2FP1A

Secreted chorismate mutase from mycobacterium tuberculosis
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
165
structure length
165
Chain Sequence
GTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chorismate mutase
publication title 1.6A Crystal Structure of the Secreted Chorismate Mutase from Mycobacterium tuberculosis: Novel Fold Topology Revealed
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 67
structure length 165
sequence length 165
chains with identical sequence B
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2006-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.170 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 2fp1A00
2GBBA 2FP2A 2AO2A 2F6LA 2FP1A
chains in the Genus database with same CATH superfamily
1XFYA 1Y8PA 2IX6A 2CJ7A 2YYLA 3II9A 2Q8GA 4WJYA 4ZYJA 4MPCA 4FF4A 2FP1A 3PFDA 2E81A 1IS2A 1Y8OA 3LGQA 1FS9A 4H7QA 4KTOA 3TZ4A 3C46A 2R0NA 2PG0A 4KSFA 2FP2A 1SIQA 2ZO5A 3D6BA 4G5EA 1FS8A 4AKIA 1U8VA 1WS9A 3GM6A 1GKXA 4H81A 4L3ZA 4MPEA 2Q8HA 4ZXVA 3C2PA 1X8ZA 4L3XA 2EC5A 4V25A 3SWOA 3GQTA 4Q5BA 4J1VA 2QR4A 2CJ8A 2PO4A 3FCJA 5M4KA 3LG1A 1XFUA 1XFZA 2XQRB 1GKZA 2J7AA 3TZ5A 3MXLA 3P4TA 5M4NA 1EGCA 4L38A 2YYGA 3MMOA 5M4MA 3OIBA 3EOMA 3D9DA 4U83A 4E01A 5K3IA 5GJVE 4AI6A 3UBRA 2Z1QA 3Q23A 1Y8NA 2BU7A 3D2RA 1PI1A 5J6AA 3F29A 3GNCA 3MDDA 5K3JA 4AKGA 1XFVA 3OWAA 3BNFA 3HWCA 4JEKA 2JBRA 4LQSB 1IVHA 1GU6A 1K93A 2VR0A 3KMLA 4KSAA 4O5MA 1SK6A 4F0XA 2D29A 4OO2A 3D9FA 1X90A 1T9GA 2OR0A 2R05A 1RJ1A 3L1TA 2Q8FA 3C3LA 4G97A 2CX9A 1XG2B 2XS1A 4E02A 1JQIA 3BNJA 3EONA 4P79A 2JBSA 4Q5CA 2BTZA 5BRMA 2OEVA 3VADA 2ZDYA 3MDEA 3VKGA 2RDZA 3Q24A 3FO3A 1OAHA 4X28A 2DDHA 3OWMA 3AFFA 4LQQB 2Q8IA 2BU5A 2VF1A 2JIFA 4MP7A 4Q1OA 2JBTA 3N0RA 2R02A 2EBHX 3CE2A 4MPNA 5M4PA 4L1FA 2E0AA 4NXLA 3NF4A 2GBBA 1EGDA 1K8TA 1QDBA 2CJ4A 2R0MA 2ZAFA 4HKRA 1PK0A 4RM7A 2YYJA 1RP3A 2R03A 1XFWA 2CJ6A 3X29A 4DOYA 5K3HA 2WBIA 3TORA 2VIGA 3D9GA 4HKSA 4Q4UA 2AO2A 1LVCA 4H85A 2REHA 4W9UA 1GJVA 4KS9A 5B5VA 3TZ0A 4Q17A 3BNGA 3AFEA 4HR3A 1R2JA 2LFWA 5GJWE 3SF6A 1JM6A 3X0XA 2CJ5A 2RFQA 2IX5A 3R7KA 2BU2A 5BRKA 4XVXA 3D1IA 2EBAA 4FZ4A 3SXQA 2UXWA 2ZKJA 3CRKA 4DZYA 5B5WA 3Q0AA 1RJ4A 2OEXA 3CRLA 2BU8A 4KCFA 4X28C 1EGEA 2OJQA 4JIZA 5B6BA 3B96A 3TTBA 4E00A 3MPIA 1S26A 3X0YA 1W07A 2FONA 3TZ2A 4AKHA 4IV6A 3MKHA 2EBFX 2AZEA 2OT4A 1SC5A 2HJNA 3MPJA 2XS8A 2YYMA 3S7WA 4JIOA 4FF3A 1SIRA 1K90A 2E80A 3D9EA 4IRNA 3M9VA 2A1TA 3BNHA 4Q0TA 2YYKA 2PNRA 1BUCA 1RX0A 4N5FA 1XFXA 2ZDXA 4L3YA 1UDYA 4FF2A 1UKWA 4V26A 5J71A 3Q22A 1X91A 4QICA 3SCEA 5K3GA 2YGWA 2F6LA 1R3BA 2BU6A 3UU9A 1Y0VA 4M9AA 3VKHA 4FF1A 2C0UA 1FS7A 2C12A 2RF7A 3RKHA 4P13A 2DVLA 2YYIA 4MP2A
chains in the Genus database with same CATH topology
1XFYA 3Q23A 2VF1A 4FF4A 2FP1A 3N0RA 4AKGA 1S26A 1XFVA 2EBHX 3CE2A 3C46A 4KSFA 4AKHA 2GBBA 2FP2A 1K8TA 2EBFX 4HKRA 2AZEA 1PK0A 3Q24A 1K93A 1SC5A 3KMLA 4AKIA 1RP3A 4KSAA 1SK6A 4F0XA 3C2PA 1XFWA 3X29A 4FF3A 1K90A 2EC5A 4HKSA 2AO2A 1LVCA 2QR4A 2PO4A 4G97A 1XFXA 4KS9A 3C3LA 4FF2A 1XFUA 5GJWE 1XFZA 2LFWA 3Q22A 4QICA 2YGWA 4P79A 2F6LA 3VKHA 1Y0VA 4FF1A 3VKGA 4FZ4A 4AI6A 5GJVE 3Q0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBB A;  2FP2 A;  2AO2 A;  2F6L A;  2FP1 A; 
#chains in the Genus database with same CATH topology
 1XFY A;  1Y8P A;  2IX6 A;  2CJ7 A;  2YYL A;  3II9 A;  2Q8G A;  4WJY A;  4ZYJ A;  4MPC A;  4FF4 A;  2FP1 A;  3PFD A;  2E81 A;  1IS2 A;  1Y8O A;  3LGQ A;  1FS9 A;  4H7Q A;  4KTO A;  3TZ4 A;  3C46 A;  2R0N A;  2PG0 A;  4KSF A;  2FP2 A;  1SIQ A;  2ZO5 A;  3D6B A;  4G5E A;  1FS8 A;  4AKI A;  1U8V A;  1WS9 A;  3GM6 A;  1GKX A;  4H81 A;  4L3Z A;  4MPE A;  2Q8H A;  4ZXV A;  3C2P A;  1X8Z A;  4L3X A;  2EC5 A;  4V25 A;  3SWO A;  3GQT A;  4Q5B A;  4J1V A;  2QR4 A;  2CJ8 A;  2PO4 A;  3FCJ A;  5M4K A;  3LG1 A;  1XFU A;  1XFZ A;  2XQR B;  1GKZ A;  2J7A A;  3TZ5 A;  3MXL A;  3P4T A;  5M4N A;  1EGC A;  4L38 A;  2YYG A;  3MMO A;  5M4M A;  3OIB A;  3EOM A;  3D9D A;  4U83 A;  4E01 A;  5K3I A;  5GJV E;  4AI6 A;  3UBR A;  2Z1Q A;  3Q23 A;  1Y8N A;  2BU7 A;  3D2R A;  1PI1 A;  5J6A A;  3F29 A;  3GNC A;  3MDD A;  5K3J A;  4AKG A;  1XFV A;  3OWA A;  3BNF A;  3HWC A;  4JEK A;  2JBR A;  4LQS B;  1IVH A;  1GU6 A;  1K93 A;  2VR0 A;  3KML A;  4KSA A;  4O5M A;  1SK6 A;  4F0X A;  2D29 A;  4OO2 A;  3D9F A;  1X90 A;  1T9G A;  2OR0 A;  2R05 A;  1RJ1 A;  3L1T A;  2Q8F A;  3C3L A;  4G97 A;  2CX9 A;  1XG2 B;  2XS1 A;  4E02 A;  1JQI A;  3BNJ A;  3EON A;  4P79 A;  2JBS A;  4Q5C A;  2BTZ A;  5BRM A;  2OEV A;  3VAD A;  2ZDY A;  3MDE A;  3VKG A;  2RDZ A;  3Q24 A;  3FO3 A;  1OAH A;  4X28 A;  2DDH A;  3OWM A;  3AFF A;  4LQQ B;  2Q8I A;  2BU5 A;  2VF1 A;  2JIF A;  4MP7 A;  4Q1O A;  2JBT A;  3N0R A;  2R02 A;  2EBH X;  3CE2 A;  4MPN A;  5M4P A;  4L1F A;  2E0A A;  4NXL A;  3NF4 A;  2GBB A;  1EGD A;  1K8T A;  1QDB A;  2CJ4 A;  2R0M A;  2ZAF A;  4HKR A;  1PK0 A;  4RM7 A;  2YYJ A;  1RP3 A;  2R03 A;  1XFW A;  2CJ6 A;  3X29 A;  4DOY A;  5K3H A;  2WBI A;  3TOR A;  2VIG A;  3D9G A;  4HKS A;  4Q4U A;  2AO2 A;  1LVC A;  4H85 A;  2REH A;  4W9U A;  1GJV A;  4KS9 A;  5B5V A;  3TZ0 A;  4Q17 A;  3BNG A;  3AFE A;  4HR3 A;  1R2J A;  2LFW A;  5GJW E;  3SF6 A;  1JM6 A;  3X0X A;  2CJ5 A;  2RFQ A;  2IX5 A;  3R7K A;  2BU2 A;  5BRK A;  4XVX A;  3D1I A;  2EBA A;  4FZ4 A;  3SXQ A;  2UXW A;  2ZKJ A;  3CRK A;  4DZY A;  5B5W A;  3Q0A A;  1RJ4 A;  2OEX A;  3CRL A;  2BU8 A;  4KCF A;  4X28 C;  1EGE A;  2OJQ A;  4JIZ A;  5B6B A;  3B96 A;  3TTB A;  4E00 A;  3MPI A;  1S26 A;  3X0Y A;  1W07 A;  2FON A;  3TZ2 A;  4AKH A;  4IV6 A;  3MKH A;  2EBF X;  2AZE A;  2OT4 A;  1SC5 A;  2HJN A;  3MPJ A;  2XS8 A;  2YYM A;  3S7W A;  4JIO A;  4FF3 A;  1SIR A;  1K90 A;  2E80 A;  3D9E A;  4IRN A;  3M9V A;  2A1T A;  3BNH A;  4Q0T A;  2YYK A;  2PNR A;  1BUC A;  1RX0 A;  4N5F A;  1XFX A;  2ZDX A;  4L3Y A;  1UDY A;  4FF2 A;  1UKW A;  4V26 A;  5J71 A;  3Q22 A;  1X91 A;  4QIC A;  3SCE A;  5K3G A;  2YGW A;  2F6L A;  1R3B A;  2BU6 A;  3UU9 A;  1Y0V A;  4M9A A;  3VKH A;  4FF1 A;  2C0U A;  1FS7 A;  2C12 A;  2RF7 A;  3RKH A;  4P13 A;  2DVL A;  2YYI A;  4MP2 A; 
#chains in the Genus database with same CATH homology
 1XFY A;  3Q23 A;  2VF1 A;  4FF4 A;  2FP1 A;  3N0R A;  4AKG A;  1S26 A;  1XFV A;  2EBH X;  3CE2 A;  3C46 A;  4KSF A;  4AKH A;  2GBB A;  2FP2 A;  1K8T A;  2EBF X;  4HKR A;  2AZE A;  1PK0 A;  3Q24 A;  1K93 A;  1SC5 A;  3KML A;  4AKI A;  1RP3 A;  4KSA A;  1SK6 A;  4F0X A;  3C2P A;  1XFW A;  3X29 A;  4FF3 A;  1K90 A;  2EC5 A;  4HKS A;  2AO2 A;  1LVC A;  2QR4 A;  2PO4 A;  4G97 A;  1XFX A;  4KS9 A;  3C3L A;  4FF2 A;  1XFU A;  5GJW E;  1XFZ A;  2LFW A;  3Q22 A;  4QIC A;  2YGW A;  4P79 A;  2F6L A;  3VKH A;  1Y0V A;  4FF1 A;  3VKG A;  4FZ4 A;  4AI6 A;  5GJV E;  3Q0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...