5B5WA

Crystal structure of mob1-lats1 ntr domain complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
172
Chain Sequence
GNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOB kinase activator 1B
publication title Structural basis for autoinhibition and its relief of MOB1 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein/apotosis
total genus 51
structure length 172
sequence length 175
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5b5wA00
5B6BA 4JIZA 1PI1A 5B5VA 4LQQB 5BRMA 2HJNA 5B5WA 4J1VA 5BRKA 4LQSB 1R3BA
chains in the Genus database with same CATH superfamily
2YGWA 2YYIA 1Y8OA 2RF7A 5M4PA 4X28A 1JM6A 4AKGA 3SXQA 4JIOA 2XS8A 2RFQA 4IRNA 5M4NA 4E01A 4FF1A 2QR4A 2LFWA 2YYJA 4KTOA 2Z1QA 5J71A 2J7AA 1LVCA 2IX6A 4FF4A 2A1TA 4F0XA 3OWAA 4M9AA 4KSFA 1XG2B 3GM6A 3PFDA 4O5MA 1UKWA 4Q5CA 3Q24A 2XQRB 4Q4UA 2CJ6A 1OAHA 2BU5A 4LQSB 3CE2A 4MPEA 3C3LA 3TZ0A 3II9A 2EBHX 3VKGA 4JIZA 2PNRA 4P13A 4QICA 1RX0A 2DVLA 5BRMA 2CJ4A 4L1FA 1Y8PA 2BU8A 2WBIA 3D9DA 3SWOA 4G5EA 3BNJA 2R0NA 4KCFA 2ZKJA 3M9VA 3OWMA 1FS8A 3UBRA 2EBAA 3TZ5A 5B5WA 4W9UA 4L3ZA 5K3IA 4MP7A 1WS9A 1R3BA 3NF4A 3SCEA 1XFUA 2YYMA 1UDYA 4Q1OA 1JQIA 4HR3A 3SF6A 2BTZA 2Q8FA 4FF2A 2E80A 2HJNA 2FONA 2OEVA 1BUCA 2FP2A 2JBTA 2UXWA 3LGQA 2PO4A 4RM7A 1GKZA 4HKRA 3S7WA 3X0XA 2JBSA 4MP2A 2OEXA 2DDHA 4H81A 4WJYA 4NXLA 3D9FA 2AZEA 3EOMA 3C46A 5J6AA 2BU6A 3TTBA 2R03A 4E00A 3LG1A 4MPCA 1GU6A 2YYKA 3UU9A 1XFXA 4DZYA 3TZ2A 5M4KA 4H7QA 3TORA 5M4MA 3BNGA 2PG0A 4G97A 3MDDA 1EGDA 1K93A 1PI1A 2D29A 3BNHA 3MMOA 4U83A 2BU7A 3FCJA 1IVHA 3L1TA 1T9GA 4KSAA 4Q5BA 4IV6A 4AKIA 1RJ4A 2EBFX 3D9GA 4V26A 1GJVA 3F29A 3D2RA 3GQTA 1XFZA 2VR0A 1IS2A 2Q8GA 4AI6A 1Y8NA 2F6LA 3MDEA 4JEKA 2OT4A 3MPIA 1EGEA 1EGCA 1X90A 1XFVA 2E0AA 2FP1A 2EC5A 4MPNA 3MKHA 1GKXA 1XFYA 4V25A 4LQQB 1K90A 3VADA 2E81A 2CJ5A 2CX9A 3KMLA 3D9EA 2R05A 1SK6A 2OR0A 3AFFA 3HWCA 4KS9A 5BRKA 4X28C 4ZXVA 4E02A 1U8VA 3P4TA 4XVXA 1SIQA 2BU2A 1RJ1A 2VIGA 2XS1A 1Y0VA 2ZDXA 3AFEA 3FO3A 4FZ4A 3R7KA 2YYGA 1SIRA 1XFWA 5K3GA 3Q23A 4H85A 2C0UA 4AKHA 3BNFA 4J1VA 3VKHA 2AO2A 2JBRA 2OJQA 3MPJA 3MXLA 1W07A 1PK0A 2IX5A 3N0RA 3D1IA 3CRKA 4OO2A 2Q8IA 4ZYJA 1RP3A 4HKSA 2CJ8A 3OIBA 3TZ4A 1SC5A 4L38A 4P79A 1QDBA 2JIFA 4Q0TA 3B96A 4DOYA 1FS7A 4N5FA 3Q22A 5GJWE 2R02A 2CJ7A 5B5VA 3X0YA 5K3JA 1X8ZA 3X29A 1FS9A 1S26A 1X91A 1R2JA 3CRLA 5B6BA 2REHA 3EONA 4L3XA 2C12A 2RDZA 4Q17A 5GJVE 5K3HA 2ZO5A 2ZDYA 2ZAFA 4L3YA 3RKHA 3Q0AA 2Q8HA 3GNCA 3C2PA 2GBBA 2VF1A 4FF3A 2YYLA 2R0MA 3D6BA 1K8TA
chains in the Genus database with same CATH topology
5B6BA 4JIZA 1PI1A 5B5VA 4LQQB 5BRMA 2HJNA 5B5WA 4J1VA 5BRKA 4LQSB 1R3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6B A;  4JIZ A;  1PI1 A;  5B5V A;  4LQQ B;  5BRM A;  2HJN A;  5B5W A;  4J1V A;  5BRK A;  4LQS B;  1R3B A; 
#chains in the Genus database with same CATH topology
 2YGW A;  2YYI A;  1Y8O A;  2RF7 A;  5M4P A;  4X28 A;  1JM6 A;  4AKG A;  3SXQ A;  4JIO A;  2XS8 A;  2RFQ A;  4IRN A;  5M4N A;  4E01 A;  4FF1 A;  2QR4 A;  2LFW A;  2YYJ A;  4KTO A;  2Z1Q A;  5J71 A;  2J7A A;  1LVC A;  2IX6 A;  4FF4 A;  2A1T A;  4F0X A;  3OWA A;  4M9A A;  4KSF A;  1XG2 B;  3GM6 A;  3PFD A;  4O5M A;  1UKW A;  4Q5C A;  3Q24 A;  2XQR B;  4Q4U A;  2CJ6 A;  1OAH A;  2BU5 A;  4LQS B;  3CE2 A;  4MPE A;  3C3L A;  3TZ0 A;  3II9 A;  2EBH X;  3VKG A;  4JIZ A;  2PNR A;  4P13 A;  4QIC A;  1RX0 A;  2DVL A;  5BRM A;  2CJ4 A;  4L1F A;  1Y8P A;  2BU8 A;  2WBI A;  3D9D A;  3SWO A;  4G5E A;  3BNJ A;  2R0N A;  4KCF A;  2ZKJ A;  3M9V A;  3OWM A;  1FS8 A;  3UBR A;  2EBA A;  3TZ5 A;  5B5W A;  4W9U A;  4L3Z A;  5K3I A;  4MP7 A;  1WS9 A;  1R3B A;  3NF4 A;  3SCE A;  1XFU A;  2YYM A;  1UDY A;  4Q1O A;  1JQI A;  4HR3 A;  3SF6 A;  2BTZ A;  2Q8F A;  4FF2 A;  2E80 A;  2HJN A;  2FON A;  2OEV A;  1BUC A;  2FP2 A;  2JBT A;  2UXW A;  3LGQ A;  2PO4 A;  4RM7 A;  1GKZ A;  4HKR A;  3S7W A;  3X0X A;  2JBS A;  4MP2 A;  2OEX A;  2DDH A;  4H81 A;  4WJY A;  4NXL A;  3D9F A;  2AZE A;  3EOM A;  3C46 A;  5J6A A;  2BU6 A;  3TTB A;  2R03 A;  4E00 A;  3LG1 A;  4MPC A;  1GU6 A;  2YYK A;  3UU9 A;  1XFX A;  4DZY A;  3TZ2 A;  5M4K A;  4H7Q A;  3TOR A;  5M4M A;  3BNG A;  2PG0 A;  4G97 A;  3MDD A;  1EGD A;  1K93 A;  1PI1 A;  2D29 A;  3BNH A;  3MMO A;  4U83 A;  2BU7 A;  3FCJ A;  1IVH A;  3L1T A;  1T9G A;  4KSA A;  4Q5B A;  4IV6 A;  4AKI A;  1RJ4 A;  2EBF X;  3D9G A;  4V26 A;  1GJV A;  3F29 A;  3D2R A;  3GQT A;  1XFZ A;  2VR0 A;  1IS2 A;  2Q8G A;  4AI6 A;  1Y8N A;  2F6L A;  3MDE A;  4JEK A;  2OT4 A;  3MPI A;  1EGE A;  1EGC A;  1X90 A;  1XFV A;  2E0A A;  2FP1 A;  2EC5 A;  4MPN A;  3MKH A;  1GKX A;  1XFY A;  4V25 A;  4LQQ B;  1K90 A;  3VAD A;  2E81 A;  2CJ5 A;  2CX9 A;  3KML A;  3D9E A;  2R05 A;  1SK6 A;  2OR0 A;  3AFF A;  3HWC A;  4KS9 A;  5BRK A;  4X28 C;  4ZXV A;  4E02 A;  1U8V A;  3P4T A;  4XVX A;  1SIQ A;  2BU2 A;  1RJ1 A;  2VIG A;  2XS1 A;  1Y0V A;  2ZDX A;  3AFE A;  3FO3 A;  4FZ4 A;  3R7K A;  2YYG A;  1SIR A;  1XFW A;  5K3G A;  3Q23 A;  4H85 A;  2C0U A;  4AKH A;  3BNF A;  4J1V A;  3VKH A;  2AO2 A;  2JBR A;  2OJQ A;  3MPJ A;  3MXL A;  1W07 A;  1PK0 A;  2IX5 A;  3N0R A;  3D1I A;  3CRK A;  4OO2 A;  2Q8I A;  4ZYJ A;  1RP3 A;  4HKS A;  2CJ8 A;  3OIB A;  3TZ4 A;  1SC5 A;  4L38 A;  4P79 A;  1QDB A;  2JIF A;  4Q0T A;  3B96 A;  4DOY A;  1FS7 A;  4N5F A;  3Q22 A;  5GJW E;  2R02 A;  2CJ7 A;  5B5V A;  3X0Y A;  5K3J A;  1X8Z A;  3X29 A;  1FS9 A;  1S26 A;  1X91 A;  1R2J A;  3CRL A;  5B6B A;  2REH A;  3EON A;  4L3X A;  2C12 A;  2RDZ A;  4Q17 A;  5GJV E;  5K3H A;  2ZO5 A;  2ZDY A;  2ZAF A;  4L3Y A;  3RKH A;  3Q0A A;  2Q8H A;  3GNC A;  3C2P A;  2GBB A;  2VF1 A;  4FF3 A;  2YYL A;  2R0M A;  3D6B A;  1K8T A; 
#chains in the Genus database with same CATH homology
 5B6B A;  4JIZ A;  1PI1 A;  5B5V A;  4LQQ B;  5BRM A;  2HJN A;  5B5W A;  4J1V A;  5BRK A;  4LQS B;  1R3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...