2FP1A

Secreted chorismate mutase from mycobacterium tuberculosis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
165
structure length
165
Chain Sequence
GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Chorismate mutase
publication title 1.6A Crystal Structure of the Secreted Chorismate Mutase from Mycobacterium tuberculosis: Novel Fold Topology Revealed
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 67
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.170 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 2fp1A00
2FP2A 2AO2A 2FP1A 2F6LA 2GBBA
chains in the Genus database with same CATH superfamily
2XS8A 3LG1A 4DOYA 4HKSA 3D6BA 1QDBA 4X28C 3VKHA 2OEXA 3MDEA 4ZYJA 3CE2A 5M4MA 2AO2A 1Y8NA 3P4TA 2CX9A 4G97A 4N5FA 1LVCA 4DZYA 1XFZA 2JBRA 3LGQA 4HKRA 4L38A 5B5WA 1FS7A 3BNGA 4MPNA 2BU6A 3Q22A 4FF3A 3AFEA 3X0YA 1XFUA 1RJ4A 4WJYA 2WBIA 2BU7A 1PI1A 2QR4A 3MPIA 4JIZA 4JIOA 4L3ZA 1RX0A 3TORA 5K3IA 2E0AA 5K3HA 2BU2A 1SIQA 3D2RA 4E00A 5M4NA 4AKIA 3MXLA 4RM7A 2YYJA 4MPEA 1SIRA 2C12A 2VR0A 1XFWA 3MPJA 2Q8IA 2PNRA 4L3XA 2OR0A 4MP2A 4L3YA 2OT4A 2D29A 4XVXA 3TZ2A 3X0XA 3UU9A 2YYMA 2OJQA 2ZO5A 2R02A 5BRKA 4Q4UA 4E02A 1U8VA 2XS1A 3OWAA 2BU8A 2PG0A 3B96A 3BNHA 1PK0A 3D9GA 1Y0VA 4H81A 4KS9A 4W9UA 3FCJA 4V26A 3RKHA 3SXQA 4OO2A 1EGCA 2R0NA 1W07A 4F0XA 2EBAA 2ZDYA 4Q1OA 3Q23A 1EGDA 2F6LA 3BNJA 3MKHA 5BRMA 2BU5A 4E01A 4FF4A 1X8ZA 4NXLA 4FF2A 5K3GA 2YGWA 3UBRA 3F29A 2JIFA 2RFQA 2OEVA 1GKZA 3HWCA 4KCFA 4L1FA 2CJ4A 4KSFA 1XG2B 3GQTA 5J6AA 2R0MA 1XFXA 3NF4A 1S26A 2AZEA 4M9AA 4ZXVA 3TZ0A 3KMLA 4P13A 3L1TA 1R2JA 2RDZA 5M4PA 1GKXA 1XFYA 2FP2A 2IX6A 3CRKA 3EOMA 4IRNA 3Q0AA 3C2PA 5GJVE 1GJVA 2E80A 2RF7A 4MPCA 1UDYA 2DVLA 3GM6A 3SCEA 1JQIA 2EBHX 3PFDA 2CJ7A 2VIGA 3N0RA 1Y8PA 1WS9A 2BTZA 2E81A 2YYKA 2ZKJA 3MDDA 4LQQB 4LQSB 2JBSA 3TZ4A 4AI6A 3VKGA 4O5MA 1IS2A 2FONA 4Q0TA 1R3BA 4X28A 2ZDXA 4G5EA 3Q24A 2CJ8A 1JM6A 2HJNA 2REHA 1FS9A 3OWMA 1OAHA 4Q5CA 2A1TA 5GJWE 5B5VA 3TZ5A 2R03A 3X29A 1FS8A 2UXWA 4QICA 2Z1QA 4FZ4A 4JEKA 2DDHA 2J7AA 3M9VA 3OIBA 3VADA 1K93A 4IV6A 4Q17A 1BUCA 1X91A 2IX5A 1EGEA 2YYIA 3MMOA 4AKGA 2CJ5A 3GNCA 5J71A 3D1IA 4J1VA 1SK6A 5K3JA 2XQRB 2YYLA 3II9A 3D9DA 1RP3A 4KTOA 4U83A 3S7WA 2EBFX 3AFFA 4H85A 4Q5BA 2C0UA 4P79A 2Q8GA 2PO4A 3SF6A 4FF1A 2R05A 1IVHA 3SWOA 3CRLA 3C3LA 2YYGA 2FP1A 1T9GA 2ZAFA 3D9EA 5B6BA 4HR3A 3FO3A 1X90A 4H7QA 1GU6A 3TTBA 1SC5A 2CJ6A 3D9FA 2LFWA 5M4KA 3R7KA 2GBBA 1RJ1A 1Y8OA 3EONA 4MP7A 2Q8HA 2Q8FA 3C46A 2JBTA 2VF1A 3BNFA 4KSAA 4V25A 1K8TA 4AKHA 1XFVA 1UKWA 2EC5A 1K90A
chains in the Genus database with same CATH topology
1XFYA 1SK6A 2FP2A 3Q0AA 3C2PA 1RP3A 5GJVE 2EBFX 4HKSA 4P79A 1PK0A 1Y0VA 4KS9A 2EBHX 2PO4A 3CE2A 4FF1A 2AO2A 3N0RA 4G97A 3C3LA 1LVCA 4F0XA 1XFZA 2FP1A 4AI6A 3Q23A 4HKRA 2F6LA 3VKGA 3Q24A 3VKHA 4FF4A 3Q22A 4FF3A 5GJWE 1XFUA 3X29A 4FF2A 2QR4A 1SC5A 2YGWA 4QICA 2LFWA 4FZ4A 2GBBA 1K93A 4KSFA 4AKIA 3KMLA 3C46A 2VF1A 4KSAA 1XFXA 1S26A 2AZEA 1K8TA 1XFWA 4AKHA 1XFVA 2EC5A 1K90A 4AKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FP2 A;  2AO2 A;  2FP1 A;  2F6L A;  2GBB A; 
#chains in the Genus database with same CATH topology
 2XS8 A;  3LG1 A;  4DOY A;  4HKS A;  3D6B A;  1QDB A;  4X28 C;  3VKH A;  2OEX A;  3MDE A;  4ZYJ A;  3CE2 A;  5M4M A;  2AO2 A;  1Y8N A;  3P4T A;  2CX9 A;  4G97 A;  4N5F A;  1LVC A;  4DZY A;  1XFZ A;  2JBR A;  3LGQ A;  4HKR A;  4L38 A;  5B5W A;  1FS7 A;  3BNG A;  4MPN A;  2BU6 A;  3Q22 A;  4FF3 A;  3AFE A;  3X0Y A;  1XFU A;  1RJ4 A;  4WJY A;  2WBI A;  2BU7 A;  1PI1 A;  2QR4 A;  3MPI A;  4JIZ A;  4JIO A;  4L3Z A;  1RX0 A;  3TOR A;  5K3I A;  2E0A A;  5K3H A;  2BU2 A;  1SIQ A;  3D2R A;  4E00 A;  5M4N A;  4AKI A;  3MXL A;  4RM7 A;  2YYJ A;  4MPE A;  1SIR A;  2C12 A;  2VR0 A;  1XFW A;  3MPJ A;  2Q8I A;  2PNR A;  4L3X A;  2OR0 A;  4MP2 A;  4L3Y A;  2OT4 A;  2D29 A;  4XVX A;  3TZ2 A;  3X0X A;  3UU9 A;  2YYM A;  2OJQ A;  2ZO5 A;  2R02 A;  5BRK A;  4Q4U A;  4E02 A;  1U8V A;  2XS1 A;  3OWA A;  2BU8 A;  2PG0 A;  3B96 A;  3BNH A;  1PK0 A;  3D9G A;  1Y0V A;  4H81 A;  4KS9 A;  4W9U A;  3FCJ A;  4V26 A;  3RKH A;  3SXQ A;  4OO2 A;  1EGC A;  2R0N A;  1W07 A;  4F0X A;  2EBA A;  2ZDY A;  4Q1O A;  3Q23 A;  1EGD A;  2F6L A;  3BNJ A;  3MKH A;  5BRM A;  2BU5 A;  4E01 A;  4FF4 A;  1X8Z A;  4NXL A;  4FF2 A;  5K3G A;  2YGW A;  3UBR A;  3F29 A;  2JIF A;  2RFQ A;  2OEV A;  1GKZ A;  3HWC A;  4KCF A;  4L1F A;  2CJ4 A;  4KSF A;  1XG2 B;  3GQT A;  5J6A A;  2R0M A;  1XFX A;  3NF4 A;  1S26 A;  2AZE A;  4M9A A;  4ZXV A;  3TZ0 A;  3KML A;  4P13 A;  3L1T A;  1R2J A;  2RDZ A;  5M4P A;  1GKX A;  1XFY A;  2FP2 A;  2IX6 A;  3CRK A;  3EOM A;  4IRN A;  3Q0A A;  3C2P A;  5GJV E;  1GJV A;  2E80 A;  2RF7 A;  4MPC A;  1UDY A;  2DVL A;  3GM6 A;  3SCE A;  1JQI A;  2EBH X;  3PFD A;  2CJ7 A;  2VIG A;  3N0R A;  1Y8P A;  1WS9 A;  2BTZ A;  2E81 A;  2YYK A;  2ZKJ A;  3MDD A;  4LQQ B;  4LQS B;  2JBS A;  3TZ4 A;  4AI6 A;  3VKG A;  4O5M A;  1IS2 A;  2FON A;  4Q0T A;  1R3B A;  4X28 A;  2ZDX A;  4G5E A;  3Q24 A;  2CJ8 A;  1JM6 A;  2HJN A;  2REH A;  1FS9 A;  3OWM A;  1OAH A;  4Q5C A;  2A1T A;  5GJW E;  5B5V A;  3TZ5 A;  2R03 A;  3X29 A;  1FS8 A;  2UXW A;  4QIC A;  2Z1Q A;  4FZ4 A;  4JEK A;  2DDH A;  2J7A A;  3M9V A;  3OIB A;  3VAD A;  1K93 A;  4IV6 A;  4Q17 A;  1BUC A;  1X91 A;  2IX5 A;  1EGE A;  2YYI A;  3MMO A;  4AKG A;  2CJ5 A;  3GNC A;  5J71 A;  3D1I A;  4J1V A;  1SK6 A;  5K3J A;  2XQR B;  2YYL A;  3II9 A;  3D9D A;  1RP3 A;  4KTO A;  4U83 A;  3S7W A;  2EBF X;  3AFF A;  4H85 A;  4Q5B A;  2C0U A;  4P79 A;  2Q8G A;  2PO4 A;  3SF6 A;  4FF1 A;  2R05 A;  1IVH A;  3SWO A;  3CRL A;  3C3L A;  2YYG A;  2FP1 A;  1T9G A;  2ZAF A;  3D9E A;  5B6B A;  4HR3 A;  3FO3 A;  1X90 A;  4H7Q A;  1GU6 A;  3TTB A;  1SC5 A;  2CJ6 A;  3D9F A;  2LFW A;  5M4K A;  3R7K A;  2GBB A;  1RJ1 A;  1Y8O A;  3EON A;  4MP7 A;  2Q8H A;  2Q8F A;  3C46 A;  2JBT A;  2VF1 A;  3BNF A;  4KSA A;  4V25 A;  1K8T A;  4AKH A;  1XFV A;  1UKW A;  2EC5 A;  1K90 A; 
#chains in the Genus database with same CATH homology
 1XFY A;  1SK6 A;  2FP2 A;  3Q0A A;  3C2P A;  1RP3 A;  5GJV E;  2EBF X;  4HKS A;  4P79 A;  1PK0 A;  1Y0V A;  4KS9 A;  2EBH X;  2PO4 A;  3CE2 A;  4FF1 A;  2AO2 A;  3N0R A;  4G97 A;  3C3L A;  1LVC A;  4F0X A;  1XFZ A;  2FP1 A;  4AI6 A;  3Q23 A;  4HKR A;  2F6L A;  3VKG A;  3Q24 A;  3VKH A;  4FF4 A;  3Q22 A;  4FF3 A;  5GJW E;  1XFU A;  3X29 A;  4FF2 A;  2QR4 A;  1SC5 A;  2YGW A;  4QIC A;  2LFW A;  4FZ4 A;  2GBB A;  1K93 A;  4KSF A;  4AKI A;  3KML A;  3C46 A;  2VF1 A;  4KSA A;  1XFX A;  1S26 A;  2AZE A;  1K8T A;  1XFW A;  4AKH A;  1XFV A;  2EC5 A;  1K90 A;  4AKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...