA 3R4PA 1A4HA 4BXIA 4YKZA 1UY6A 2XDUA 3LPSA 4LWHA 4URMA 3JZ3A 2FWZA 4O09A 4CWSA 4MPEA 1I5BA 3T0ZA 4YKWA 4XCLA 2XX2A 2E0AA 1UY9A 5F5RA 3WHAA 4V25A 3EHFA 1YC3A 2QF6A 2O1UA 4H7QA 5CF0A 5CPHA 2IWXA 2BZ5A 1YC4A 4CWTA 4KP4A 3SL2A 3TUHA 2BU8A 3BMYA 2BYIA 1TIDA 2Q8GA 2XX4A 2WI1A 4DUHA 1YT2A 2YEFA 5F3KA 4CWNA 4JASA 3CRKA 5IN9A 1YS3A 3R4OA 2EXLA 2VCIA 3R4NA 4NH9A 3K98A 3EHGA 1I5DA 3INXA 3WQ9A 4EM7A 1I59A 2ZDYA 2YEHA 4HXWA 2QG0A 4XCJA 2YKJA 3OW6A 4I5SA 3CWVA 1UYEA 4URNA 4XKOA 2YGAA 3C0EA 3TZ5A 3D2RA 2ZDXA 3Q5LA 1Z59A 1R62A 5FNCA 1B3QA 4YKRA 2WI3A 2BU7A 3VHAA 2YJXA 4R3AA 5BODA 4HY1A 1UYDA 4PU9A 2YKCA 1ZXNA 4NH7A 2CGFA 2YEBA 5M4NA 3G75A 4JAUA 4P7AA 3C11A 2BU2A 3B27A 4GQTA 3ZXQA 4MPNA 2IWUA 4HY6A 1S14A 3K99A 4FCQA 1Z5AA 2YGFA 1TBWA 4LWFA 5M4EA 2JJCA 3A0YA 3MNRP 2CG9A 4WUBA 5IDJA 1US7A 1AH8A 2XDXA 2CCTA 2XCMA 2YE2A 3PEJA 5D7CA 2YI5A 4XC0A 4CWOA 1AMWA 1Y4UA 3D0BA 2YEEA 3TZ0A 5C93A 4EGKA 2WI6A 2BSMA 4BQGA 1ZW9A 2CCSA 4YKUA 5GGZA 1KIJA 4R1FA 4X9LA 3G7BA 5J71A 4L91A 2YK9A 4BIUA 2YEAA 4ASAA 4L90A 5FNFA 2BT0A 3A0XA 3K97A 4U7OA 4LWGA 3T0HA 4R3MA 4AWPA 3Q5KA 2YE6A 1I5CA 4BIZA 2YEGA 5L3JA 1AH6A 4CE2A 5CTXA 1L0OA 3EKRA 1YT1A 2XD6A 3OWBA 2BU6A 2O1WA 2H8MA 5IDMA 4CWQA 1ZWHA 1UYKA 2Q2EB 3U2DA 2YKEA 3R4MA 2GFDA 3VHDA 1AJ6A 3GIGB 4XIQA 4EFTA 4URLA 3EHJA 4XIPA 2HCHA 3GIEA 1AM1A 5M4PA 4PRVA 2IWSA 2WI7A 3K60A 4EEHA 1NHIA 3OMUA 2XDSA 1B62A 2BREA 3B25A 4GCZA 1B63A 1UYGA 2UWDA 3G7EA 2C2AA 3OWDA 1OSFA 2XJGA 4O05A 3RLQA 1UY7A 4K4OA 1THNA 1ZXMA 1JM6A 3U67A 2Q8HA 3T1KA 2Q8FA 4UROA 2YECA 2YKIA 1Y4SA 4V26A 5J6AA 4PRXA 2O1VA 4HZ5A 3DGEA 4MP7A 4I3HA 2XDLA 4MOTA 1YT0A 2ZKJA 4HXZA 2IOQA 3HEKA 1NHHA 2XABA 4L93A 4XE2A 3R92A 4NH8A 1H7SA 3VADA 2CCUA 4CWFA 1U2OA 3O0IA 4E02A 1GJVA 4H85A 1BXDA 1GKXA 1ID0A 1YERA 4HYPA 1Y8OA 4B6CA 4ZVIA 1U0ZA 3FT8A 1TC6A 1BGQA 3T2SA 2QFOA 2XJXA 3QDDA 3CRLA 5CTYA 1YSZA 3D36A 3Q5JA 2XHXA 2XDKA 3GIFA 4L94A 4XTJA 4ASFA 4XIRA 3VHCA 5D7RA 4B7PA 2IOPA 1EI1A 4XD8A 2YE5A 4ZKIA 2VW5A 2YE4A 3B28A 4CWPA 1Y8PA 2HG1A 2PNRA 4HYMA 5D6QA 3EHHA 1QYEA 2GQPA 4KTNA 2YK2A 2FXSA 4E01A 2YI6A 2YE8A 3BM9A 1I58A 4GGLA 2XX5A 3ZKDA 2CH4A 3FV5A 4LPBA 4MB9A 1Z5CA 4KFGA 2VWCA 3R91A 2BU5A 3ZXOA 2YKBA 1TILA 2XHRA 2ESAA 3HZ1A 2YEIA 4KSHA 3RLRA 3O6OA 1QZRA 3TTZA 1EA6A 4XDMA 3RKZA 3ZKBA 3RLPA 2IORA 3B26A 3A0WA 1YESA 4KQVA 4CE3A 4FCRA 5M4MA 1UYCA 2H55A 3TZ2A 1I5AA 3H4LA 2XJJA 2FWYA 4Q20A 4LWEA 2HKJA 3IEDA 2WI4A 2Q8IA 4P8OA 2WEQA 3O2FA 1MX0A 3OPDA 2YGEA 3KE6A 2BTZA 5M4HA 4AWOA 4MP2A 1PVGA 2YEJA 4U7NA 4BAEA 4YKTA 4JQLA 1S16A 2QG2A 4GEEA 5CTWA 4FPPA 4LP0A 4FCPA 4FMTA 4DZYA 4EMVA 4E00A 3CGZA 3T10A 1Y8NA 4EGIA 3PEHA 2K5BA 4O04A 1UYHA 4JAVA 2WEPA 2JKIA 3HZ5A 2VCJA 1YSRA 2YE7A 4CE1A 2BYHA 4L8ZA 5FNDA 1UYFA 3FT5A 4QPJA 5D6PA 4AS9A 5BOCA 4WUCA 1H7UA 2WI2A 4ASBA 3HYYA 3A0TA 2XHTA 4HZ0A 2YEDA 1UYMA 4O0BA 4H81A 2BRCA 4EFUA 1UYLA 2YE3A 1QY8A 1UYIA 3CGYA 4MBCA 1GKZA 4PL9A 4EGHA 3NMQA 2WI5A 4GFNA 4CWRA 4XKAA 4XKKA 3QTFA 1YETA 4MPCA 2XK2A 1MU5A 5CTUA 4YKQA 1TH8A 4YKYA 4ASGA 2YI0A 3HYZA 1BKNA 4WUDA 2WERA 1UY8A 4AWQA 4U93A 4BQJA 4KSGA 1NHJA 4XITA 3H80A 2YI7A 3HHUA 3TZ4A 1BYQA 1KZNA 2FYPA 2YE9A 3U2KA 4O07A 5D7DA 5M4KA 3INWA 3ZM7A 3A0RA 3B24A 5FWKA 3A0ZA 4QPKA 4GT8A 1YC1A 2ZBKB
chains in the Genus database with same CATH superfamily
4YKXA 2CJ6A 2AKPA 1XFYA 1TC0A 1Z5BA 3EKOA 2UXWA 2CX9A 3LNUA 3GIGA 4LWIA 2YJWA 4W7TA 2R0NA 3R4PA 1A4HA 4BXIA 3NF4A 4YKZA 1X8ZA 1UY6A 3C3LA 3Q0AA 2XDUA 3LPSA 4LWHA 4URMA 3FCJA 3JZ3A 2FWZA 4O09A 4CWSA 2C1GA 4MPEA 1R2JA 2RF7A 1I5BA 3BNJA 4AKHA 3T0ZA 3AFEA 4JEKA 4XCLA 2XX2A 3TORA 4YKWA 2E0AA 3C2PA 1UY9A 5F5RA 3WHAA 4V25A 3D9GA 3EHFA 1YC3A 2QF6A 2O1UA 4H7QA 4Q0TA 5CF0A 5CPHA 2IWXA 2BZ5A 4Q1OA 1YC4A 4CWTA 2OT4A 4KP4A 4KSFA 3SL2A 3MMOA 3TUHA 3GNCA 2BU8A 2EBHX 3OWMA 2GBBA 3BMYA 2BYIA 1TIDA 2Q8GA 2XX4A 2WI1A 4FF2A 4DUHA 1YT2A 2YEFA 3HWCA 5F3KA 2YYGA 4CWNA 4JASA 3CRKA 5IN9A 3EONA 3EOMA 1YS3A 3R4OA 2FP1A 2EXLA 2VCIA 3R4NA 2VIGA 4KS9A 3K98A 3EHGA 4NH9A 1I5DA 3INXA 2FONA 3WQ9A 4EM7A 3C46A 1I59A 2ZDYA 5B5WA 2YEHA 4HXWA 1XG2B 2QG0A 4XCJA 1WS9A 1IVHA 2YKJA 3OW6A 4I5SA 3CWVA 3MXLA 5B5VA 1UYEA 4KTOA 4N5FA 2E80A 4URNA 4XKOA 2YGAA 3C0EA 3TZ5A 3D2RA 2ZDXA 3Q5LA 1Z59A 1R62A 5FNCA 1B3QA 4YKRA 5K3JA 2WI3A 2BU7A 1LVCA 5K3IA 3VHAA 2YJXA 4R3AA 5BODA 4HY1A 1UYDA 4PU9A 2YKCA 1ZXNA 4NH7A 2CGFA 3LG1A 4P13A 2YEBA 5M4NA 3G75A 1EGDA 4JAUA 4P7AA 3C11A 2BU2A 3B27A 2EC5A 4GQTA 3ZXQA 4MPNA 2IWUA 4HY6A 1S14A 1K90A 3K99A 4FCQA 2C12A 2Z1QA 1Z5AA 2OR0A 2YGFA 1TBWA 4LWFA 3Q23A 5M4EA 2JJCA 2CJ5A 3A0YA 3MNRP 3X0XA 2CG9A 4WUBA 1UDYA 2REHA 5IDJA 1US7A 4FF4A 1AH8A 3II9A 2XDXA 5GJWE 2C1IA 4HKRA 2CCTA 2DDHA 2XCMA 2YE2A 3PEJA 5D7CA 2YI5A 2VF1A 4XC0A 3MKHA 4CWOA 1AMWA 2YGWA 1Y4UA 3D0BA 2YEEA 3TZ0A 4Q17A 1EGEA 1PK0A 4J1VA 1QDBA 5C93A 4EGKA 2WI6A 2BSMA 4BQGA 1ZW9A 2IX6A 3SWOA 2CCSA 4YKUA 3L1TA 3UBRA 3TTBA 5GGZA 1KIJA 4R1FA 4X9LA 3G7BA 5J71A 4L91A 1XFWA 2YK9A 4BIUA 2YEAA 4ASAA 2AZEA 4L90A 5FNFA 2BT0A 3A0XA 3K97A 4U7OA 3BNFA 4LWGA 3T0HA 4R3MA 1IXMA 4AWPA 3Q5KA 4KSAA 2YE6A 1I5CA 3S7WA 1SIRA 4LQSB 4BIZA 1W07A 5K3HA 5B6BA 4W9UA 2IX5A 2YEGA 5L3JA 4ZYJA 4Q5CA 3D9FA 1AH6A 4CE2A 3VKHA 1FS9A 5CTXA 4FF1A 1L0OA 3EKRA 1YT1A 2XD6A 3OWBA 2BU6A 2HHIA 2ZAFA 4IRNA 2O1WA 2XS1A 2H8MA 5IDMA 2R02A 4CWQA 1ZWHA 1FS7A 1XFZA 3Q24A 1RX0A 1UYKA 2Q2EB 3U2DA 2YKEA 3SCEA 1R3BA 3R4MA 4O5MA 3F29A 1RJ4A 2GFDA 3VHDA 1AJ6A 2XQRB 3GIGB 4XIQA 4EFTA 4URLA 3VKGA 3EHJA 4XIPA 2HCHA 3GIEA 1AM1A 5M4PA 3CE2A 2IWSA 2WI7A 3K60A 4PRVA 4EEHA 3CYGA 1NHIA 3OMUA 2XDSA 1B62A 2BREA 3B25A 4GCZA 1B63A 3MDDA 1K8TA 3LGQA 1UYGA 2UWDA 3OWAA 2C2AA 3G7EA 3D9EA 3OWDA 1OSFA 2XJGA 2XS8A 4O05A 4QICA 3Q22A 3RLQA 4ZXVA 1UY7A 4K4OA 1THNA 1ZXMA 4JIOA 1JM6A 3U67A 2Q8HA 3T1KA 2Q8FA 3LMMA 4RM7A 4UROA 4HKSA 3BNHA 2YECA 2YKIA 1Y4SA 1GU6A 2ZBKB 4V26A 5J6AA 4PRXA 2O1VA 4HZ5A 1OAHA 3B96A 3DGEA 4MP7A 4I3HA 3BNGA 3AFFA 2XDLA 3MPIA 4MOTA 1YT0A 2ZKJA 4HXZA 2R0MA 2IOQA 3HEKA 1NHHA 2XABA 2OEXA 3KMLA 4L93A 4XE2A 3R92A 3S5TA 2JBRA 3SF6A 4NH8A 1H7SA 3VADA 2CCUA 4IV6A 4CWFA 1U2OA 3O0IA 4E02A 1GJVA 4H85A 1BXDA 1GKXA 4FF3A 2FP2A 1ID0A 1YERA 1SC5A 2DVLA 3M9VA 2YYIA 4HYPA 1Y8OA 2A1TA 4HR3A 4B6CA 4ZVIA 1U0ZA 3FT8A 1TC6A 1BGQA 3T2SA 2QFOA 2XJXA 3QDDA 3CRLA 2QR4A 5CTYA 1PI1A 1YSZA 3D36A 3Q5JA 2XHXA 2XDKA 3GIFA 4L94A 4XTJA 4ASFA 4XIRA 3MPJA 3VHCA 4L3YA 1X91A 5D7RA 4B7PA 2PG0A 4AKIA 2IOPA 1EI1A 4XD8A 2YE5A 3X0YA 4ZKIA 2YYJA 2VW5A 2YE4A 1Y0VA 3B28A 4CWPA 1Y8PA 2HG1A 2PNRA 4HYMA 5D6QA 4WJYA 5BRMA 3EHHA 1QYEA 1XFXA 3PFDA 2GQPA 4KTNA 2YK2A 2FXSA 4E01A 2FTKA 2ZO5A 2YI6A 2YE8A 3BM9A 1T9GA 1I58A 4GGLA 1UKWA 1FS8A 2XX5A 3ZKDA 2CH4A 3FV5A 4LPBA 4MB9A 2F6LA 1Z5CA 4E72A 4KFGA 1IS2A 2R03A 2VWCA 2BU5A 3R91A 3ZXOA 2LFWA 2YKBA 2CJ8A 1TILA 3GQTA 2XHRA 2ESAA 3HZ1A 2YEIA 4KSHA 4P79A 3SXQA 4AKGA 2EBAA 3RLRA 3O6OA 1QZRA 3TTZA 4KCFA 2HJNA 1EA6A 4XDMA 3RKZA 3ZKBA 3OIBA 3RLPA 2IORA 1F51A 3B26A 3RKHA 3A0WA 1YESA 4KQVA 4CE3A 4XVXA 4NXLA 4LQQB 4FCRA 2YYMA 5M4MA 1UYCA 2H55A 5BRKA 3TZ2A 1BUCA 4F0XA 1I5AA 3H4LA 2XJJA 1RJ1A 1K93A 2FWYA 4Q20A 4LWEA 2HKJA 3IEDA 2WI4A 2Q8IA 4P8OA 1X90A 2WEQA 3O2FA 1MX0A 3OPDA 1S26A 1SIQA 4U83A 2YGEA 3KE6A 2BTZA 5M4HA 2CJ7A 4AWOA 4MP2A 1JQIA 1PVGA 2YEJA 1XFUA 4U7NA 4BAEA 4YKTA 2E81A 4JQLA 1S16A 2J7AA 2WBIA 2QG2A 4GEEA 5CTWA 4FPPA 4LP0A 2YYLA 5GJVE 4FCPA 4FMTA 4DZYA 1RP3A 3FO3A 4EMVA 4Q5BA 4E00A 3CGZA 3T10A 4G5EA 1Y8NA 4EGIA 3PEHA 2K5BA 4O04A 1UYHA 4JAVA 2WEPA 5JENA 2JKIA 3HZ5A 2VCJA 2JBSA 1YSRA 2YE7A 4CE1A 2C0UA 5K3GA 2BYHA 4L8ZA 2EBFX 3D1IA 5FNDA 4FZ4A 1UYFA 4G97A 3N0RA 3FT5A 2AO2A 3P4TA 4OO2A 4QPJA 5D6PA 4AS9A 5BOCA 4WUCA 1H7UA 2WI2A 1XFVA 4ASBA 3HYYA 2D29A 3A0TA 3GM6A 2YYKA 2XHTA 2VR0A 2PO4A 1UYMA 2YEDA 2RFQA 4HZ0A 4H81A 4O0BA 2BRCA 4EFUA 3D6BA 1UYLA 2YE3A 1QY8A 1UYIA 3CGYA 4L1FA 4MBCA 1GKZA 4L3XA 1SK6A 4PL9A 4EGHA 3MDEA 3NMQA 2WI5A 4GFNA 4CWRA 4XKAA 4XKKA 3QTFA 3UU9A 4Q4UA 1YETA 2R05A 4MPCA 2XK2A 2OJQA 4L3ZA 1MU5A 5CTUA 4YKQA 1TH8A 4YKYA 2RDZA 4ASGA 4DOYA 2YI0A 4L38A 3HYZA 1U8VA 1BKNA 4WUDA 2WERA 1UY8A 3R7KA 4AWQA 4U93A 4BQJA 4KSGA 1EGCA 1NHJA 4XITA 4AI6A 3H80A 4M9AA 4X28C 2CJ4A 2YI7A 3HHUA 4X28A 3TZ4A 1BYQA 1KZNA 2FYPA 2YE9A 3U2KA 4O07A 5D7DA 5M4KA 3INWA 3X29A 3ZM7A 2OEVA 3A0RA 2JBTA 3D9DA 3B24A 5FWKA 3A0ZA 4QPKA 4JIZA 4GT8A 1YC1A 2JIFA
chains in the Genus database with same CATH topology
4YKXA 2AKPA 1TC0A 1Z5BA 3EKOA 3LNUA 4LWIA 3GIGA 2YJWA 4W7TA 3R4PA 1A4HA 4BXIA 4YKZA 1UY6A 2XDUA 3LPSA 4LWHA 4URMA 3JZ3A 2FWZA 4O09A 4CWSA 4MPEA 1I5BA 3T0ZA 4YKWA 4XCLA 2XX2A 2E0AA 1UY9A 5F5RA 3WHAA 4V25A 3EHFA 1YC3A 2QF6A 2O1UA 4H7QA 5CF0A 5CPHA 2IWXA 2BZ5A 1YC4A 4CWTA 4KP4A 3SL2A 3TUHA 2BU8A 3BMYA 2BYIA 1TIDA 2Q8GA 2XX4A 2WI1A 4DUHA 1YT2A 2YEFA 5F3KA 4CWNA 4JASA 3CRKA 5IN9A 1YS3A 3R4OA 2EXLA 2VCIA 3R4NA 4NH9A 3K98A 3EHGA 1I5DA 3INXA 3WQ9A 4EM7A 1I59A 2ZDYA 2YEHA 4HXWA 2QG0A 4XCJA 2YKJA 3OW6A 4I5SA 3CWVA 1UYEA 4URNA 4XKOA 2YGAA 3C0EA 3TZ5A 3D2RA 2ZDXA 3Q5LA 1Z59A 1R62A 5FNCA 1B3QA 4YKRA 2WI3A 2BU7A 3VHAA 2YJXA 4R3AA 5BODA 4HY1A 1UYDA 4PU9A 2YKCA 1ZXNA 4NH7A 2CGFA 2YEBA 5M4NA 3G75A 4JAUA 4P7AA 3C11A 2BU2A 3B27A 4GQTA 3ZXQA 4MPNA 2IWUA 4HY6A 1S14A 3K99A 4FCQA 1Z5AA 2YGFA 1TBWA 4LWFA 5M4EA 2JJCA 3A0YA 3MNRP 2CG9A 4WUBA 5IDJA 1US7A 1AH8A 2XDXA 2CCTA 2XCMA 2YE2A 3PEJA 5D7CA 2YI5A 4XC0A 4CWOA 1AMWA 1Y4UA 3D0BA 2YEEA 3TZ0A 5C93A 4EGKA 2WI6A 2BSMA 4BQGA 1ZW9A 2CCSA 4YKUA 5GGZA 1KIJA 4R1FA 4X9LA 3G7BA 5J71A 4L91A 2YK9A 4BIUA 2YEAA 4ASAA 4L90A 5FNFA 2BT0A 3A0XA 3K97A 4U7OA 4LWGA 3T0HA 4R3MA 4AWPA 3Q5KA 2YE6A 1I5CA 4BIZA 2YEGA 5L3JA 1AH6A 4CE2A 5CTXA 1L0OA 3EKRA 1YT1A 2XD6A 3OWBA 2BU6A 2O1WA 2H8MA 5IDMA 4CWQA 1ZWHA 1UYKA 2Q2EB 3U2DA 2YKEA 3R4MA 2GFDA 3VHDA 1AJ6A 3GIGB 4XIQA 4EFTA 4URLA 3EHJA 4XIPA 2HCHA 3GIEA 1AM1A 5M4PA 4PRVA 2IWSA 2WI7A 3K60A 4EEHA 1NHIA 3OMUA 2XDSA 1B62A 2BREA 3B25A 4GCZA 1B63A 1UYGA 2UWDA 3G7EA 2C2AA 3OWDA 1OSFA 2XJGA 4O05A 3RLQA 1UY7A 4K4OA 1THNA 1ZXMA 1JM6A 3U67A 2Q8HA 3T1KA 2Q8FA 4UROA 2YECA 2YKIA 1Y4SA 4V26A 5J6AA 4PRXA 2O1VA 4HZ5A 3DGEA 4MP7A 4I3HA 2XDLA 4MOTA 1YT0A 2ZKJA 4HXZA 2IOQA 3HEKA 1NHHA 2XABA 4L93A 4XE2A 3R92A 4NH8A 1H7SA 3VADA 2CCUA 4CWFA 1U2OA 3O0IA 4E02A 1GJVA 4H85A 1BXDA 1GKXA 1ID0A 1YERA 4HYPA 1Y8OA 4B6CA 4ZVIA 1U0ZA 3FT8A 1TC6A 1BGQA 3T2SA 2QFOA 2XJXA 3QDDA 3CRLA 5CTYA 1YSZA 3D36A 3Q5JA 2XHXA 2XDKA 3GIFA 4L94A 4XTJA 4ASFA 4XIRA 3VHCA 5D7RA 4B7PA 2IOPA 1EI1A 4XD8A 2YE5A 4ZKIA 2VW5A 2YE4A 3B28A 4CWPA 1Y8PA 2HG1A 2PNRA 4HYMA 5D6QA 3EHHA 1QYEA 2GQPA 4KTNA 2YK2A 2FXSA 4E01A 2YI6A 2YE8A 3BM9A 1I58A 4GGLA 2XX5A 3ZKDA 2CH4A 3FV5A 4LPBA 4MB9A 1Z5CA 4KFGA 2VWCA 3R91A 2BU5A 3ZXOA 2YKBA 1TILA 2XHRA 2ESAA 3HZ1A 2YEIA 4KSHA 3RLRA 3O6OA 1QZRA 3TTZA 1EA6A 4XDMA 3RKZA 3ZKBA 3RLPA 2IORA 3B26A 3A0WA 1YESA 4KQVA 4CE3A 4FCRA 5M4MA 1UYCA 2H55A 3TZ2A 1I5AA 3H4LA 2XJJA 2FWYA 4Q20A 4LWEA 2HKJA 3IEDA 2WI4A 2Q8IA 4P8OA 2WEQA 3O2FA 1MX0A 3OPDA 2YGEA 3KE6A 2BTZA 5M4HA 4AWOA 4MP2A 1PVGA 2YEJA 4U7NA 4BAEA 4YKTA 4JQLA 1S16A 2QG2A 4GEEA 5CTWA 4FPPA 4LP0A 4FCPA 4FMTA 4DZYA 4EMVA 4E00A 3CGZA 3T10A 1Y8NA 4EGIA 3PEHA 2K5BA 4O04A 1UYHA 4JAVA 2WEPA 2JKIA 3HZ5A 2VCJA 1YSRA 2YE7A 4CE1A 2BYHA 4L8ZA 5FNDA 1UYFA 3FT5A 4QPJA 5D6PA 4AS9A 5BOCA 4WUCA 1H7UA 2WI2A 4ASBA 3HYYA 3A0TA 2XHTA 4HZ0A 2YEDA 1UYMA 4O0BA 4H81A 2BRCA 4EFUA 1UYLA 2YE3A 1QY8A 1UYIA 3CGYA 4MBCA 1GKZA 4PL9A 4EGHA 3NMQA 2WI5A 4GFNA 4CWRA 4XKAA 4XKKA 3QTFA 1YETA 4MPCA 2XK2A 1MU5A 5CTUA 4YKQA 1TH8A 4YKYA 4ASGA 2YI0A 3HYZA 1BKNA 4WUDA 2WERA 1UY8A 4AWQA 4U93A 4BQJA 4KSGA 1NHJA 4XITA 3H80A 2YI7A 3HHUA 3TZ4A 1BYQA 1KZNA 2FYPA 2YE9A 3U2KA 4O07A 5D7DA 5M4KA 3INWA 3ZM7A 3A0RA 3B24A 5FWKA 3A0ZA 4QPKA 4GT8A 1YC1A 2ZBKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YKX A;  2AKP A;  1TC0 A;  1Z5B A;  3EKO A;  3LNU A;  4LWI A;  3GIG A;  2YJW A;  4W7T A;  3R4P A;  1A4H A;  4BXI A;  4YKZ A;  1UY6 A;  2XDU A;  3LPS A;  4LWH A;  4URM A;  3JZ3 A;  2FWZ A;  4O09 A;  4CWS A;  4MPE A;  1I5B A;  3T0Z A;  4YKW A;  4XCL A;  2XX2 A;  2E0A A;  1UY9 A;  5F5R A;  3WHA A;  4V25 A;  3EHF A;  1YC3 A;  2QF6 A;  2O1U A;  4H7Q A;  5CF0 A;  5CPH A;  2IWX A;  2BZ5 A;  1YC4 A;  4CWT A;  4KP4 A;  3SL2 A;  3TUH A;  2BU8 A;  3BMY A;  2BYI A;  1TID A;  2Q8G A;  2XX4 A;  2WI1 A;  4DUH A;  1YT2 A;  2YEF A;  5F3K A;  4CWN A;  4JAS A;  3CRK A;  5IN9 A;  1YS3 A;  3R4O A;  2EXL A;  2VCI A;  3R4N A;  4NH9 A;  3K98 A;  3EHG A;  1I5D A;  3INX A;  3WQ9 A;  4EM7 A;  1I59 A;  2ZDY A;  2YEH A;  4HXW A;  2QG0 A;  4XCJ A;  2YKJ A;  3OW6 A;  4I5S A;  3CWV A;  1UYE A;  4URN A;  4XKO A;  2YGA A;  3C0E A;  3TZ5 A;  3D2R A;  2ZDX A;  3Q5L A;  1Z59 A;  1R62 A;  5FNC A;  1B3Q A;  4YKR A;  2WI3 A;  2BU7 A;  3VHA A;  2YJX A;  4R3A A;  5BOD A;  4HY1 A;  1UYD A;  4PU9 A;  2YKC A;  1ZXN A;  4NH7 A;  2CGF A;  2YEB A;  5M4N A;  3G75 A;  4JAU A;  4P7A A;  3C11 A;  2BU2 A;  3B27 A;  4GQT A;  3ZXQ A;  4MPN A;  2IWU A;  4HY6 A;  1S14 A;  3K99 A;  4FCQ A;  1Z5A A;  2YGF A;  1TBW A;  4LWF A;  5M4E A;  2JJC A;  3A0Y A;  3MNR P;  2CG9 A;  4WUB A;  5IDJ A;  1US7 A;  1AH8 A;  2XDX A;  2CCT A;  2XCM A;  2YE2 A;  3PEJ A;  5D7C A;  2YI5 A;  4XC0 A;  4CWO A;  1AMW A;  1Y4U A;  3D0B A;  2YEE A;  3TZ0 A;  5C93 A;  4EGK A;  2WI6 A;  2BSM A;  4BQG A;  1ZW9 A;  2CCS A;  4YKU A;  5GGZ A;  1KIJ A;  4R1F A;  4X9L A;  3G7B A;  5J71 A;  4L91 A;  2YK9 A;  4BIU A;  2YEA A;  4ASA A;  4L90 A;  5FNF A;  2BT0 A;  3A0X A;  3K97 A;  4U7O A;  4LWG A;  3T0H A;  4R3M A;  4AWP A;  3Q5K A;  2YE6 A;  1I5C A;  4BIZ A;  2YEG A;  5L3J A;  1AH6 A;  4CE2 A;  5CTX A;  1L0O A;  3EKR A;  1YT1 A;  2XD6 A;  3OWB A;  2BU6 A;  2O1W A;  2H8M A;  5IDM A;  4CWQ A;  1ZWH A;  1UYK A;  2Q2E B;  3U2D A;  2YKE A;  3R4M A;  2GFD A;  3VHD A;  1AJ6 A;  3GIG B;  4XIQ A;  4EFT A;  4URL A;  3EHJ A;  4XIP A;  2HCH A;  3GIE A;  1AM1 A;  5M4P A;  4PRV A;  2IWS A;  2WI7 A;  3K60 A;  4EEH A;  1NHI A;  3OMU A;  2XDS A;  1B62 A;  2BRE A;  3B25 A;  4GCZ A;  1B63 A;  1UYG A;  2UWD A;  3G7E A;  2C2A A;  3OWD A;  1OSF A;  2XJG A;  4O05 A;  3RLQ A;  1UY7 A;  4K4O A;  1THN A;  1ZXM A;  1JM6 A;  3U67 A;  2Q8H A;  3T1K A;  2Q8F A;  4URO A;  2YEC A;  2YKI A;  1Y4S A;  4V26 A;  5J6A A;  4PRX A;  2O1V A;  4HZ5 A;  3DGE A;  4MP7 A;  4I3H A;  2XDL A;  4MOT A;  1YT0 A;  2ZKJ A;  4HXZ A;  2IOQ A;  3HEK A;  1NHH A;  2XAB A;  4L93 A;  4XE2 A;  3R92 A;  4NH8 A;  1H7S A;  3VAD A;  2CCU A;  4CWF A;  1U2O A;  3O0I A;  4E02 A;  1GJV A;  4H85 A;  1BXD A;  1GKX A;  1ID0 A;  1YER A;  4HYP A;  1Y8O A;  4B6C A;  4ZVI A;  1U0Z A;  3FT8 A;  1TC6 A;  1BGQ A;  3T2S A;  2QFO A;  2XJX A;  3QDD A;  3CRL A;  5CTY A;  1YSZ A;  3D36 A;  3Q5J A;  2XHX A;  2XDK A;  3GIF A;  4L94 A;  4XTJ A;  4ASF A;  4XIR A;  3VHC A;  5D7R A;  4B7P A;  2IOP A;  1EI1 A;  4XD8 A;  2YE5 A;  4ZKI A;  2VW5 A;  2YE4 A;  3B28 A;  4CWP A;  1Y8P A;  2HG1 A;  2PNR A;  4HYM A;  5D6Q A;  3EHH A;  1QYE A;  2GQP A;  4KTN A;  2YK2 A;  2FXS A;  4E01 A;  2YI6 A;  2YE8 A;  3BM9 A;  1I58 A;  4GGL A;  2XX5 A;  3ZKD A;  2CH4 A;  3FV5 A;  4LPB A;  4MB9 A;  1Z5C A;  4KFG A;  2VWC A;  3R91 A;  2BU5 A;  3ZXO A;  2YKB A;  1TIL A;  2XHR A;  2ESA A;  3HZ1 A;  2YEI A;  4KSH A;  3RLR A;  3O6O A;  1QZR A;  3TTZ A;  1EA6 A;  4XDM A;  3RKZ A;  3ZKB A;  3RLP A;  2IOR A;  3B26 A;  3A0W A;  1YES A;  4KQV A;  4CE3 A;  4FCR A;  5M4M A;  1UYC A;  2H55 A;  3TZ2 A;  1I5A A;  3H4L A;  2XJJ A;  2FWY A;  4Q20 A;  4LWE A;  2HKJ A;  3IED A;  2WI4 A;  2Q8I A;  4P8O A;  2WEQ A;  3O2F A;  1MX0 A;  3OPD A;  2YGE A;  3KE6 A;  2BTZ A;  5M4H A;  4AWO A;  4MP2 A;  1PVG A;  2YEJ A;  4U7N A;  4BAE A;  4YKT A;  4JQL A;  1S16 A;  2QG2 A;  4GEE A;  5CTW A;  4FPP A;  4LP0 A;  4FCP A;  4FMT A;  4DZY A;  4EMV A;  4E00 A;  3CGZ A;  3T10 A;  1Y8N A;  4EGI A;  3PEH A;  2K5B A;  4O04 A;  1UYH A;  4JAV A;  2WEP A;  2JKI A;  3HZ5 A;  2VCJ A;  1YSR A;  2YE7 A;  4CE1 A;  2BYH A;  4L8Z A;  5FND A;  1UYF A;  3FT5 A;  4QPJ A;  5D6P A;  4AS9 A;  5BOC A;  4WUC A;  1H7U A;  2WI2 A;  4ASB A;  3HYY A;  3A0T A;  2XHT A;  4HZ0 A;  2YED A;  1UYM A;  4O0B A;  4H81 A;  2BRC A;  4EFU A;  1UYL A;  2YE3 A;  1QY8 A;  1UYI A;  3CGY A;  4MBC A;  1GKZ A;  4PL9 A;  4EGH A;  3NMQ A;  2WI5 A;  4GFN A;  4CWR A;  4XKA A;  4XKK A;  3QTF A;  1YET A;  4MPC A;  2XK2 A;  1MU5 A;  5CTU A;  4YKQ A;  1TH8 A;  4YKY A;  4ASG A;  2YI0 A;  3HYZ A;  1BKN A;  4WUD A;  2WER A;  1UY8 A;  4AWQ A;  4U93 A;  4BQJ A;  4KSG A;  1NHJ A;  4XIT A;  3H80 A;  2YI7 A;  3HHU A;  3TZ4 A;  1BYQ A;  1KZN A;  2FYP A;  2YE9 A;  3U2K A;  4O07 A;  5D7D A;  5M4K A;  3INW A;  3ZM7 A;  3A0R A;  3B24 A;  5FWK A;  3A0Z A;  4QPK A;  4GT8 A;  1YC1 A;  2ZBK B; 
#chains in the Genus database with same CATH topology
 4YKX A;  2CJ6 A;  2AKP A;  1XFY A;  1TC0 A;  1Z5B A;  3EKO A;  2UXW A;  2CX9 A;  3LNU A;  3GIG A;  4LWI A;  2YJW A;  4W7T A;  2R0N A;  3R4P A;  1A4H A;  4BXI A;  3NF4 A;  4YKZ A;  1X8Z A;  1UY6 A;  3C3L A;  3Q0A A;  2XDU A;  3LPS A;  4LWH A;  4URM A;  3FCJ A;  3JZ3 A;  2FWZ A;  4O09 A;  4CWS A;  2C1G A;  4MPE A;  1R2J A;  2RF7 A;  1I5B A;  3BNJ A;  4AKH A;  3T0Z A;  3AFE A;  4JEK A;  4XCL A;  2XX2 A;  3TOR A;  4YKW A;  2E0A A;  3C2P A;  1UY9 A;  5F5R A;  3WHA A;  4V25 A;  3D9G A;  3EHF A;  1YC3 A;  2QF6 A;  2O1U A;  4H7Q A;  4Q0T A;  5CF0 A;  5CPH A;  2IWX A;  2BZ5 A;  4Q1O A;  1YC4 A;  4CWT A;  2OT4 A;  4KP4 A;  4KSF A;  3SL2 A;  3MMO A;  3TUH A;  3GNC A;  2BU8 A;  2EBH X;  3OWM A;  2GBB A;  3BMY A;  2BYI A;  1TID A;  2Q8G A;  2XX4 A;  2WI1 A;  4FF2 A;  4DUH A;  1YT2 A;  2YEF A;  3HWC A;  5F3K A;  2YYG A;  4CWN A;  4JAS A;  3CRK A;  5IN9 A;  3EON A;  3EOM A;  1YS3 A;  3R4O A;  2FP1 A;  2EXL A;  2VCI A;  3R4N A;  2VIG A;  4KS9 A;  3K98 A;  3EHG A;  4NH9 A;  1I5D A;  3INX A;  2FON A;  3WQ9 A;  4EM7 A;  3C46 A;  1I59 A;  2ZDY A;  5B5W A;  2YEH A;  4HXW A;  1XG2 B;  2QG0 A;  4XCJ A;  1WS9 A;  1IVH A;  2YKJ A;  3OW6 A;  4I5S A;  3CWV A;  3MXL A;  5B5V A;  1UYE A;  4KTO A;  4N5F A;  2E80 A;  4URN A;  4XKO A;  2YGA A;  3C0E A;  3TZ5 A;  3D2R A;  2ZDX A;  3Q5L A;  1Z59 A;  1R62 A;  5FNC A;  1B3Q A;  4YKR A;  5K3J A;  2WI3 A;  2BU7 A;  1LVC A;  5K3I A;  3VHA A;  2YJX A;  4R3A A;  5BOD A;  4HY1 A;  1UYD A;  4PU9 A;  2YKC A;  1ZXN A;  4NH7 A;  2CGF A;  3LG1 A;  4P13 A;  2YEB A;  5M4N A;  3G75 A;  1EGD A;  4JAU A;  4P7A A;  3C11 A;  2BU2 A;  3B27 A;  2EC5 A;  4GQT A;  3ZXQ A;  4MPN A;  2IWU A;  4HY6 A;  1S14 A;  1K90 A;  3K99 A;  4FCQ A;  2C12 A;  2Z1Q A;  1Z5A A;  2OR0 A;  2YGF A;  1TBW A;  4LWF A;  3Q23 A;  5M4E A;  2JJC A;  2CJ5 A;  3A0Y A;  3MNR P;  3X0X A;  2CG9 A;  4WUB A;  1UDY A;  2REH A;  5IDJ A;  1US7 A;  4FF4 A;  1AH8 A;  3II9 A;  2XDX A;  5GJW E;  2C1I A;  4HKR A;  2CCT A;  2DDH A;  2XCM A;  2YE2 A;  3PEJ A;  5D7C A;  2YI5 A;  2VF1 A;  4XC0 A;  3MKH A;  4CWO A;  1AMW A;  2YGW A;  1Y4U A;  3D0B A;  2YEE A;  3TZ0 A;  4Q17 A;  1EGE A;  1PK0 A;  4J1V A;  1QDB A;  5C93 A;  4EGK A;  2WI6 A;  2BSM A;  4BQG A;  1ZW9 A;  2IX6 A;  3SWO A;  2CCS A;  4YKU A;  3L1T A;  3UBR A;  3TTB A;  5GGZ A;  1KIJ A;  4R1F A;  4X9L A;  3G7B A;  5J71 A;  4L91 A;  1XFW A;  2YK9 A;  4BIU A;  2YEA A;  4ASA A;  2AZE A;  4L90 A;  5FNF A;  2BT0 A;  3A0X A;  3K97 A;  4U7O A;  3BNF A;  4LWG A;  3T0H A;  4R3M A;  1IXM A;  4AWP A;  3Q5K A;  4KSA A;  2YE6 A;  1I5C A;  3S7W A;  1SIR A;  4LQS B;  4BIZ A;  1W07 A;  5K3H A;  5B6B A;  4W9U A;  2IX5 A;  2YEG A;  5L3J A;  4ZYJ A;  4Q5C A;  3D9F A;  1AH6 A;  4CE2 A;  3VKH A;  1FS9 A;  5CTX A;  4FF1 A;  1L0O A;  3EKR A;  1YT1 A;  2XD6 A;  3OWB A;  2BU6 A;  2HHI A;  2ZAF A;  4IRN A;  2O1W A;  2XS1 A;  2H8M A;  5IDM A;  2R02 A;  4CWQ A;  1ZWH A;  1FS7 A;  1XFZ A;  3Q24 A;  1RX0 A;  1UYK A;  2Q2E B;  3U2D A;  2YKE A;  3SCE A;  1R3B A;  3R4M A;  4O5M A;  3F29 A;  1RJ4 A;  2GFD A;  3VHD A;  1AJ6 A;  2XQR B;  3GIG B;  4XIQ A;  4EFT A;  4URL A;  3VKG A;  3EHJ A;  4XIP A;  2HCH A;  3GIE A;  1AM1 A;  5M4P A;  3CE2 A;  2IWS A;  2WI7 A;  3K60 A;  4PRV A;  4EEH A;  3CYG A;  1NHI A;  3OMU A;  2XDS A;  1B62 A;  2BRE A;  3B25 A;  4GCZ A;  1B63 A;  3MDD A;  1K8T A;  3LGQ A;  1UYG A;  2UWD A;  3OWA A;  2C2A A;  3G7E A;  3D9E A;  3OWD A;  1OSF A;  2XJG A;  2XS8 A;  4O05 A;  4QIC A;  3Q22 A;  3RLQ A;  4ZXV A;  1UY7 A;  4K4O A;  1THN A;  1ZXM A;  4JIO A;  1JM6 A;  3U67 A;  2Q8H A;  3T1K A;  2Q8F A;  3LMM A;  4RM7 A;  4URO A;  4HKS A;  3BNH A;  2YEC A;  2YKI A;  1Y4S A;  1GU6 A;  2ZBK B;  4V26 A;  5J6A A;  4PRX A;  2O1V A;  4HZ5 A;  1OAH A;  3B96 A;  3DGE A;  4MP7 A;  4I3H A;  3BNG A;  3AFF A;  2XDL A;  3MPI A;  4MOT A;  1YT0 A;  2ZKJ A;  4HXZ A;  2R0M A;  2IOQ A;  3HEK A;  1NHH A;  2XAB A;  2OEX A;  3KML A;  4L93 A;  4XE2 A;  3R92 A;  3S5T A;  2JBR A;  3SF6 A;  4NH8 A;  1H7S A;  3VAD A;  2CCU A;  4IV6 A;  4CWF A;  1U2O A;  3O0I A;  4E02 A;  1GJV A;  4H85 A;  1BXD A;  1GKX A;  4FF3 A;  2FP2 A;  1ID0 A;  1YER A;  1SC5 A;  2DVL A;  3M9V A;  2YYI A;  4HYP A;  1Y8O A;  2A1T A;  4HR3 A;  4B6C A;  4ZVI A;  1U0Z A;  3FT8 A;  1TC6 A;  1BGQ A;  3T2S A;  2QFO A;  2XJX A;  3QDD A;  3CRL A;  2QR4 A;  5CTY A;  1PI1 A;  1YSZ A;  3D36 A;  3Q5J A;  2XHX A;  2XDK A;  3GIF A;  4L94 A;  4XTJ A;  4ASF A;  4XIR A;  3MPJ A;  3VHC A;  4L3Y A;  1X91 A;  5D7R A;  4B7P A;  2PG0 A;  4AKI A;  2IOP A;  1EI1 A;  4XD8 A;  2YE5 A;  3X0Y A;  4ZKI A;  2YYJ A;  2VW5 A;  2YE4 A;  1Y0V A;  3B28 A;  4CWP A;  1Y8P A;  2HG1 A;  2PNR A;  4HYM A;  5D6Q A;  4WJY A;  5BRM A;  3EHH A;  1QYE A;  1XFX A;  3PFD A;  2GQP A;  4KTN A;  2YK2 A;  2FXS A;  4E01 A;  2FTK A;  2ZO5 A;  2YI6 A;  2YE8 A;  3BM9 A;  1T9G A;  1I58 A;  4GGL A;  1UKW A;  1FS8 A;  2XX5 A;  3ZKD A;  2CH4 A;  3FV5 A;  4LPB A;  4MB9 A;  2F6L A;  1Z5C A;  4E72 A;  4KFG A;  1IS2 A;  2R03 A;  2VWC A;  2BU5 A;  3R91 A;  3ZXO A;  2LFW A;  2YKB A;  2CJ8 A;  1TIL A;  3GQT A;  2XHR A;  2ESA A;  3HZ1 A;  2YEI A;  4KSH A;  4P79 A;  3SXQ A;  4AKG A;  2EBA A;  3RLR A;  3O6O A;  1QZR A;  3TTZ A;  4KCF A;  2HJN A;  1EA6 A;  4XDM A;  3RKZ A;  3ZKB A;  3OIB A;  3RLP A;  2IOR A;  1F51 A;  3B26 A;  3RKH A;  3A0W A;  1YES A;  4KQV A;  4CE3 A;  4XVX A;  4NXL A;  4LQQ B;  4FCR A;  2YYM A;  5M4M A;  1UYC A;  2H55 A;  5BRK A;  3TZ2 A;  1BUC A;  4F0X A;  1I5A A;  3H4L A;  2XJJ A;  1RJ1 A;  1K93 A;  2FWY A;  4Q20 A;  4LWE A;  2HKJ A;  3IED A;  2WI4 A;  2Q8I A;  4P8O A;  1X90 A;  2WEQ A;  3O2F A;  1MX0 A;  3OPD A;  1S26 A;  1SIQ A;  4U83 A;  2YGE A;  3KE6 A;  2BTZ A;  5M4H A;  2CJ7 A;  4AWO A;  4MP2 A;  1JQI A;  1PVG A;  2YEJ A;  1XFU A;  4U7N A;  4BAE A;  4YKT A;  2E81 A;  4JQL A;  1S16 A;  2J7A A;  2WBI A;  2QG2 A;  4GEE A;  5CTW A;  4FPP A;  4LP0 A;  2YYL A;  5GJV E;  4FCP A;  4FMT A;  4DZY A;  1RP3 A;  3FO3 A;  4EMV A;  4Q5B A;  4E00 A;  3CGZ A;  3T10 A;  4G5E A;  1Y8N A;  4EGI A;  3PEH A;  2K5B A;  4O04 A;  1UYH A;  4JAV A;  2WEP A;  5JEN A;  2JKI A;  3HZ5 A;  2VCJ A;  2JBS A;  1YSR A;  2YE7 A;  4CE1 A;  2C0U A;  5K3G A;  2BYH A;  4L8Z A;  2EBF X;  3D1I A;  5FND A;  4FZ4 A;  1UYF A;  4G97 A;  3N0R A;  3FT5 A;  2AO2 A;  3P4T A;  4OO2 A;  4QPJ A;  5D6P A;  4AS9 A;  5BOC A;  4WUC A;  1H7U A;  2WI2 A;  1XFV A;  4ASB A;  3HYY A;  2D29 A;  3A0T A;  3GM6 A;  2YYK A;  2XHT A;  2VR0 A;  2PO4 A;  1UYM A;  2YED A;  2RFQ A;  4HZ0 A;  4H81 A;  4O0B A;  2BRC A;  4EFU A;  3D6B A;  1UYL A;  2YE3 A;  1QY8 A;  1UYI A;  3CGY A;  4L1F A;  4MBC A;  1GKZ A;  4L3X A;  1SK6 A;  4PL9 A;  4EGH A;  3MDE A;  3NMQ A;  2WI5 A;  4GFN A;  4CWR A;  4XKA A;  4XKK A;  3QTF A;  3UU9 A;  4Q4U A;  1YET A;  2R05 A;  4MPC A;  2XK2 A;  2OJQ A;  4L3Z A;  1MU5 A;  5CTU A;  4YKQ A;  1TH8 A;  4YKY A;  2RDZ A;  4ASG A;  4DOY A;  2YI0 A;  4L38 A;  3HYZ A;  1U8V A;  1BKN A;  4WUD A;  2WER A;  1UY8 A;  3R7K A;  4AWQ A;  4U93 A;  4BQJ A;  4KSG A;  1EGC A;  1NHJ A;  4XIT A;  4AI6 A;  3H80 A;  4M9A A;  4X28 C;  2CJ4 A;  2YI7 A;  3HHU A;  4X28 A;  3TZ4 A;  1BYQ A;  1KZN A;  2FYP A;  2YE9 A;  3U2K A;  4O07 A;  5D7D A;  5M4K A;  3INW A;  3X29 A;  3ZM7 A;  2OEV A;  3A0R A;  2JBT A;  3D9D A;  3B24 A;  5FWK A;  3A0Z A;  4QPK A;  4JIZ A;  4GT8 A;  1YC1 A;  2JIF A; 
#chains in the Genus database with same CATH homology
 4YKX A;  2AKP A;  1TC0 A;  1Z5B A;  3EKO A;  3LNU A;  4LWI A;  3GIG A;  2YJW A;  4W7T A;  3R4P A;  1A4H A;  4BXI A;  4YKZ A;  1UY6 A;  2XDU A;  3LPS A;  4LWH A;  4URM A;  3JZ3 A;  2FWZ A;  4O09 A;  4CWS A;  4MPE A;  1I5B A;  3T0Z A;  4YKW A;  4XCL A;  2XX2 A;  2E0A A;  1UY9 A;  5F5R A;  3WHA A;  4V25 A;  3EHF A;  1YC3 A;  2QF6 A;  2O1U A;  4H7Q A;  5CF0 A;  5CPH A;  2IWX A;  2BZ5 A;  1YC4 A;  4CWT A;  4KP4 A;  3SL2 A;  3TUH A;  2BU8 A;  3BMY A;  2BYI A;  1TID A;  2Q8G A;  2XX4 A;  2WI1 A;  4DUH A;  1YT2 A;  2YEF A;  5F3K A;  4CWN A;  4JAS A;  3CRK A;  5IN9 A;  1YS3 A;  3R4O A;  2EXL A;  2VCI A;  3R4N A;  4NH9 A;  3K98 A;  3EHG A;  1I5D A;  3INX A;  3WQ9 A;  4EM7 A;  1I59 A;  2ZDY A;  2YEH A;  4HXW A;  2QG0 A;  4XCJ A;  2YKJ A;  3OW6 A;  4I5S A;  3CWV A;  1UYE A;  4URN A;  4XKO A;  2YGA A;  3C0E A;  3TZ5 A;  3D2R A;  2ZDX A;  3Q5L A;  1Z59 A;  1R62 A;  5FNC A;  1B3Q A;  4YKR A;  2WI3 A;  2BU7 A;  3VHA A;  2YJX A;  4R3A A;  5BOD A;  4HY1 A;  1UYD A;  4PU9 A;  2YKC A;  1ZXN A;  4NH7 A;  2CGF A;  2YEB A;  5M4N A;  3G75 A;  4JAU A;  4P7A A;  3C11 A;  2BU2 A;  3B27 A;  4GQT A;  3ZXQ A;  4MPN A;  2IWU A;  4HY6 A;  1S14 A;  3K99 A;  4FCQ A;  1Z5A A;  2YGF A;  1TBW A;  4LWF A;  5M4E A;  2JJC A;  3A0Y A;  3MNR P;  2CG9 A;  4WUB A;  5IDJ A;  1US7 A;  1AH8 A;  2XDX A;  2CCT A;  2XCM A;  2YE2 A;  3PEJ A;  5D7C A;  2YI5 A;  4XC0 A;  4CWO A;  1AMW A;  1Y4U A;  3D0B A;  2YEE A;  3TZ0 A;  5C93 A;  4EGK A;  2WI6 A;  2BSM A;  4BQG A;  1ZW9 A;  2CCS A;  4YKU A;  5GGZ A;  1KIJ A;  4R1F A;  4X9L A;  3G7B A;  5J71 A;  4L91 A;  2YK9 A;  4BIU A;  2YEA A;  4ASA A;  4L90 A;  5FNF A;  2BT0 A;  3A0X A;  3K97 A;  4U7O A;  4LWG A;  3T0H A;  4R3M A;  4AWP A;  3Q5K A;  2YE6 A;  1I5C A;  4BIZ A;  2YEG A;  5L3J A;  1AH6 A;  4CE2 A;  5CTX A;  1L0O A;  3EKR A;  1YT1 A;  2XD6 A;  3OWB A;  2BU6 A;  2O1W A;  2H8M A;  5IDM A;  4CWQ A;  1ZWH A;  1UYK A;  2Q2E B;  3U2D A;  2YKE A;  3R4M A;  2GFD A;  3VHD A;  1AJ6 A;  3GIG B;  4XIQ A;  4EFT A;  4URL A;  3EHJ A;  4XIP A;  2HCH A;  3GIE A;  1AM1 A;  5M4P A;  4PRV A;  2IWS A;  2WI7 A;  3K60 A;  4EEH A;  1NHI A;  3OMU A;  2XDS A;  1B62 A;  2BRE A;  3B25 A;  4GCZ A;  1B63 A;  1UYG A;  2UWD A;  3G7E A;  2C2A A;  3OWD A;  1OSF A;  2XJG A;  4O05 A;  3RLQ A;  1UY7 A;  4K4O A;  1THN A;  1ZXM A;  1JM6 A;  3U67 A;  2Q8H A;  3T1K A;  2Q8F A;  4URO A;  2YEC A;  2YKI A;  1Y4S A;  4V26 A;  5J6A A;  4PRX A;  2O1V A;  4HZ5 A;  3DGE A;  4MP7 A;  4I3H A;  2XDL A;  4MOT A;  1YT0 A;  2ZKJ A;  4HXZ A;  2IOQ A;  3HEK A;  1NHH A;  2XAB A;  4L93 A;  4XE2 A;  3R92 A;  4NH8 A;  1H7S A;  3VAD A;  2CCU A;  4CWF A;  1U2O A;  3O0I A;  4E02 A;  1GJV A;  4H85 A;  1BXD A;  1GKX A;  1ID0 A;  1YER A;  4HYP A;  1Y8O A;  4B6C A;  4ZVI A;  1U0Z A;  3FT8 A;  1TC6 A;  1BGQ A;  3T2S A;  2QFO A;  2XJX A;  3QDD A;  3CRL A;  5CTY A;  1YSZ A;  3D36 A;  3Q5J A;  2XHX A;  2XDK A;  3GIF A;  4L94 A;  4XTJ A;  4ASF A;  4XIR A;  3VHC A;  5D7R A;  4B7P A;  2IOP A;  1EI1 A;  4XD8 A;  2YE5 A;  4ZKI A;  2VW5 A;  2YE4 A;  3B28 A;  4CWP A;  1Y8P A;  2HG1 A;  2PNR A;  4HYM A;  5D6Q A;  3EHH A;  1QYE A;  2GQP A;  4KTN A;  2YK2 A;  2FXS A;  4E01 A;  2YI6 A;  2YE8 A;  3BM9 A;  1I58 A;  4GGL A;  2XX5 A;  3ZKD A;  2CH4 A;  3FV5 A;  4LPB A;  4MB9 A;  1Z5C A;  4KFG A;  2VWC A;  3R91 A;  2BU5 A;  3ZXO A;  2YKB A;  1TIL A;  2XHR A;  2ESA A;  3HZ1 A;  2YEI A;  4KSH A;  3RLR A;  3O6O A;  1QZR A;  3TTZ A;  1EA6 A;  4XDM A;  3RKZ A;  3ZKB A;  3RLP A;  2IOR A;  3B26 A;  3A0W A;  1YES A;  4KQV A;  4CE3 A;  4FCR A;  5M4M A;  1UYC A;  2H55 A;  3TZ2 A;  1I5A A;  3H4L A;  2XJJ A;  2FWY A;  4Q20 A;  4LWE A;  2HKJ A;  3IED A;  2WI4 A;  2Q8I A;  4P8O A;  2WEQ A;  3O2F A;  1MX0 A;  3OPD A;  2YGE A;  3KE6 A;  2BTZ A;  5M4H A;  4AWO A;  4MP2 A;  1PVG A;  2YEJ A;  4U7N A;  4BAE A;  4YKT A;  4JQL A;  1S16 A;  2QG2 A;  4GEE A;  5CTW A;  4FPP A;  4LP0 A;  4FCP A;  4FMT A;  4DZY A;  4EMV A;  4E00 A;  3CGZ A;  3T10 A;  1Y8N A;  4EGI A;  3PEH A;  2K5B A;  4O04 A;  1UYH A;  4JAV A;  2WEP A;  2JKI A;  3HZ5 A;  2VCJ A;  1YSR A;  2YE7 A;  4CE1 A;  2BYH A;  4L8Z A;  5FND A;  1UYF A;  3FT5 A;  4QPJ A;  5D6P A;  4AS9 A;  5BOC A;  4WUC A;  1H7U A;  2WI2 A;  4ASB A;  3HYY A;  3A0T A;  2XHT A;  4HZ0 A;  2YED A;  1UYM A;  4O0B A;  4H81 A;  2BRC A;  4EFU A;  1UYL A;  2YE3 A;  1QY8 A;  1UYI A;  3CGY A;  4MBC A;  1GKZ A;  4PL9 A;  4EGH A;  3NMQ A;  2WI5 A;  4GFN A;  4CWR A;  4XKA A;  4XKK A;  3QTF A;  1YET A;  4MPC A;  2XK2 A;  1MU5 A;  5CTU A;  4YKQ A;  1TH8 A;  4YKY A;  4ASG A;  2YI0 A;  3HYZ A;  1BKN A;  4WUD A;  2WER A;  1UY8 A;  4AWQ A;  4U93 A;  4BQJ A;  4KSG A;  1NHJ A;  4XIT A;  3H80 A;  2YI7 A;  3HHU A;  3TZ4 A;  1BYQ A;  1KZN A;  2FYP A;  2YE9 A;  3U2K A;  4O07 A;  5D7D A;  5M4K A;  3INW A;  3ZM7 A;  3A0R A;  3B24 A;  5FWK A;  3A0Z A;  4QPK A;  4GT8 A;  1YC1 A;  2ZBK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...