2AO2A

The 2.07 angstrom crystal structure of mycobacterium tuberculosis chorismate mutase reveals unexpected gene duplication and suggests a role in host-pathogen interactions
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
165
structure length
165
Chain Sequence
GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Chorismate mutase
publication title The 2.15 A crystal structure of Mycobacterium tuberculosis chorismate mutase reveals an unexpected gene duplication and suggests a role in host-pathogen interactions.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 66
structure length 165
sequence length 165
chains with identical sequence B, C
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.170 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 2ao2A00
2AO2A 2FP2A 2F6LA 2FP1A 2GBBA
chains in the Genus database with same CATH superfamily
2A1TA 4L3XA 1XFWA 4QICA 1GKZA 2R02A 4KSFA 3D6BA 1RJ1A 3D9FA 2JBRA 5K3JA 1JM6A 1K93A 2Q8GA 4HKRA 4FZ4A 4V26A 4MPNA 2OEVA 1X91A 2FP1A 3BNFA 5B5VA 3TTBA 1QDBA 2DVLA 2JBTA 1Y8NA 1EGEA 2C12A 3BNJA 4L3YA 4L3ZA 1XFYA 4G5EA 2PG0A 1XFXA 2BU8A 4JIZA 4DZYA 4G97A 1EGDA 4RM7A 4KSAA 2YYKA 3CE2A 3X0YA 2YYMA 2C0UA 2BTZA 3OWMA 3TZ0A 3EONA 5K3GA 4Q4UA 4KS9A 4MP2A 1FS8A 5K3IA 4MP7A 2OEXA 5M4MA 4J1VA 2JBSA 4H85A 3X29A 2EBAA 1K8TA 4LQQB 3C46A 3MDEA 3C3LA 3D2RA 4Q17A 3BNGA 2E0AA 2DDHA 3MPJA 2CJ5A 2OT4A 2AZEA 1SIRA 1GU6A 1FS9A 4OO2A 2VR0A 4H81A 2JIFA 4H7QA 3OIBA 1XFUA 2OR0A 1EGCA 2BU6A 4HKSA 2XS1A 4ZXVA 5J71A 1Y0VA 5B5WA 1XG2B 4JEKA 4F0XA 2FONA 4FF1A 2BU2A 3FCJA 4MPEA 4Q1OA 2PO4A 2D29A 3L1TA 1SK6A 1WS9A 2R0NA 2OJQA 4M9AA 1SIQA 1X8ZA 2EBHX 3C2PA 5M4PA 2YYIA 1U8VA 5BRKA 3VKHA 1RX0A 2VIGA 1X90A 2R0MA 2ZDYA 1PK0A 3MKHA 3X0XA 4AKHA 2YYJA 3UU9A 1RJ4A 1T9GA 2EC5A 2CJ7A 2IX5A 5GJVE 3S7WA 4FF3A 3OWAA 3Q23A 4WJYA 4ZYJA 4XVXA 2YGWA 2YYGA 4IV6A 2ZDXA 4JIOA 4V25A 4NXLA 1PI1A 2BU5A 3AFEA 3D9EA 2REHA 3GM6A 4AKIA 3VKGA 1W07A 2CJ8A 4E02A 4HR3A 2Q8FA 3SWOA 4AI6A 2R05A 3SF6A 4AKGA 3EOMA 3GNCA 3LGQA 1LVCA 2HJNA 2IX6A 2VF1A 2YYLA 3SXQA 4E00A 1JQIA 4E01A 4O5MA 4MPCA 4Q5BA 1RP3A 3GQTA 1R3BA 1XFVA 4IRNA 2ZAFA 4DOYA 1Y8PA 5B6BA 3MMOA 5K3HA 3B96A 3P4TA 1Y8OA 4L1FA 3M9VA 4KTOA 2CJ6A 4P13A 2ZO5A 3D1IA 2FP2A 3TZ4A 3TZ5A 3Q24A 2F6LA 3HWCA 4P79A 5M4NA 5GJWE 2CX9A 1S26A 3BNHA 2Q8IA 1GJVA 3MXLA 1BUCA 3KMLA 2BU7A 2GBBA 3LG1A 2RDZA 4W9UA 2AO2A 3AFFA 2R03A 3F29A 2UXWA 4U83A 3Q0AA 2RFQA 2ZKJA 3PFDA 2E80A 1R2JA 5M4KA 2Q8HA 4Q0TA 4Q5CA 3MDDA 4N5FA 3SCEA 2QR4A 1IVHA 4KCFA 3RKHA 3NF4A 2XQRB 1GKXA 3UBRA 3TZ2A 4FF2A 4X28C 3II9A 3D9GA 1SC5A 4LQSB 4X28A 1OAHA 3TORA 2Z1QA 5J6AA 3CRKA 3MPIA 1UKWA 1XFZA 3N0RA 3Q22A 2EBFX 4FF4A 4L38A 2J7AA 3VADA 5BRMA 2E81A 2RF7A 2XS8A 1UDYA 2PNRA 1FS7A 3CRLA 2WBIA 3D9DA 1IS2A 3FO3A 3R7KA 1K90A 2CJ4A 2LFWA
chains in the Genus database with same CATH topology
1XFWA 2AO2A 2YGWA 4KSFA 4QICA 2AZEA 1K93A 4HKRA 4FZ4A 3Q0AA 3VKGA 4AKIA 2FP1A 1XFUA 4AI6A 4HKSA 1Y0VA 1XFYA 2QR4A 4AKGA 1LVCA 4F0XA 2VF1A 1XFXA 4FF1A 4G97A 2PO4A 4KSAA 1RP3A 3CE2A 1SK6A 1XFVA 4FF2A 1SC5A 2EBHX 3C2PA 3VKHA 1XFZA 3N0RA 4KS9A 2EBFX 3Q22A 1PK0A 4FF4A 4AKHA 2FP2A 3Q24A 2EC5A 2F6LA 4P79A 4FF3A 5GJWE 5GJVE 3X29A 1S26A 1K8TA 3C46A 1K90A 3Q23A 3KMLA 2GBBA 3C3LA 2LFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AO2 A;  2FP2 A;  2F6L A;  2FP1 A;  2GBB A; 
#chains in the Genus database with same CATH topology
 2A1T A;  4L3X A;  1XFW A;  4QIC A;  1GKZ A;  2R02 A;  4KSF A;  3D6B A;  1RJ1 A;  3D9F A;  2JBR A;  5K3J A;  1JM6 A;  1K93 A;  2Q8G A;  4HKR A;  4FZ4 A;  4V26 A;  4MPN A;  2OEV A;  1X91 A;  2FP1 A;  3BNF A;  5B5V A;  3TTB A;  1QDB A;  2DVL A;  2JBT A;  1Y8N A;  1EGE A;  2C12 A;  3BNJ A;  4L3Y A;  4L3Z A;  1XFY A;  4G5E A;  2PG0 A;  1XFX A;  2BU8 A;  4JIZ A;  4DZY A;  4G97 A;  1EGD A;  4RM7 A;  4KSA A;  2YYK A;  3CE2 A;  3X0Y A;  2YYM A;  2C0U A;  2BTZ A;  3OWM A;  3TZ0 A;  3EON A;  5K3G A;  4Q4U A;  4KS9 A;  4MP2 A;  1FS8 A;  5K3I A;  4MP7 A;  2OEX A;  5M4M A;  4J1V A;  2JBS A;  4H85 A;  3X29 A;  2EBA A;  1K8T A;  4LQQ B;  3C46 A;  3MDE A;  3C3L A;  3D2R A;  4Q17 A;  3BNG A;  2E0A A;  2DDH A;  3MPJ A;  2CJ5 A;  2OT4 A;  2AZE A;  1SIR A;  1GU6 A;  1FS9 A;  4OO2 A;  2VR0 A;  4H81 A;  2JIF A;  4H7Q A;  3OIB A;  1XFU A;  2OR0 A;  1EGC A;  2BU6 A;  4HKS A;  2XS1 A;  4ZXV A;  5J71 A;  1Y0V A;  5B5W A;  1XG2 B;  4JEK A;  4F0X A;  2FON A;  4FF1 A;  2BU2 A;  3FCJ A;  4MPE A;  4Q1O A;  2PO4 A;  2D29 A;  3L1T A;  1SK6 A;  1WS9 A;  2R0N A;  2OJQ A;  4M9A A;  1SIQ A;  1X8Z A;  2EBH X;  3C2P A;  5M4P A;  2YYI A;  1U8V A;  5BRK A;  3VKH A;  1RX0 A;  2VIG A;  1X90 A;  2R0M A;  2ZDY A;  1PK0 A;  3MKH A;  3X0X A;  4AKH A;  2YYJ A;  3UU9 A;  1RJ4 A;  1T9G A;  2EC5 A;  2CJ7 A;  2IX5 A;  5GJV E;  3S7W A;  4FF3 A;  3OWA A;  3Q23 A;  4WJY A;  4ZYJ A;  4XVX A;  2YGW A;  2YYG A;  4IV6 A;  2ZDX A;  4JIO A;  4V25 A;  4NXL A;  1PI1 A;  2BU5 A;  3AFE A;  3D9E A;  2REH A;  3GM6 A;  4AKI A;  3VKG A;  1W07 A;  2CJ8 A;  4E02 A;  4HR3 A;  2Q8F A;  3SWO A;  4AI6 A;  2R05 A;  3SF6 A;  4AKG A;  3EOM A;  3GNC A;  3LGQ A;  1LVC A;  2HJN A;  2IX6 A;  2VF1 A;  2YYL A;  3SXQ A;  4E00 A;  1JQI A;  4E01 A;  4O5M A;  4MPC A;  4Q5B A;  1RP3 A;  3GQT A;  1R3B A;  1XFV A;  4IRN A;  2ZAF A;  4DOY A;  1Y8P A;  5B6B A;  3MMO A;  5K3H A;  3B96 A;  3P4T A;  1Y8O A;  4L1F A;  3M9V A;  4KTO A;  2CJ6 A;  4P13 A;  2ZO5 A;  3D1I A;  2FP2 A;  3TZ4 A;  3TZ5 A;  3Q24 A;  2F6L A;  3HWC A;  4P79 A;  5M4N A;  5GJW E;  2CX9 A;  1S26 A;  3BNH A;  2Q8I A;  1GJV A;  3MXL A;  1BUC A;  3KML A;  2BU7 A;  2GBB A;  3LG1 A;  2RDZ A;  4W9U A;  2AO2 A;  3AFF A;  2R03 A;  3F29 A;  2UXW A;  4U83 A;  3Q0A A;  2RFQ A;  2ZKJ A;  3PFD A;  2E80 A;  1R2J A;  5M4K A;  2Q8H A;  4Q0T A;  4Q5C A;  3MDD A;  4N5F A;  3SCE A;  2QR4 A;  1IVH A;  4KCF A;  3RKH A;  3NF4 A;  2XQR B;  1GKX A;  3UBR A;  3TZ2 A;  4FF2 A;  4X28 C;  3II9 A;  3D9G A;  1SC5 A;  4LQS B;  4X28 A;  1OAH A;  3TOR A;  2Z1Q A;  5J6A A;  3CRK A;  3MPI A;  1UKW A;  1XFZ A;  3N0R A;  3Q22 A;  2EBF X;  4FF4 A;  4L38 A;  2J7A A;  3VAD A;  5BRM A;  2E81 A;  2RF7 A;  2XS8 A;  1UDY A;  2PNR A;  1FS7 A;  3CRL A;  2WBI A;  3D9D A;  1IS2 A;  3FO3 A;  3R7K A;  1K90 A;  2CJ4 A;  2LFW A; 
#chains in the Genus database with same CATH homology
 1XFW A;  2AO2 A;  2YGW A;  4KSF A;  4QIC A;  2AZE A;  1K93 A;  4HKR A;  4FZ4 A;  3Q0A A;  3VKG A;  4AKI A;  2FP1 A;  1XFU A;  4AI6 A;  4HKS A;  1Y0V A;  1XFY A;  2QR4 A;  4AKG A;  1LVC A;  4F0X A;  2VF1 A;  1XFX A;  4FF1 A;  4G97 A;  2PO4 A;  4KSA A;  1RP3 A;  3CE2 A;  1SK6 A;  1XFV A;  4FF2 A;  1SC5 A;  2EBH X;  3C2P A;  3VKH A;  1XFZ A;  3N0R A;  4KS9 A;  2EBF X;  3Q22 A;  1PK0 A;  4FF4 A;  4AKH A;  2FP2 A;  3Q24 A;  2EC5 A;  2F6L A;  4P79 A;  4FF3 A;  5GJW E;  5GJV E;  3X29 A;  1S26 A;  1K8T A;  3C46 A;  1K90 A;  3Q23 A;  3KML A;  2GBB A;  3C3L A;  2LFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...