2XQRB

Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
146
structure length
146
Chain Sequence
NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords BETA-FRUCTOFURANOSIDASE, INSOLUBLE ISOENZYME CWINV1
publication title Structural Insights Into the Ph-Controlled Targeting of Plant Cell-Wall Invertase by a Specific Inhibitor Protein.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 55
structure length 146
sequence length 146
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2xqrB00
2CJ8A 2CJ7A 1X90A 1XG2B 1RJ1A 2XQRB 2CJ5A 1X8ZA 2CJ4A 1RJ4A 2CJ6A 1X91A
chains in the Genus database with same CATH superfamily
1SIRA 2JBRA 2XS8A 1FS9A 3D9GA 4FZ4A 4NXLA 4E02A 3Q22A 2YYLA 4KSAA 3PFDA 5B5VA 4Q5CA 4OO2A 3D9FA 5K3GA 3MDEA 3CRKA 2YYKA 1IVHA 2EBAA 4WJYA 1PK0A 1XFZA 2Q8GA 1FS8A 2R02A 2YYIA 3SCEA 1UDYA 2HJNA 1GKXA 4N5FA 4HKSA 4FF3A 4MPEA 2EBHX 1EGCA 2DDHA 3SXQA 3C3LA 2R03A 3VADA 3LGQA 1RJ4A 1K93A 2BU6A 3OWMA 3EOMA 4P79A 3UBRA 3OWAA 2F6LA 1R3BA 1Y8PA 2CJ5A 2VF1A 1XFUA 2OEVA 5BRKA 4AI6A 4G5EA 2D29A 1EGEA 4V25A 4W9UA 3GM6A 5M4MA 3MXLA 4RM7A 2PG0A 3VKGA 2E80A 4X28A 4DOYA 3GNCA 1XFYA 2EBFX 3NF4A 2WBIA 3F29A 5GJWE 5M4PA 4Q5BA 4FF4A 2DVLA 2CX9A 2E0AA 4Q1OA 4IV6A 4E01A 5K3HA 4Q0TA 3R7KA 1BUCA 3MMOA 2C12A 2CJ4A 4JIZA 1RP3A 1Y8NA 3Q0AA 2RDZA 1LVCA 3UU9A 1PI1A 3TZ5A 2REHA 4KSFA 2XQRB 4H81A 4O5MA 1IS2A 3P4TA 4IRNA 2Q8FA 4ZXVA 4Q17A 1XFXA 4L3ZA 2R0MA 1JM6A 2BU8A 4AKHA 2XS1A 5B6BA 2Z1QA 2A1TA 1X8ZA 5B5WA 2LFWA 3X0YA 4MPNA 4XVXA 3C46A 2CJ7A 1FS7A 3FCJA 3D1IA 5M4KA 2ZAFA 3EONA 2IX5A 3D9DA 3L1TA 2E81A 2YGWA 2AZEA 3LG1A 3X0XA 1GU6A 2ZDYA 3BNGA 3D9EA 2ZO5A 4Q4UA 3C2PA 2OEXA 1XG2B 2AO2A 2JBTA 3BNJA 3BNHA 2FONA 3AFEA 3MPJA 3OIBA 4KS9A 5GJVE 3TZ4A 5M4NA 3VKHA 2R0NA 1XFWA 4HKRA 2Q8HA 2OJQA 1X90A 2YYJA 3GQTA 3N0RA 3AFFA 1OAHA 2RFQA 2OT4A 2C0UA 2ZKJA 1K8TA 2BU2A 2GBBA 4HR3A 2EC5A 1U8VA 4H7QA 2CJ6A 4L1FA 3M9VA 1X91A 4LQQB 3SF6A 3S7WA 2FP1A 4JIOA 4JEKA 2RF7A 4FF1A 3TTBA 5J71A 2YYMA 1WS9A 2JIFA 1RX0A 5K3JA 3MDDA 4F0XA 1Y8OA 4KCFA 2BU5A 4V26A 3TORA 4E00A 2CJ8A 5J6AA 5K3IA 1T9GA 3MPIA 1Y0VA 3RKHA 1GJVA 3HWCA 1K90A 1SIQA 2FP2A 3FO3A 4DZYA 4FF2A 4G97A 3TZ2A 3TZ0A 3SWOA 4AKIA 1QDBA 4MP2A 2PNRA 1EGDA 4L38A 3Q23A 2R05A 1RJ1A 4L3XA 4KTOA 1UKWA 1XFVA 3B96A 4U83A 4M9AA 4MPCA 2ZDXA 4MP7A 4P13A 2Q8IA 4ZYJA 3MKHA 3II9A 1W07A 3BNFA 2VIGA 3CE2A 4QICA 4AKGA 2JBSA 2BTZA 2QR4A 1R2JA 1SK6A 2BU7A 2UXWA 2IX6A 2J7AA 4J1VA 2VR0A 2PO4A 2YYGA 3D6BA 1GKZA 4H85A 4L3YA 5BRMA 2OR0A 4X28C 1JQIA 4LQSB 3X29A 3CRLA 3D2RA 3Q24A 1S26A 1SC5A 3KMLA
chains in the Genus database with same CATH topology
2CJ8A 2CJ7A 1X90A 1XG2B 1RJ1A 2XQRB 2CJ5A 1X8ZA 2CJ4A 1RJ4A 2CJ6A 1X91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJ8 A;  2CJ7 A;  1X90 A;  1XG2 B;  1RJ1 A;  2XQR B;  2CJ5 A;  1X8Z A;  2CJ4 A;  1RJ4 A;  2CJ6 A;  1X91 A; 
#chains in the Genus database with same CATH topology
 1SIR A;  2JBR A;  2XS8 A;  1FS9 A;  3D9G A;  4FZ4 A;  4NXL A;  4E02 A;  3Q22 A;  2YYL A;  4KSA A;  3PFD A;  5B5V A;  4Q5C A;  4OO2 A;  3D9F A;  5K3G A;  3MDE A;  3CRK A;  2YYK A;  1IVH A;  2EBA A;  4WJY A;  1PK0 A;  1XFZ A;  2Q8G A;  1FS8 A;  2R02 A;  2YYI A;  3SCE A;  1UDY A;  2HJN A;  1GKX A;  4N5F A;  4HKS A;  4FF3 A;  4MPE A;  2EBH X;  1EGC A;  2DDH A;  3SXQ A;  3C3L A;  2R03 A;  3VAD A;  3LGQ A;  1RJ4 A;  1K93 A;  2BU6 A;  3OWM A;  3EOM A;  4P79 A;  3UBR A;  3OWA A;  2F6L A;  1R3B A;  1Y8P A;  2CJ5 A;  2VF1 A;  1XFU A;  2OEV A;  5BRK A;  4AI6 A;  4G5E A;  2D29 A;  1EGE A;  4V25 A;  4W9U A;  3GM6 A;  5M4M A;  3MXL A;  4RM7 A;  2PG0 A;  3VKG A;  2E80 A;  4X28 A;  4DOY A;  3GNC A;  1XFY A;  2EBF X;  3NF4 A;  2WBI A;  3F29 A;  5GJW E;  5M4P A;  4Q5B A;  4FF4 A;  2DVL A;  2CX9 A;  2E0A A;  4Q1O A;  4IV6 A;  4E01 A;  5K3H A;  4Q0T A;  3R7K A;  1BUC A;  3MMO A;  2C12 A;  2CJ4 A;  4JIZ A;  1RP3 A;  1Y8N A;  3Q0A A;  2RDZ A;  1LVC A;  3UU9 A;  1PI1 A;  3TZ5 A;  2REH A;  4KSF A;  2XQR B;  4H81 A;  4O5M A;  1IS2 A;  3P4T A;  4IRN A;  2Q8F A;  4ZXV A;  4Q17 A;  1XFX A;  4L3Z A;  2R0M A;  1JM6 A;  2BU8 A;  4AKH A;  2XS1 A;  5B6B A;  2Z1Q A;  2A1T A;  1X8Z A;  5B5W A;  2LFW A;  3X0Y A;  4MPN A;  4XVX A;  3C46 A;  2CJ7 A;  1FS7 A;  3FCJ A;  3D1I A;  5M4K A;  2ZAF A;  3EON A;  2IX5 A;  3D9D A;  3L1T A;  2E81 A;  2YGW A;  2AZE A;  3LG1 A;  3X0X A;  1GU6 A;  2ZDY A;  3BNG A;  3D9E A;  2ZO5 A;  4Q4U A;  3C2P A;  2OEX A;  1XG2 B;  2AO2 A;  2JBT A;  3BNJ A;  3BNH A;  2FON A;  3AFE A;  3MPJ A;  3OIB A;  4KS9 A;  5GJV E;  3TZ4 A;  5M4N A;  3VKH A;  2R0N A;  1XFW A;  4HKR A;  2Q8H A;  2OJQ A;  1X90 A;  2YYJ A;  3GQT A;  3N0R A;  3AFF A;  1OAH A;  2RFQ A;  2OT4 A;  2C0U A;  2ZKJ A;  1K8T A;  2BU2 A;  2GBB A;  4HR3 A;  2EC5 A;  1U8V A;  4H7Q A;  2CJ6 A;  4L1F A;  3M9V A;  1X91 A;  4LQQ B;  3SF6 A;  3S7W A;  2FP1 A;  4JIO A;  4JEK A;  2RF7 A;  4FF1 A;  3TTB A;  5J71 A;  2YYM A;  1WS9 A;  2JIF A;  1RX0 A;  5K3J A;  3MDD A;  4F0X A;  1Y8O A;  4KCF A;  2BU5 A;  4V26 A;  3TOR A;  4E00 A;  2CJ8 A;  5J6A A;  5K3I A;  1T9G A;  3MPI A;  1Y0V A;  3RKH A;  1GJV A;  3HWC A;  1K90 A;  1SIQ A;  2FP2 A;  3FO3 A;  4DZY A;  4FF2 A;  4G97 A;  3TZ2 A;  3TZ0 A;  3SWO A;  4AKI A;  1QDB A;  4MP2 A;  2PNR A;  1EGD A;  4L38 A;  3Q23 A;  2R05 A;  1RJ1 A;  4L3X A;  4KTO A;  1UKW A;  1XFV A;  3B96 A;  4U83 A;  4M9A A;  4MPC A;  2ZDX A;  4MP7 A;  4P13 A;  2Q8I A;  4ZYJ A;  3MKH A;  3II9 A;  1W07 A;  3BNF A;  2VIG A;  3CE2 A;  4QIC A;  4AKG A;  2JBS A;  2BTZ A;  2QR4 A;  1R2J A;  1SK6 A;  2BU7 A;  2UXW A;  2IX6 A;  2J7A A;  4J1V A;  2VR0 A;  2PO4 A;  2YYG A;  3D6B A;  1GKZ A;  4H85 A;  4L3Y A;  5BRM A;  2OR0 A;  4X28 C;  1JQI A;  4LQS B;  3X29 A;  3CRL A;  3D2R A;  3Q24 A;  1S26 A;  1SC5 A;  3KML A; 
#chains in the Genus database with same CATH homology
 2CJ8 A;  2CJ7 A;  1X90 A;  1XG2 B;  1RJ1 A;  2XQR B;  2CJ5 A;  1X8Z A;  2CJ4 A;  1RJ4 A;  2CJ6 A;  1X91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...