4KTOA

Crystal structure of a putative isovaleryl-coa dehydrogenase (psi-nysgrc-012251) from sinorhizobium meliloti 1021
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
385
structure length
377
Chain Sequence
MFEAGLNFALGEEIDALRASVRRFASERIAPLADDADRSNAFPMSLWREMGELGLLGITADEAHGGAGLGYLAHCVAMEEISRASASVGLSYGAHSNLCVNQINRNGKPAQKSRYLPKLISGEHVGALAMSEPGVSMKLKADKRGDRYVLNGSKMWITNGPDADVLVVYAKTDPPRGITAFLVEKAFPGFSAGQKLDKLGMRGSNTSELIFTDCEVPEENVLGGVGEGVKVLMSGLDYERVVLSAGPLGIMAACLDVVVPYLHERKQFGQPIGEFQLMQGKLADMYVTMNAARAYVYAVAAACDRGETARKDAAGCILYAAEKATAMALEAIQALGGNGYTNDYPAGRLLRDAKLYEIGAGTSEIRRMLIGRELFAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords isovaleryl-CoA dehydrogenase
publication title Crystal structure of a Putative Isovaleryl-CoA dehydrogenase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
total genus 134
structure length 377
sequence length 385
chains with identical sequence B, C, D
ec nomenclature ec 1.3.99.10: Transferred entry: 1.3.8.4.
pdb deposition date 2013-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain
A PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain
A PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.540.10 Mainly Alpha Orthogonal Bundle Butyryl-Coa Dehydrogenase, subunit A; domain 1 Acyl-CoA dehydrogenase/oxidase, N-terminal domain 4ktoA01
1.20.140.10 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A, domain 3 4ktoA03
2.40.110.10 Mainly Beta Beta Barrel Butyryl-CoA Dehydrogenase, subunit A; domain 2 Butyryl-CoA Dehydrogenase, subunit A, domain 2 4ktoA02
1OAHA 3HWCA 1QDBA 4Q5CA 3AFEA 2EBAA 2VR0A 2DVLA 2WBIA 2JBRA 4WJYA 4KCFA 3B96A 4X28C 3FO3A 4L3ZA 3GNCA 4HR3A 3D9GA 3L1TA 3AFFA 2REHA 4XVXA 3GQTA 2YYLA 4G5EA 3M9VA 4RM7A 2YYGA 5K3HA 2RF7A 3R7KA 1UDYA 2JBTA 4KTOA 3TORA 2JBSA 2PG0A 1EGEA 4ZXVA 3BNFA 3BNGA 1R2JA 3UU9A 2FONA 2YYMA 3GM6A 4JEKA 3MPJA 3EOMA 4M9AA 3OIBA 3NF4A 1SIQA 3D9DA 4IV6A 5K3IA 4O5MA 2IX6A 2ZAFA 3OWAA 3LGQA 3EONA 4DOYA 2IX5A 4L38A 2YYKA 3X0YA 2D29A 3SWOA 4N5FA 1U8VA 1IVHA 1RX0A 4Q4UA 2J7AA 3S7WA 2E80A 2C12A 1FS9A 1EGDA 4U83A 3PFDA 2E81A 4Q17A 2A1TA 3MKHA 4NXLA 3UBRA 3D6BA 1GU6A 4L3XA 2C0UA 3SCEA 3MDEA 1FS7A 3BNHA 2JIFA 4ZYJA 3BNJA 1EGCA 4L3YA 3SF6A 2R0MA 3RKHA 5K3GA 3MMOA 3D9EA 1IS2A 3FCJA 1JQIA 2VIGA 3P4TA 2DDHA 2YYIA 2R0NA 1UKWA 4L1FA 2OR0A 5K3JA 2OT4A 3OWMA 4Q5BA 3D9FA 1W07A 3X0XA 2UXWA 4IRNA 4Q1OA 1FS8A 3F29A 1SIRA 2CX9A 1BUCA 4Q0TA 4W9UA 4X28A 3MDDA 3MXLA 3SXQA 2RFQA 3D1IA 3LG1A 3MPIA 4OO2A 1WS9A 2ZO5A 4P13A 2Z1QA 3II9A 3TTBA 1T9GA 2RDZA 2YYJA
chains in the Genus database with same CATH superfamily
1OAHA 3HWCA 1QDBA 4LQQB 1XFVA 1Y8OA 4KSAA 4Q5CA 3AFEA 2EBAA 1X90A 2VR0A 2BU8A 2DVLA 3TZ5A 2Q8FA 2WBIA 4HKSA 2JBRA 4MP2A 4WJYA 4KCFA 2XS8A 3B96A 4X28C 2Q8GA 2CJ7A 3FO3A 2HJNA 3C2PA 4L3ZA 3GNCA 2OEXA 4HR3A 3D9GA 3Q24A 3L1TA 3AFFA 2REHA 4XVXA 3GQTA 2CJ8A 2VF1A 2YYLA 4G5EA 4V26A 2BU6A 2Q8HA 3M9VA 4RM7A 2FP2A 2YYGA 5K3HA 4MPNA 1XFZA 2RF7A 4E02A 3R7KA 1UDYA 4J1VA 4FF1A 2RDZA 2JBTA 4KTOA 3TORA 2JBSA 2PG0A 1EGEA 1R3BA 4ZXVA 5GJVE 3BNFA 3BNGA 1R2JA 1SC5A 3UU9A 5BRMA 2EBFX 2PNRA 2FONA 2YYMA 3GM6A 4FF3A 4JEKA 3MPJA 3EOMA 4M9AA 4MP7A 2CJ4A 5BRKA 3OIBA 2FP1A 5J71A 3NF4A 3Q0AA 4FF2A 2F6LA 1SIQA 2Q8IA 3D9DA 4IV6A 5K3IA 4FZ4A 4O5MA 4AKIA 5B6BA 2IX6A 4AKGA 2ZAFA 3OWAA 1Y8NA 3LGQA 3EONA 4DOYA 2IX5A 4L38A 1SK6A 1X8ZA 3VADA 2YYKA 3X0YA 1K90A 5M4PA 2D29A 3SWOA 4N5FA 1U8VA 2YGWA 2ZKJA 1IVHA 5GJWE 5J6AA 1RX0A 4Q4UA 2J7AA 5M4MA 1XFWA 1S26A 2CJ5A 2E80A 2EC5A 3CE2A 3S7WA 2C12A 1FS9A 4HKRA 3Q23A 1EGDA 4U83A 1XFYA 3C46A 4AKHA 3CRKA 3VKGA 3PFDA 2E81A 4KSFA 2A1TA 3MKHA 4NXLA 4Q17A 3UBRA 3D6BA 1XG2B 3C3LA 1GU6A 4L3XA 4DZYA 2C0UA 3SCEA 1K8TA 3MDEA 2BU5A 1FS7A 3BNHA 4QICA 1GKZA 2JIFA 4ZYJA 5B5WA 3BNJA 2QR4A 1EGCA 4L3YA 3SF6A 4V25A 1JM6A 1RP3A 2R05A 1RJ4A 2XQRB 2AZEA 2R0MA 3RKHA 5K3GA 5B5VA 4E00A 4AI6A 3U33A 3MMOA 3D9EA 1IS2A 4KS9A 3DJLA 3KMLA 3FCJA 3TZ4A 3VKHA 3TZ0A 1JQIA 2VIGA 4G97A 2EBHX 4JIZA 3CRLA 4MPEA 4P79A 4F0XA 3P4TA 1RJ1A 2DDHA 2AO2A 2YYIA 2ZDXA 2R0NA 2OEVA 4H85A 1UKWA 4L1FA 2OR0A 5K3JA 2OJQA 4H7QA 3OWMA 4Q5BA 2OT4A 3D9FA 4H81A 4JIOA 1W07A 3X29A 5M4NA 3X0XA 1XFXA 2UXWA 4IRNA 4Q1OA 1FS8A 2R02A 2ZDYA 3F29A 5EZ3A 1SIRA 3N0RA 4FF4A 1PK0A 1X91A 2PO4A 2CX9A 1BUCA 2BTZA 4Q0TA 4W9UA 4X28A 3D2RA 1K93A 3MDDA 4MPCA 3MXLA 1Y0VA 1Y8PA 2E0AA 3SXQA 1XFUA 2RFQA 2R03A 1GJVA 4LQSB 3D1IA 3Q22A 3LG1A 3MPIA 3TZ2A 2BU2A 4OO2A 5M4KA 2GBBA 1WS9A 2ZO5A 1PI1A 4P13A 1LVCA 1GKXA 2Z1QA 2XS1A 3II9A 4E01A 2BU7A 2CJ6A 3TTBA 1T9GA 2LFWA 2YYJA
chains in the Genus database with same CATH topology
1OAHA 3HWCA 1QDBA 4Q5CA 3AFEA 2EBAA 2VR0A 2DVLA 2WBIA 2JBRA 4WJYA 4KCFA 3B96A 4X28C 3FO3A 4L3ZA 3GNCA 4HR3A 3D9GA 3L1TA 3AFFA 2REHA 4XVXA 3GQTA 2YYLA 4G5EA 3M9VA 4RM7A 2YYGA 5K3HA 2RF7A 3R7KA 1UDYA 2JBTA 4KTOA 3TORA 2JBSA 2PG0A 1EGEA 4ZXVA 3BNFA 3BNGA 1R2JA 3UU9A 2FONA 2YYMA 3GM6A 4JEKA 3MPJA 3EOMA 4M9AA 3OIBA 3NF4A 1SIQA 3D9DA 4IV6A 5K3IA 4O5MA 2IX6A 2ZAFA 3OWAA 3LGQA 3EONA 4DOYA 2IX5A 4L38A 2YYKA 3X0YA 2D29A 3SWOA 4N5FA 1U8VA 1IVHA 1RX0A 4Q4UA 2J7AA 3S7WA 2E80A 2C12A 1FS9A 1EGDA 4U83A 3PFDA 2E81A 4Q17A 2A1TA 3MKHA 4NXLA 3UBRA 3D6BA 1GU6A 4L3XA 2C0UA 3SCEA 3MDEA 1FS7A 3BNHA 2JIFA 4ZYJA 3BNJA 1EGCA 4L3YA 3SF6A 2R0MA 3RKHA 5K3GA 3MMOA 3D9EA 1IS2A 3FCJA 1JQIA 2VIGA 3P4TA 2DDHA 2YYIA 2R0NA 1UKWA 4L1FA 2OR0A 5K3JA 2OT4A 3OWMA 4Q5BA 3D9FA 1W07A 3X0XA 2UXWA 4IRNA 4Q1OA 1FS8A 3F29A 1SIRA 2CX9A 1BUCA 4Q0TA 4W9UA 4X28A 3MDDA 3MXLA 3SXQA 2RFQA 3D1IA 3LG1A 3MPIA 4OO2A 1WS9A 2ZO5A 4P13A 2Z1QA 3II9A 3TTBA 1T9GA 2RDZA 2YYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OAH A;  3HWC A;  1QDB A;  4Q5C A;  3AFE A;  2EBA A;  2VR0 A;  2DVL A;  2WBI A;  2JBR A;  4WJY A;  4KCF A;  3B96 A;  4X28 C;  3FO3 A;  4L3Z A;  3GNC A;  4HR3 A;  3D9G A;  3L1T A;  3AFF A;  2REH A;  4XVX A;  3GQT A;  2YYL A;  4G5E A;  3M9V A;  4RM7 A;  2YYG A;  5K3H A;  2RF7 A;  3R7K A;  1UDY A;  2JBT A;  4KTO A;  3TOR A;  2JBS A;  2PG0 A;  1EGE A;  4ZXV A;  3BNF A;  3BNG A;  1R2J A;  3UU9 A;  2FON A;  2YYM A;  3GM6 A;  4JEK A;  3MPJ A;  3EOM A;  4M9A A;  3OIB A;  3NF4 A;  1SIQ A;  3D9D A;  4IV6 A;  5K3I A;  4O5M A;  2IX6 A;  2ZAF A;  3OWA A;  3LGQ A;  3EON A;  4DOY A;  2IX5 A;  4L38 A;  2YYK A;  3X0Y A;  2D29 A;  3SWO A;  4N5F A;  1U8V A;  1IVH A;  1RX0 A;  4Q4U A;  2J7A A;  3S7W A;  2E80 A;  2C12 A;  1FS9 A;  1EGD A;  4U83 A;  3PFD A;  2E81 A;  4Q17 A;  2A1T A;  3MKH A;  4NXL A;  3UBR A;  3D6B A;  1GU6 A;  4L3X A;  2C0U A;  3SCE A;  3MDE A;  1FS7 A;  3BNH A;  2JIF A;  4ZYJ A;  3BNJ A;  1EGC A;  4L3Y A;  3SF6 A;  2R0M A;  3RKH A;  5K3G A;  3MMO A;  3D9E A;  1IS2 A;  3FCJ A;  1JQI A;  2VIG A;  3P4T A;  2DDH A;  2YYI A;  2R0N A;  1UKW A;  4L1F A;  2OR0 A;  5K3J A;  2OT4 A;  3OWM A;  4Q5B A;  3D9F A;  1W07 A;  3X0X A;  2UXW A;  4IRN A;  4Q1O A;  1FS8 A;  3F29 A;  1SIR A;  2CX9 A;  1BUC A;  4Q0T A;  4W9U A;  4X28 A;  3MDD A;  3MXL A;  3SXQ A;  2RFQ A;  3D1I A;  3LG1 A;  3MPI A;  4OO2 A;  1WS9 A;  2ZO5 A;  4P13 A;  2Z1Q A;  3II9 A;  3TTB A;  1T9G A;  2RDZ A;  2YYJ A; 
#chains in the Genus database with same CATH topology
 1OAH A;  3HWC A;  1QDB A;  4LQQ B;  1XFV A;  1Y8O A;  4KSA A;  4Q5C A;  3AFE A;  2EBA A;  1X90 A;  2VR0 A;  2BU8 A;  2DVL A;  3TZ5 A;  2Q8F A;  2WBI A;  4HKS A;  2JBR A;  4MP2 A;  4WJY A;  4KCF A;  2XS8 A;  3B96 A;  4X28 C;  2Q8G A;  2CJ7 A;  3FO3 A;  2HJN A;  3C2P A;  4L3Z A;  3GNC A;  2OEX A;  4HR3 A;  3D9G A;  3Q24 A;  3L1T A;  3AFF A;  2REH A;  4XVX A;  3GQT A;  2CJ8 A;  2VF1 A;  2YYL A;  4G5E A;  4V26 A;  2BU6 A;  2Q8H A;  3M9V A;  4RM7 A;  2FP2 A;  2YYG A;  5K3H A;  4MPN A;  1XFZ A;  2RF7 A;  4E02 A;  3R7K A;  1UDY A;  4J1V A;  4FF1 A;  2RDZ A;  2JBT A;  4KTO A;  3TOR A;  2JBS A;  2PG0 A;  1EGE A;  1R3B A;  4ZXV A;  5GJV E;  3BNF A;  3BNG A;  1R2J A;  1SC5 A;  3UU9 A;  5BRM A;  2EBF X;  2PNR A;  2FON A;  2YYM A;  3GM6 A;  4FF3 A;  4JEK A;  3MPJ A;  3EOM A;  4M9A A;  4MP7 A;  2CJ4 A;  5BRK A;  3OIB A;  2FP1 A;  5J71 A;  3NF4 A;  3Q0A A;  4FF2 A;  2F6L A;  1SIQ A;  2Q8I A;  3D9D A;  4IV6 A;  5K3I A;  4FZ4 A;  4O5M A;  4AKI A;  5B6B A;  2IX6 A;  4AKG A;  2ZAF A;  3OWA A;  1Y8N A;  3LGQ A;  3EON A;  4DOY A;  2IX5 A;  4L38 A;  1SK6 A;  1X8Z A;  3VAD A;  2YYK A;  3X0Y A;  1K90 A;  5M4P A;  2D29 A;  3SWO A;  4N5F A;  1U8V A;  2YGW A;  2ZKJ A;  1IVH A;  5GJW E;  5J6A A;  1RX0 A;  4Q4U A;  2J7A A;  5M4M A;  1XFW A;  1S26 A;  2CJ5 A;  2E80 A;  2EC5 A;  3CE2 A;  3S7W A;  2C12 A;  1FS9 A;  4HKR A;  3Q23 A;  1EGD A;  4U83 A;  1XFY A;  3C46 A;  4AKH A;  3CRK A;  3VKG A;  3PFD A;  2E81 A;  4KSF A;  2A1T A;  3MKH A;  4NXL A;  4Q17 A;  3UBR A;  3D6B A;  1XG2 B;  3C3L A;  1GU6 A;  4L3X A;  4DZY A;  2C0U A;  3SCE A;  1K8T A;  3MDE A;  2BU5 A;  1FS7 A;  3BNH A;  4QIC A;  1GKZ A;  2JIF A;  4ZYJ A;  5B5W A;  3BNJ A;  2QR4 A;  1EGC A;  4L3Y A;  3SF6 A;  4V25 A;  1JM6 A;  1RP3 A;  2R05 A;  1RJ4 A;  2XQR B;  2AZE A;  2R0M A;  3RKH A;  5K3G A;  5B5V A;  4E00 A;  4AI6 A;  3U33 A;  3MMO A;  3D9E A;  1IS2 A;  4KS9 A;  3DJL A;  3KML A;  3FCJ A;  3TZ4 A;  3VKH A;  3TZ0 A;  1JQI A;  2VIG A;  4G97 A;  2EBH X;  4JIZ A;  3CRL A;  4MPE A;  4P79 A;  4F0X A;  3P4T A;  1RJ1 A;  2DDH A;  2AO2 A;  2YYI A;  2ZDX A;  2R0N A;  2OEV A;  4H85 A;  1UKW A;  4L1F A;  2OR0 A;  5K3J A;  2OJQ A;  4H7Q A;  3OWM A;  4Q5B A;  2OT4 A;  3D9F A;  4H81 A;  4JIO A;  1W07 A;  3X29 A;  5M4N A;  3X0X A;  1XFX A;  2UXW A;  4IRN A;  4Q1O A;  1FS8 A;  2R02 A;  2ZDY A;  3F29 A;  5EZ3 A;  1SIR A;  3N0R A;  4FF4 A;  1PK0 A;  1X91 A;  2PO4 A;  2CX9 A;  1BUC A;  2BTZ A;  4Q0T A;  4W9U A;  4X28 A;  3D2R A;  1K93 A;  3MDD A;  4MPC A;  3MXL A;  1Y0V A;  1Y8P A;  2E0A A;  3SXQ A;  1XFU A;  2RFQ A;  2R03 A;  1GJV A;  4LQS B;  3D1I A;  3Q22 A;  3LG1 A;  3MPI A;  3TZ2 A;  2BU2 A;  4OO2 A;  5M4K A;  2GBB A;  1WS9 A;  2ZO5 A;  1PI1 A;  4P13 A;  1LVC A;  1GKX A;  2Z1Q A;  2XS1 A;  3II9 A;  4E01 A;  2BU7 A;  2CJ6 A;  3TTB A;  1T9G A;  2LFW A;  2YYJ A; 
#chains in the Genus database with same CATH homology
 1OAH A;  3HWC A;  1QDB A;  4Q5C A;  3AFE A;  2EBA A;  2VR0 A;  2DVL A;  2WBI A;  2JBR A;  4WJY A;  4KCF A;  3B96 A;  4X28 C;  3FO3 A;  4L3Z A;  3GNC A;  4HR3 A;  3D9G A;  3L1T A;  3AFF A;  2REH A;  4XVX A;  3GQT A;  2YYL A;  4G5E A;  3M9V A;  4RM7 A;  2YYG A;  5K3H A;  2RF7 A;  3R7K A;  1UDY A;  2JBT A;  4KTO A;  3TOR A;  2JBS A;  2PG0 A;  1EGE A;  4ZXV A;  3BNF A;  3BNG A;  1R2J A;  3UU9 A;  2FON A;  2YYM A;  3GM6 A;  4JEK A;  3MPJ A;  3EOM A;  4M9A A;  3OIB A;  3NF4 A;  1SIQ A;  3D9D A;  4IV6 A;  5K3I A;  4O5M A;  2IX6 A;  2ZAF A;  3OWA A;  3LGQ A;  3EON A;  4DOY A;  2IX5 A;  4L38 A;  2YYK A;  3X0Y A;  2D29 A;  3SWO A;  4N5F A;  1U8V A;  1IVH A;  1RX0 A;  4Q4U A;  2J7A A;  3S7W A;  2E80 A;  2C12 A;  1FS9 A;  1EGD A;  4U83 A;  3PFD A;  2E81 A;  4Q17 A;  2A1T A;  3MKH A;  4NXL A;  3UBR A;  3D6B A;  1GU6 A;  4L3X A;  2C0U A;  3SCE A;  3MDE A;  1FS7 A;  3BNH A;  2JIF A;  4ZYJ A;  3BNJ A;  1EGC A;  4L3Y A;  3SF6 A;  2R0M A;  3RKH A;  5K3G A;  3MMO A;  3D9E A;  1IS2 A;  3FCJ A;  1JQI A;  2VIG A;  3P4T A;  2DDH A;  2YYI A;  2R0N A;  1UKW A;  4L1F A;  2OR0 A;  5K3J A;  2OT4 A;  3OWM A;  4Q5B A;  3D9F A;  1W07 A;  3X0X A;  2UXW A;  4IRN A;  4Q1O A;  1FS8 A;  3F29 A;  1SIR A;  2CX9 A;  1BUC A;  4Q0T A;  4W9U A;  4X28 A;  3MDD A;  3MXL A;  3SXQ A;  2RFQ A;  3D1I A;  3LG1 A;  3MPI A;  4OO2 A;  1WS9 A;  2ZO5 A;  4P13 A;  2Z1Q A;  3II9 A;  3TTB A;  1T9G A;  2RDZ A;  2YYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...