2AO2A

The 2.07 angstrom crystal structure of mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
165
structure length
165
Chain Sequence
GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chorismate mutase
publication title The 2.15 A crystal structure of Mycobacterium tuberculosis chorismate mutase reveals an unexpected gene duplication and suggests a role in host-pathogen interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 66
structure length 165
sequence length 165
chains with identical sequence B, C
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.170 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 2ao2A00
2FP2A 2AO2A 2F6LA 2FP1A 2GBBA
chains in the Genus database with same CATH superfamily
2CJ7A 2EBFX 2RFQA 3LG1A 2IX6A 3TZ4A 1RP3A 5B6BA 2YYJA 3OWMA 2Q8HA 4JIZA 4Q4UA 2R02A 2R03A 5K3HA 4JEKA 4DZYA 3RKHA 1RJ1A 2BTZA 4XVXA 2YYKA 3UBRA 3PFDA 2IX5A 2YYLA 5M4KA 2JBSA 4QICA 4J1VA 1FS8A 4MPEA 1SC5A 3EOMA 1FS7A 1XG2B 2WBIA 1WS9A 2OEVA 5M4NA 3C3LA 4P13A 2REHA 4KCFA 3Q23A 2OEXA 1PK0A 3TZ5A 1XFWA 5M4MA 1X8ZA 2VF1A 3NF4A 4W9UA 3X29A 1EGDA 3D9GA 1BUCA 1Y8NA 1R2JA 1EGEA 2EBHX 2JIFA 3BNGA 3MMOA 3GQTA 3M9VA 2AO2A 2HJNA 1XFXA 2ZAFA 5K3GA 3Q24A 2FONA 3OIBA 2EC5A 1OAHA 2BU6A 1Y8OA 2LFWA 2XS1A 2CJ8A 4Q17A 2Q8FA 4IV6A 4KTOA 4U83A 2CJ6A 4V25A 2YYIA 5BRKA 1S26A 4L1FA 2BU7A 4Q5CA 3D9EA 2YYGA 2AZEA 2ZDXA 3D2RA 1JM6A 2R05A 4L3ZA 4L3XA 3HWCA 3BNJA 3X0XA 3GM6A 4Q0TA 3CRKA 2E0AA 4G5EA 4FF3A 2A1TA 4Q5BA 3P4TA 3B96A 4X28C 3TZ2A 1PI1A 4JIOA 2XS8A 3TORA 2FP1A 4WJYA 2XQRB 4AI6A 2RDZA 2ZKJA 4IRNA 5J71A 2RF7A 2ZDYA 3MDEA 4ZYJA 1Y0VA 4V26A 4M9AA 4DOYA 4HKRA 3S7WA 4F0XA 3BNHA 2D29A 3D9DA 5J6AA 4FF4A 2R0MA 3SWOA 2JBRA 4AKHA 3KMLA 5GJVE 1X90A 4Q1OA 2CJ5A 4FF2A 1XFYA 1UDYA 4E02A 4NXLA 2J7AA 2Q8IA 4KS9A 1FS9A 2BU2A 2E80A 2PG0A 2VR0A 3F29A 3MDDA 4E01A 3C2PA 4H7QA 3Q0AA 4KSAA 1T9GA 4FF1A 1W07A 1K90A 4N5FA 1SIQA 3EONA 2VIGA 4HKSA 4G97A 4X28A 5B5WA 1IVHA 2E81A 2ZO5A 4LQQB 1GJVA 2QR4A 1GKXA 2DVLA 3BNFA 3FCJA 4MPCA 1GU6A 1X91A 2OR0A 1SK6A 3R7KA 2UXWA 4HR3A 5M4PA 4H85A 1XFZA 1RJ4A 3CE2A 4ZXVA 3D9FA 3MPJA 3Q22A 4KSFA 3VKGA 2FP2A 3AFEA 3SXQA 2C0UA 3D6BA 4AKGA 3MXLA 3OWAA 4E00A 5K3IA 5BRMA 3MPIA 1R3BA 2PO4A 1RX0A 3VADA 1K93A 4H81A 4MP2A 1EGCA 3SCEA 1UKWA 3X0YA 3FO3A 2JBTA 2C12A 4RM7A 5K3JA 3TZ0A 1JQIA 1SIRA 4MPNA 4OO2A 4FZ4A 3CRLA 1LVCA 1Y8PA 3II9A 1IS2A 4O5MA 2R0NA 4LQSB 4L38A 2BU5A 4L3YA 1XFVA 2CX9A 4P79A 3UU9A 3C46A 3LGQA 4AKIA 2Z1QA 3GNCA 2PNRA 5B5VA 3VKHA 2F6LA 2DDHA 5GJWE 3TTBA 1XFUA 2EBAA 3D1IA 1U8VA 2OJQA 2Q8GA 3SF6A 2YYMA 3N0RA 2YGWA 3L1TA 4MP7A 1GKZA 2OT4A 1QDBA 1K8TA 2BU8A 2CJ4A 3MKHA 3AFFA 2GBBA
chains in the Genus database with same CATH topology
1K93A 4AKHA 3KMLA 5GJVE 4FF2A 2EBFX 1XFYA 1RP3A 1S26A 4FF4A 4KS9A 2AZEA 3Q0AA 4FZ4A 4KSAA 1LVCA 4FF1A 4QICA 1K90A 1XFVA 1SC5A 4G97A 4HKSA 4P79A 4FF3A 3C46A 3C3LA 2QR4A 4AKIA 3Q23A 1SK6A 2LFWA 3VKHA 1PK0A 1XFZA 1XFWA 2F6LA 3CE2A 5GJWE 1XFUA 2VF1A 2FP1A 2PO4A 3X29A 3Q22A 3C2PA 4KSFA 4AI6A 2FP2A 3VKGA 2EBHX 1Y0VA 3N0RA 2YGWA 4AKGA 2AO2A 1K8TA 1XFXA 4HKRA 3Q24A 4F0XA 2EC5A 2GBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FP2 A;  2AO2 A;  2F6L A;  2FP1 A;  2GBB A; 
#chains in the Genus database with same CATH topology
 2CJ7 A;  2EBF X;  2RFQ A;  3LG1 A;  2IX6 A;  3TZ4 A;  1RP3 A;  5B6B A;  2YYJ A;  3OWM A;  2Q8H A;  4JIZ A;  4Q4U A;  2R02 A;  2R03 A;  5K3H A;  4JEK A;  4DZY A;  3RKH A;  1RJ1 A;  2BTZ A;  4XVX A;  2YYK A;  3UBR A;  3PFD A;  2IX5 A;  2YYL A;  5M4K A;  2JBS A;  4QIC A;  4J1V A;  1FS8 A;  4MPE A;  1SC5 A;  3EOM A;  1FS7 A;  1XG2 B;  2WBI A;  1WS9 A;  2OEV A;  5M4N A;  3C3L A;  4P13 A;  2REH A;  4KCF A;  3Q23 A;  2OEX A;  1PK0 A;  3TZ5 A;  1XFW A;  5M4M A;  1X8Z A;  2VF1 A;  3NF4 A;  4W9U A;  3X29 A;  1EGD A;  3D9G A;  1BUC A;  1Y8N A;  1R2J A;  1EGE A;  2EBH X;  2JIF A;  3BNG A;  3MMO A;  3GQT A;  3M9V A;  2AO2 A;  2HJN A;  1XFX A;  2ZAF A;  5K3G A;  3Q24 A;  2FON A;  3OIB A;  2EC5 A;  1OAH A;  2BU6 A;  1Y8O A;  2LFW A;  2XS1 A;  2CJ8 A;  4Q17 A;  2Q8F A;  4IV6 A;  4KTO A;  4U83 A;  2CJ6 A;  4V25 A;  2YYI A;  5BRK A;  1S26 A;  4L1F A;  2BU7 A;  4Q5C A;  3D9E A;  2YYG A;  2AZE A;  2ZDX A;  3D2R A;  1JM6 A;  2R05 A;  4L3Z A;  4L3X A;  3HWC A;  3BNJ A;  3X0X A;  3GM6 A;  4Q0T A;  3CRK A;  2E0A A;  4G5E A;  4FF3 A;  2A1T A;  4Q5B A;  3P4T A;  3B96 A;  4X28 C;  3TZ2 A;  1PI1 A;  4JIO A;  2XS8 A;  3TOR A;  2FP1 A;  4WJY A;  2XQR B;  4AI6 A;  2RDZ A;  2ZKJ A;  4IRN A;  5J71 A;  2RF7 A;  2ZDY A;  3MDE A;  4ZYJ A;  1Y0V A;  4V26 A;  4M9A A;  4DOY A;  4HKR A;  3S7W A;  4F0X A;  3BNH A;  2D29 A;  3D9D A;  5J6A A;  4FF4 A;  2R0M A;  3SWO A;  2JBR A;  4AKH A;  3KML A;  5GJV E;  1X90 A;  4Q1O A;  2CJ5 A;  4FF2 A;  1XFY A;  1UDY A;  4E02 A;  4NXL A;  2J7A A;  2Q8I A;  4KS9 A;  1FS9 A;  2BU2 A;  2E80 A;  2PG0 A;  2VR0 A;  3F29 A;  3MDD A;  4E01 A;  3C2P A;  4H7Q A;  3Q0A A;  4KSA A;  1T9G A;  4FF1 A;  1W07 A;  1K90 A;  4N5F A;  1SIQ A;  3EON A;  2VIG A;  4HKS A;  4G97 A;  4X28 A;  5B5W A;  1IVH A;  2E81 A;  2ZO5 A;  4LQQ B;  1GJV A;  2QR4 A;  1GKX A;  2DVL A;  3BNF A;  3FCJ A;  4MPC A;  1GU6 A;  1X91 A;  2OR0 A;  1SK6 A;  3R7K A;  2UXW A;  4HR3 A;  5M4P A;  4H85 A;  1XFZ A;  1RJ4 A;  3CE2 A;  4ZXV A;  3D9F A;  3MPJ A;  3Q22 A;  4KSF A;  3VKG A;  2FP2 A;  3AFE A;  3SXQ A;  2C0U A;  3D6B A;  4AKG A;  3MXL A;  3OWA A;  4E00 A;  5K3I A;  5BRM A;  3MPI A;  1R3B A;  2PO4 A;  1RX0 A;  3VAD A;  1K93 A;  4H81 A;  4MP2 A;  1EGC A;  3SCE A;  1UKW A;  3X0Y A;  3FO3 A;  2JBT A;  2C12 A;  4RM7 A;  5K3J A;  3TZ0 A;  1JQI A;  1SIR A;  4MPN A;  4OO2 A;  4FZ4 A;  3CRL A;  1LVC A;  1Y8P A;  3II9 A;  1IS2 A;  4O5M A;  2R0N A;  4LQS B;  4L38 A;  2BU5 A;  4L3Y A;  1XFV A;  2CX9 A;  4P79 A;  3UU9 A;  3C46 A;  3LGQ A;  4AKI A;  2Z1Q A;  3GNC A;  2PNR A;  5B5V A;  3VKH A;  2F6L A;  2DDH A;  5GJW E;  3TTB A;  1XFU A;  2EBA A;  3D1I A;  1U8V A;  2OJQ A;  2Q8G A;  3SF6 A;  2YYM A;  3N0R A;  2YGW A;  3L1T A;  4MP7 A;  1GKZ A;  2OT4 A;  1QDB A;  1K8T A;  2BU8 A;  2CJ4 A;  3MKH A;  3AFF A;  2GBB A; 
#chains in the Genus database with same CATH homology
 1K93 A;  4AKH A;  3KML A;  5GJV E;  4FF2 A;  2EBF X;  1XFY A;  1RP3 A;  1S26 A;  4FF4 A;  4KS9 A;  2AZE A;  3Q0A A;  4FZ4 A;  4KSA A;  1LVC A;  4FF1 A;  4QIC A;  1K90 A;  1XFV A;  1SC5 A;  4G97 A;  4HKS A;  4P79 A;  4FF3 A;  3C46 A;  3C3L A;  2QR4 A;  4AKI A;  3Q23 A;  1SK6 A;  2LFW A;  3VKH A;  1PK0 A;  1XFZ A;  1XFW A;  2F6L A;  3CE2 A;  5GJW E;  1XFU A;  2VF1 A;  2FP1 A;  2PO4 A;  3X29 A;  3Q22 A;  3C2P A;  4KSF A;  4AI6 A;  2FP2 A;  3VKG A;  2EBH X;  1Y0V A;  3N0R A;  2YGW A;  4AKG A;  2AO2 A;  1K8T A;  1XFX A;  4HKR A;  3Q24 A;  4F0X A;  2EC5 A;  2GBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...