4JIZA

Human mob1-phosphopeptide complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
172
Chain Sequence
NLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOB kinase activator 1A
publication title Activation of the yeast Hippo pathway by phosphorylation-dependent assembly of signaling complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 53
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2013-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 4jizA00
4JIZA 4J1VA 5BRMA 4LQQB 4LQSB 5B5VA 5B5WA 1PI1A 5BRKA 1R3BA 2HJNA 5B6BA
chains in the Genus database with same CATH superfamily
4JIZA 4IRNA 1SK6A 1SC5A 2OEXA 2YGWA 5K3GA 4L1FA 2Q8FA 4ZYJA 1GKZA 1T9GA 4HKSA 3BNJA 2CX9A 3Q23A 3TTBA 2E81A 4Q5BA 2CJ5A 2JBSA 2XQRB 4E00A 4MP2A 3R7KA 3AFFA 5B5VA 4MP7A 2CJ7A 2XS1A 2BU8A 2FP1A 4JEKA 1RX0A 4DZYA 3C46A 2RF7A 3TORA 5M4PA 3CRLA 3MPJA 3UBRA 2DVLA 2EC5A 4F0XA 2E80A 4H85A 3BNFA 3D6BA 4L3ZA 3MDEA 3SWOA 1GKXA 2ZDXA 3D9GA 5K3IA 2ZO5A 4QICA 3HWCA 5K3HA 2R0MA 3B96A 2YYJA 1RJ4A 3FO3A 4V26A 4X28A 5B6BA 3MXLA 4M9AA 2CJ8A 3EOMA 3KMLA 3BNHA 3MKHA 3MPIA 2BU2A 1EGDA 4KSFA 4FF4A 4MPEA 4MPNA 2JIFA 3GQTA 3P4TA 3SF6A 2ZAFA 5GJVE 2YYLA 3X0YA 3PFDA 4WJYA 1Y8PA 3CE2A 5B5WA 5J71A 4L38A 1FS7A 4KCFA 5M4NA 3Q0AA 1K8TA 4O5MA 1GJVA 1BUCA 1K90A 2YYGA 2AO2A 3SXQA 3X0XA 2OEVA 2BU6A 1X91A 1WS9A 4Q17A 3OWAA 2YYMA 1EGEA 4NXLA 1SIQA 2PNRA 3MDDA 4W9UA 3Q22A 2PG0A 4LQSB 3TZ2A 3MMOA 3NF4A 4FZ4A 2ZDYA 4G97A 5BRKA 2EBFX 4KSAA 1GU6A 3SCEA 5GJWE 1PK0A 2C0UA 2A1TA 2UXWA 1JQIA 2VF1A 1LVCA 3AFEA 3TZ0A 2VIGA 3LGQA 3OIBA 1QDBA 4DOYA 2ZKJA 2BU7A 3VADA 2BU5A 4G5EA 5M4MA 4AKHA 4L3XA 3TZ4A 5J6AA 2HJNA 2R03A 4Q1OA 2GBBA 4E01A 3F29A 1K93A 4E02A 2PO4A 4JIOA 3FCJA 3RKHA 2JBTA 2BTZA 3D9DA 4N5FA 2OJQA 3S7WA 1XFZA 1JM6A 1W07A 4AKIA 1XG2B 2Q8HA 1Y0VA 3N0RA 4Q4UA 2RFQA 2J7AA 4FF1A 1EGCA 4FF3A 2FP2A 2C12A 1FS9A 1XFUA 4IV6A 2EBHX 3D2RA 3II9A 3TZ5A 1Y8NA 2QR4A 2XS8A 2R0NA 4V25A 3L1TA 4H81A 2FONA 3LG1A 2CJ6A 1OAHA 4P79A 1XFXA 5BRMA 3Q24A 4HKRA 4XVXA 3M9VA 4Q5CA 4AI6A 3D9EA 3GM6A 2IX5A 2YYKA 1R2JA 4X28C 2IX6A 2D29A 2R05A 2VR0A 2YYIA 1IS2A 4HR3A 2DDHA 4LQQB 4MPCA 1SIRA 2F6LA 4U83A 3GNCA 1PI1A 4OO2A 4KTOA 3C3LA 3D1IA 1RP3A 1XFWA 3D9FA 5K3JA 4RM7A 2EBAA 2Q8IA 2CJ4A 1U8VA 4KS9A 3C2PA 2OT4A 1Y8OA 4P13A 1S26A 4J1VA 1RJ1A 2WBIA 2REHA 2OR0A 1UDYA 1X90A 3CRKA 3EONA 4ZXVA 4FF2A 2JBRA 2RDZA 4H7QA 3OWMA 1UKWA 4L3YA 4Q0TA 3UU9A 3VKGA 4AKGA 2AZEA 1FS8A 1XFVA 2LFWA 1XFYA 3X29A 1IVHA 2Q8GA 5M4KA 2Z1QA 2E0AA 2R02A 3BNGA 1R3BA 1X8ZA 3VKHA
chains in the Genus database with same CATH topology
4JIZA 4J1VA 5BRMA 4LQQB 4LQSB 5B5VA 5B5WA 1PI1A 5BRKA 1R3BA 2HJNA 5B6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JIZ A;  4J1V A;  5BRM A;  4LQQ B;  4LQS B;  5B5V A;  5B5W A;  1PI1 A;  5BRK A;  1R3B A;  2HJN A;  5B6B A; 
#chains in the Genus database with same CATH topology
 4JIZ A;  4IRN A;  1SK6 A;  1SC5 A;  2OEX A;  2YGW A;  5K3G A;  4L1F A;  2Q8F A;  4ZYJ A;  1GKZ A;  1T9G A;  4HKS A;  3BNJ A;  2CX9 A;  3Q23 A;  3TTB A;  2E81 A;  4Q5B A;  2CJ5 A;  2JBS A;  2XQR B;  4E00 A;  4MP2 A;  3R7K A;  3AFF A;  5B5V A;  4MP7 A;  2CJ7 A;  2XS1 A;  2BU8 A;  2FP1 A;  4JEK A;  1RX0 A;  4DZY A;  3C46 A;  2RF7 A;  3TOR A;  5M4P A;  3CRL A;  3MPJ A;  3UBR A;  2DVL A;  2EC5 A;  4F0X A;  2E80 A;  4H85 A;  3BNF A;  3D6B A;  4L3Z A;  3MDE A;  3SWO A;  1GKX A;  2ZDX A;  3D9G A;  5K3I A;  2ZO5 A;  4QIC A;  3HWC A;  5K3H A;  2R0M A;  3B96 A;  2YYJ A;  1RJ4 A;  3FO3 A;  4V26 A;  4X28 A;  5B6B A;  3MXL A;  4M9A A;  2CJ8 A;  3EOM A;  3KML A;  3BNH A;  3MKH A;  3MPI A;  2BU2 A;  1EGD A;  4KSF A;  4FF4 A;  4MPE A;  4MPN A;  2JIF A;  3GQT A;  3P4T A;  3SF6 A;  2ZAF A;  5GJV E;  2YYL A;  3X0Y A;  3PFD A;  4WJY A;  1Y8P A;  3CE2 A;  5B5W A;  5J71 A;  4L38 A;  1FS7 A;  4KCF A;  5M4N A;  3Q0A A;  1K8T A;  4O5M A;  1GJV A;  1BUC A;  1K90 A;  2YYG A;  2AO2 A;  3SXQ A;  3X0X A;  2OEV A;  2BU6 A;  1X91 A;  1WS9 A;  4Q17 A;  3OWA A;  2YYM A;  1EGE A;  4NXL A;  1SIQ A;  2PNR A;  3MDD A;  4W9U A;  3Q22 A;  2PG0 A;  4LQS B;  3TZ2 A;  3MMO A;  3NF4 A;  4FZ4 A;  2ZDY A;  4G97 A;  5BRK A;  2EBF X;  4KSA A;  1GU6 A;  3SCE A;  5GJW E;  1PK0 A;  2C0U A;  2A1T A;  2UXW A;  1JQI A;  2VF1 A;  1LVC A;  3AFE A;  3TZ0 A;  2VIG A;  3LGQ A;  3OIB A;  1QDB A;  4DOY A;  2ZKJ A;  2BU7 A;  3VAD A;  2BU5 A;  4G5E A;  5M4M A;  4AKH A;  4L3X A;  3TZ4 A;  5J6A A;  2HJN A;  2R03 A;  4Q1O A;  2GBB A;  4E01 A;  3F29 A;  1K93 A;  4E02 A;  2PO4 A;  4JIO A;  3FCJ A;  3RKH A;  2JBT A;  2BTZ A;  3D9D A;  4N5F A;  2OJQ A;  3S7W A;  1XFZ A;  1JM6 A;  1W07 A;  4AKI A;  1XG2 B;  2Q8H A;  1Y0V A;  3N0R A;  4Q4U A;  2RFQ A;  2J7A A;  4FF1 A;  1EGC A;  4FF3 A;  2FP2 A;  2C12 A;  1FS9 A;  1XFU A;  4IV6 A;  2EBH X;  3D2R A;  3II9 A;  3TZ5 A;  1Y8N A;  2QR4 A;  2XS8 A;  2R0N A;  4V25 A;  3L1T A;  4H81 A;  2FON A;  3LG1 A;  2CJ6 A;  1OAH A;  4P79 A;  1XFX A;  5BRM A;  3Q24 A;  4HKR A;  4XVX A;  3M9V A;  4Q5C A;  4AI6 A;  3D9E A;  3GM6 A;  2IX5 A;  2YYK A;  1R2J A;  4X28 C;  2IX6 A;  2D29 A;  2R05 A;  2VR0 A;  2YYI A;  1IS2 A;  4HR3 A;  2DDH A;  4LQQ B;  4MPC A;  1SIR A;  2F6L A;  4U83 A;  3GNC A;  1PI1 A;  4OO2 A;  4KTO A;  3C3L A;  3D1I A;  1RP3 A;  1XFW A;  3D9F A;  5K3J A;  4RM7 A;  2EBA A;  2Q8I A;  2CJ4 A;  1U8V A;  4KS9 A;  3C2P A;  2OT4 A;  1Y8O A;  4P13 A;  1S26 A;  4J1V A;  1RJ1 A;  2WBI A;  2REH A;  2OR0 A;  1UDY A;  1X90 A;  3CRK A;  3EON A;  4ZXV A;  4FF2 A;  2JBR A;  2RDZ A;  4H7Q A;  3OWM A;  1UKW A;  4L3Y A;  4Q0T A;  3UU9 A;  3VKG A;  4AKG A;  2AZE A;  1FS8 A;  1XFV A;  2LFW A;  1XFY A;  3X29 A;  1IVH A;  2Q8G A;  5M4K A;  2Z1Q A;  2E0A A;  2R02 A;  3BNG A;  1R3B A;  1X8Z A;  3VKH A; 
#chains in the Genus database with same CATH homology
 4JIZ A;  4J1V A;  5BRM A;  4LQQ B;  4LQS B;  5B5V A;  5B5W A;  1PI1 A;  5BRK A;  1R3B A;  2HJN A;  5B6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...