2XQRB

Crystal structure of plant cell wall invertase in complex with a specific protein inhibitor
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
146
structure length
146
Chain Sequence
NLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-FRUCTOFURANOSIDASE, INSOLUBLE ISOENZYME CWINV1
publication title Structural Insights Into the Ph-Controlled Targeting of Plant Cell-Wall Invertase by a Specific Inhibitor Protein.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/inhibitor
total genus 55
structure length 146
sequence length 146
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2010-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2xqrB00
2CJ8A 1X90A 1X8ZA 1XG2B 1RJ4A 1RJ1A 2CJ6A 2CJ5A 2CJ7A 2XQRB 1X91A 2CJ4A
chains in the Genus database with same CATH superfamily
2CJ8A 5K3IA 4NXLA 1GJVA 2YYJA 2ZKJA 4KS9A 4HR3A 1UDYA 2YYLA 3P4TA 3L1TA 3LGQA 2BU8A 4L38A 1FS9A 2AZEA 2HJNA 2QR4A 3TZ5A 1W07A 5M4PA 3VADA 5K3HA 2CJ6A 4Q1OA 3OWMA 1GU6A 1XFZA 2BU7A 2R05A 4X28A 2YYKA 4LQQB 3HWCA 1GKXA 1IS2A 1RX0A 2WBIA 1PI1A 2E81A 3EOMA 4H85A 4IRNA 4QICA 5M4NA 4H81A 3GNCA 4L3YA 3SF6A 4Q5BA 3MMOA 3OWAA 4XVXA 2R02A 3BNGA 3Q24A 3D1IA 3VKGA 2XS1A 3LG1A 4W9UA 3TTBA 1Y8OA 3SXQA 1XFXA 3UBRA 4G97A 4IV6A 4LQSB 1RJ4A 1PK0A 2E80A 2IX5A 2YGWA 3F29A 3X0XA 2FP1A 2LFWA 5M4KA 1XFUA 5K3JA 1SC5A 4ZXVA 2FP2A 3AFEA 3KMLA 2A1TA 2ZAFA 1K93A 2ZDYA 3CE2A 2JBTA 1UKWA 5BRMA 2CJ4A 3C2PA 3NF4A 3X0YA 4AKGA 2BU2A 1R2JA 4Q4UA 4WJYA 1RP3A 4MPNA 2PO4A 3VKHA 5GJVE 1Y8NA 5GJWE 4FF2A 2OEVA 2YYMA 4OO2A 2EBAA 4P79A 3C3LA 2XQRB 3RKHA 1FS8A 2BTZA 4AKHA 2IX6A 1K90A 4L3ZA 3II9A 2EC5A 2R0MA 3C46A 1X91A 4G5EA 3R7KA 1EGCA 1X8ZA 2UXWA 4FF1A 3D9DA 2BU5A 1XFYA 2PNRA 3S7WA 2OT4A 3UU9A 2F6LA 1T9GA 4E00A 4FZ4A 5B5VA 2DVLA 2VF1A 5B6BA 4ZYJA 1U8VA 3D9FA 5K3GA 4RM7A 2ZO5A 2EBFX 1JM6A 4U83A 2CJ5A 4V25A 3Q22A 2BU6A 1BUCA 3MPIA 2D29A 1EGEA 1XFWA 2C0UA 3D2RA 2VR0A 4KCFA 4Q5CA 4E02A 1R3BA 1RJ1A 1S26A 4H7QA 2Z1QA 3B96A 3BNFA 3M9VA 3CRKA 3MDEA 4JIZA 2R0NA 3MXLA 4JIOA 4JEKA 4Q0TA 2OJQA 3SCEA 1EGDA 1OAHA 1X90A 5J6AA 4J1VA 3BNHA 5B5WA 2XS8A 1LVCA 3MDDA 2DDHA 4M9AA 4E01A 1SIRA 3N0RA 2OEXA 1IVHA 3FCJA 2JBSA 3FO3A 4HKSA 2E0AA 2Q8GA 4V26A 4DOYA 4FF4A 2RF7A 3TZ4A 3AFFA 3CRLA 3Q23A 4P13A 2Q8IA 4Q17A 1XFVA 3EONA 2OR0A 2YYGA 3Q0AA 1WS9A 1FS7A 2CJ7A 2EBHX 3BNJA 3MPJA 2FONA 1SK6A 2GBBA 1K8TA 2Q8FA 3TZ2A 2ZDXA 3X29A 3GM6A 4KSAA 3GQTA 2PG0A 4X28C 2AO2A 2C12A 1XG2B 4KTOA 4MPCA 2Q8HA 2YYIA 3MKHA 4L1FA 3PFDA 4DZYA 4F0XA 4O5MA 2R03A 1QDBA 5J71A 2JIFA 4MP7A 4N5FA 5BRKA 4AKIA 2JBRA 3D6BA 3D9GA 3OIBA 4KSFA 3TORA 4MP2A 2RFQA 1SIQA 1Y8PA 1Y0VA 4HKRA 1JQIA 3D9EA 4AI6A 3SWOA 2J7AA 2VIGA 5M4MA 2RDZA 4MPEA 3TZ0A 1GKZA 2CX9A 4FF3A 4L3XA 2REHA
chains in the Genus database with same CATH topology
2CJ8A 1X90A 1X8ZA 1XG2B 1RJ4A 1RJ1A 2CJ6A 2CJ5A 2CJ7A 2XQRB 1X91A 2CJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJ8 A;  1X90 A;  1X8Z A;  1XG2 B;  1RJ4 A;  1RJ1 A;  2CJ6 A;  2CJ5 A;  2CJ7 A;  2XQR B;  1X91 A;  2CJ4 A; 
#chains in the Genus database with same CATH topology
 2CJ8 A;  5K3I A;  4NXL A;  1GJV A;  2YYJ A;  2ZKJ A;  4KS9 A;  4HR3 A;  1UDY A;  2YYL A;  3P4T A;  3L1T A;  3LGQ A;  2BU8 A;  4L38 A;  1FS9 A;  2AZE A;  2HJN A;  2QR4 A;  3TZ5 A;  1W07 A;  5M4P A;  3VAD A;  5K3H A;  2CJ6 A;  4Q1O A;  3OWM A;  1GU6 A;  1XFZ A;  2BU7 A;  2R05 A;  4X28 A;  2YYK A;  4LQQ B;  3HWC A;  1GKX A;  1IS2 A;  1RX0 A;  2WBI A;  1PI1 A;  2E81 A;  3EOM A;  4H85 A;  4IRN A;  4QIC A;  5M4N A;  4H81 A;  3GNC A;  4L3Y A;  3SF6 A;  4Q5B A;  3MMO A;  3OWA A;  4XVX A;  2R02 A;  3BNG A;  3Q24 A;  3D1I A;  3VKG A;  2XS1 A;  3LG1 A;  4W9U A;  3TTB A;  1Y8O A;  3SXQ A;  1XFX A;  3UBR A;  4G97 A;  4IV6 A;  4LQS B;  1RJ4 A;  1PK0 A;  2E80 A;  2IX5 A;  2YGW A;  3F29 A;  3X0X A;  2FP1 A;  2LFW A;  5M4K A;  1XFU A;  5K3J A;  1SC5 A;  4ZXV A;  2FP2 A;  3AFE A;  3KML A;  2A1T A;  2ZAF A;  1K93 A;  2ZDY A;  3CE2 A;  2JBT A;  1UKW A;  5BRM A;  2CJ4 A;  3C2P A;  3NF4 A;  3X0Y A;  4AKG A;  2BU2 A;  1R2J A;  4Q4U A;  4WJY A;  1RP3 A;  4MPN A;  2PO4 A;  3VKH A;  5GJV E;  1Y8N A;  5GJW E;  4FF2 A;  2OEV A;  2YYM A;  4OO2 A;  2EBA A;  4P79 A;  3C3L A;  2XQR B;  3RKH A;  1FS8 A;  2BTZ A;  4AKH A;  2IX6 A;  1K90 A;  4L3Z A;  3II9 A;  2EC5 A;  2R0M A;  3C46 A;  1X91 A;  4G5E A;  3R7K A;  1EGC A;  1X8Z A;  2UXW A;  4FF1 A;  3D9D A;  2BU5 A;  1XFY A;  2PNR A;  3S7W A;  2OT4 A;  3UU9 A;  2F6L A;  1T9G A;  4E00 A;  4FZ4 A;  5B5V A;  2DVL A;  2VF1 A;  5B6B A;  4ZYJ A;  1U8V A;  3D9F A;  5K3G A;  4RM7 A;  2ZO5 A;  2EBF X;  1JM6 A;  4U83 A;  2CJ5 A;  4V25 A;  3Q22 A;  2BU6 A;  1BUC A;  3MPI A;  2D29 A;  1EGE A;  1XFW A;  2C0U A;  3D2R A;  2VR0 A;  4KCF A;  4Q5C A;  4E02 A;  1R3B A;  1RJ1 A;  1S26 A;  4H7Q A;  2Z1Q A;  3B96 A;  3BNF A;  3M9V A;  3CRK A;  3MDE A;  4JIZ A;  2R0N A;  3MXL A;  4JIO A;  4JEK A;  4Q0T A;  2OJQ A;  3SCE A;  1EGD A;  1OAH A;  1X90 A;  5J6A A;  4J1V A;  3BNH A;  5B5W A;  2XS8 A;  1LVC A;  3MDD A;  2DDH A;  4M9A A;  4E01 A;  1SIR A;  3N0R A;  2OEX A;  1IVH A;  3FCJ A;  2JBS A;  3FO3 A;  4HKS A;  2E0A A;  2Q8G A;  4V26 A;  4DOY A;  4FF4 A;  2RF7 A;  3TZ4 A;  3AFF A;  3CRL A;  3Q23 A;  4P13 A;  2Q8I A;  4Q17 A;  1XFV A;  3EON A;  2OR0 A;  2YYG A;  3Q0A A;  1WS9 A;  1FS7 A;  2CJ7 A;  2EBH X;  3BNJ A;  3MPJ A;  2FON A;  1SK6 A;  2GBB A;  1K8T A;  2Q8F A;  3TZ2 A;  2ZDX A;  3X29 A;  3GM6 A;  4KSA A;  3GQT A;  2PG0 A;  4X28 C;  2AO2 A;  2C12 A;  1XG2 B;  4KTO A;  4MPC A;  2Q8H A;  2YYI A;  3MKH A;  4L1F A;  3PFD A;  4DZY A;  4F0X A;  4O5M A;  2R03 A;  1QDB A;  5J71 A;  2JIF A;  4MP7 A;  4N5F A;  5BRK A;  4AKI A;  2JBR A;  3D6B A;  3D9G A;  3OIB A;  4KSF A;  3TOR A;  4MP2 A;  2RFQ A;  1SIQ A;  1Y8P A;  1Y0V A;  4HKR A;  1JQI A;  3D9E A;  4AI6 A;  3SWO A;  2J7A A;  2VIG A;  5M4M A;  2RDZ A;  4MPE A;  3TZ0 A;  1GKZ A;  2CX9 A;  4FF3 A;  4L3X A;  2REH A; 
#chains in the Genus database with same CATH homology
 2CJ8 A;  1X90 A;  1X8Z A;  1XG2 B;  1RJ4 A;  1RJ1 A;  2CJ6 A;  2CJ5 A;  2CJ7 A;  2XQR B;  1X91 A;  2CJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...