5B5WA

Crystal structure of mob1-lats1 ntr domain complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
172
Chain Sequence
GNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/apotosis
molecule keywords MOB kinase activator 1B
publication title Structural basis for autoinhibition and its relief of MOB1 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 172
sequence length 175
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5b5wA00
5B5VA 4JIZA 4LQQB 4LQSB 1PI1A 2HJNA 5B5WA 5B6BA 5BRKA 4J1VA 1R3BA 5BRMA
chains in the Genus database with same CATH superfamily
1SIQA 3GNCA 3OWMA 4HKRA 2OT4A 3X0XA 4AKHA 5M4NA 4L1FA 1K93A 2CJ5A 1T9GA 1XFVA 2YYLA 4AKGA 2YYMA 4V26A 2XS1A 2Q8IA 1RJ1A 2IX6A 2BU8A 2CJ6A 2VF1A 3D9EA 4FF3A 2Q8HA 4H7QA 3Q0AA 3VKHA 5B5VA 5GJVE 5K3GA 2FP2A 3Q24A 1FS8A 2J7AA 2R0MA 1QDBA 2WBIA 3D9GA 3FO3A 1IS2A 2QR4A 2ZO5A 4JIZA 4U83A 3FCJA 5J71A 2DDHA 4ZYJA 2C0UA 1X8ZA 1FS9A 2BU7A 4J1VA 2REHA 4MPCA 4OO2A 5K3IA 1PK0A 2RFQA 3MKHA 2A1TA 3BNGA 1SK6A 3D9FA 5K3HA 1Y8PA 1JQIA 3S7WA 2YYGA 1R2JA 3CRKA 3GQTA 4IRNA 3BNFA 4ZXVA 1SC5A 2R0NA 2ZDXA 2Z1QA 1SIRA 2YGWA 2JIFA 3LG1A 4IV6A 4KTOA 2AZEA 3D9DA 4NXLA 4KSAA 2FP1A 4AKIA 3D1IA 4Q4UA 3EOMA 3LGQA 4FF1A 3F29A 2Q8FA 4L38A 3GM6A 1XG2B 3EONA 3UU9A 3VADA 4DZYA 5M4KA 3MDDA 3C2PA 1XFYA 5B5WA 5B6BA 1FS7A 2C12A 3X0YA 4E00A 2R02A 2BU2A 2ZDYA 1X91A 2YYJA 2ZKJA 3D2RA 3MPIA 1K90A 4MPEA 3TORA 4F0XA 3SCEA 4E01A 1EGDA 3CE2A 3Q22A 1XFUA 3AFFA 3X29A 2OEVA 1W07A 3N0RA 3MDEA 4Q17A 4QICA 1EGEA 2DVLA 3OWAA 4L3YA 2RF7A 4P13A 4Q5CA 2EC5A 2HJNA 3R7KA 1S26A 5J6AA 4P79A 2FONA 1GKXA 3II9A 3PFDA 3TZ4A 4L3XA 4JEKA 4V25A 2BTZA 4G5EA 3AFEA 3SXQA 2JBRA 4G97A 1GU6A 4N5FA 4E02A 3C46A 5BRKA 1XFWA 2VIGA 2R03A 4L3ZA 3P4TA 2CJ4A 4W9UA 4FF4A 4Q5BA 2E81A 2R05A 2PO4A 2XS8A 4LQQB 3OIBA 4HR3A 1Y8NA 4H85A 1XFZA 2E80A 3D6BA 1GJVA 4FF2A 3CRLA 4MPNA 4X28A 3TZ2A 4LQSB 3TZ0A 1PI1A 4FZ4A 2CJ8A 1EGCA 3SF6A 2UXWA 3MXLA 2JBSA 4MP7A 5BRMA 2ZAFA 2VR0A 4WJYA 3BNHA 2OR0A 3M9VA 1UDYA 4KCFA 4M9AA 3NF4A 5GJWE 5K3JA 4HKSA 3B96A 1UKWA 5M4MA 4DOYA 1K8TA 4X28C 4AI6A 1Y0VA 4KS9A 2RDZA 2Q8GA 3HWCA 4MP2A 1X90A 1Y8OA 2AO2A 1R3BA 3L1TA 4KSFA 2PNRA 4Q0TA 3Q23A 3KMLA 2BU5A 1JM6A 1OAHA 2PG0A 2YYIA 3TTBA 4XVXA 3SWOA 1LVCA 4RM7A 1BUCA 1XFXA 2F6LA 2YYKA 3MMOA 3TZ5A 3C3LA 2LFWA 1RJ4A 3MPJA 1U8VA 4H81A 2E0AA 2EBHX 2IX5A 2CX9A 2XQRB 3VKGA 2JBTA 2OJQA 2OEXA 2BU6A 1IVHA 5M4PA 4O5MA 2EBFX 4JIOA 3BNJA 1RX0A 1GKZA 4Q1OA 1RP3A 3RKHA 2D29A 1WS9A 2CJ7A 3UBRA 2EBAA 2GBBA
chains in the Genus database with same CATH topology
5B5VA 4JIZA 4LQQB 4LQSB 1PI1A 2HJNA 5B5WA 5B6BA 5BRKA 4J1VA 1R3BA 5BRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5V A;  4JIZ A;  4LQQ B;  4LQS B;  1PI1 A;  2HJN A;  5B5W A;  5B6B A;  5BRK A;  4J1V A;  1R3B A;  5BRM A; 
#chains in the Genus database with same CATH topology
 1SIQ A;  3GNC A;  3OWM A;  4HKR A;  2OT4 A;  3X0X A;  4AKH A;  5M4N A;  4L1F A;  1K93 A;  2CJ5 A;  1T9G A;  1XFV A;  2YYL A;  4AKG A;  2YYM A;  4V26 A;  2XS1 A;  2Q8I A;  1RJ1 A;  2IX6 A;  2BU8 A;  2CJ6 A;  2VF1 A;  3D9E A;  4FF3 A;  2Q8H A;  4H7Q A;  3Q0A A;  3VKH A;  5B5V A;  5GJV E;  5K3G A;  2FP2 A;  3Q24 A;  1FS8 A;  2J7A A;  2R0M A;  1QDB A;  2WBI A;  3D9G A;  3FO3 A;  1IS2 A;  2QR4 A;  2ZO5 A;  4JIZ A;  4U83 A;  3FCJ A;  5J71 A;  2DDH A;  4ZYJ A;  2C0U A;  1X8Z A;  1FS9 A;  2BU7 A;  4J1V A;  2REH A;  4MPC A;  4OO2 A;  5K3I A;  1PK0 A;  2RFQ A;  3MKH A;  2A1T A;  3BNG A;  1SK6 A;  3D9F A;  5K3H A;  1Y8P A;  1JQI A;  3S7W A;  2YYG A;  1R2J A;  3CRK A;  3GQT A;  4IRN A;  3BNF A;  4ZXV A;  1SC5 A;  2R0N A;  2ZDX A;  2Z1Q A;  1SIR A;  2YGW A;  2JIF A;  3LG1 A;  4IV6 A;  4KTO A;  2AZE A;  3D9D A;  4NXL A;  4KSA A;  2FP1 A;  4AKI A;  3D1I A;  4Q4U A;  3EOM A;  3LGQ A;  4FF1 A;  3F29 A;  2Q8F A;  4L38 A;  3GM6 A;  1XG2 B;  3EON A;  3UU9 A;  3VAD A;  4DZY A;  5M4K A;  3MDD A;  3C2P A;  1XFY A;  5B5W A;  5B6B A;  1FS7 A;  2C12 A;  3X0Y A;  4E00 A;  2R02 A;  2BU2 A;  2ZDY A;  1X91 A;  2YYJ A;  2ZKJ A;  3D2R A;  3MPI A;  1K90 A;  4MPE A;  3TOR A;  4F0X A;  3SCE A;  4E01 A;  1EGD A;  3CE2 A;  3Q22 A;  1XFU A;  3AFF A;  3X29 A;  2OEV A;  1W07 A;  3N0R A;  3MDE A;  4Q17 A;  4QIC A;  1EGE A;  2DVL A;  3OWA A;  4L3Y A;  2RF7 A;  4P13 A;  4Q5C A;  2EC5 A;  2HJN A;  3R7K A;  1S26 A;  5J6A A;  4P79 A;  2FON A;  1GKX A;  3II9 A;  3PFD A;  3TZ4 A;  4L3X A;  4JEK A;  4V25 A;  2BTZ A;  4G5E A;  3AFE A;  3SXQ A;  2JBR A;  4G97 A;  1GU6 A;  4N5F A;  4E02 A;  3C46 A;  5BRK A;  1XFW A;  2VIG A;  2R03 A;  4L3Z A;  3P4T A;  2CJ4 A;  4W9U A;  4FF4 A;  4Q5B A;  2E81 A;  2R05 A;  2PO4 A;  2XS8 A;  4LQQ B;  3OIB A;  4HR3 A;  1Y8N A;  4H85 A;  1XFZ A;  2E80 A;  3D6B A;  1GJV A;  4FF2 A;  3CRL A;  4MPN A;  4X28 A;  3TZ2 A;  4LQS B;  3TZ0 A;  1PI1 A;  4FZ4 A;  2CJ8 A;  1EGC A;  3SF6 A;  2UXW A;  3MXL A;  2JBS A;  4MP7 A;  5BRM A;  2ZAF A;  2VR0 A;  4WJY A;  3BNH A;  2OR0 A;  3M9V A;  1UDY A;  4KCF A;  4M9A A;  3NF4 A;  5GJW E;  5K3J A;  4HKS A;  3B96 A;  1UKW A;  5M4M A;  4DOY A;  1K8T A;  4X28 C;  4AI6 A;  1Y0V A;  4KS9 A;  2RDZ A;  2Q8G A;  3HWC A;  4MP2 A;  1X90 A;  1Y8O A;  2AO2 A;  1R3B A;  3L1T A;  4KSF A;  2PNR A;  4Q0T A;  3Q23 A;  3KML A;  2BU5 A;  1JM6 A;  1OAH A;  2PG0 A;  2YYI A;  3TTB A;  4XVX A;  3SWO A;  1LVC A;  4RM7 A;  1BUC A;  1XFX A;  2F6L A;  2YYK A;  3MMO A;  3TZ5 A;  3C3L A;  2LFW A;  1RJ4 A;  3MPJ A;  1U8V A;  4H81 A;  2E0A A;  2EBH X;  2IX5 A;  2CX9 A;  2XQR B;  3VKG A;  2JBT A;  2OJQ A;  2OEX A;  2BU6 A;  1IVH A;  5M4P A;  4O5M A;  2EBF X;  4JIO A;  3BNJ A;  1RX0 A;  1GKZ A;  4Q1O A;  1RP3 A;  3RKH A;  2D29 A;  1WS9 A;  2CJ7 A;  3UBR A;  2EBA A;  2GBB A; 
#chains in the Genus database with same CATH homology
 5B5V A;  4JIZ A;  4LQQ B;  4LQS B;  1PI1 A;  2HJN A;  5B5W A;  5B6B A;  5BRK A;  4J1V A;  1R3B A;  5BRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...