5GJWE

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
166
Chain Sequence
MSPTEAPKVRVTLFCILVGIVLAMTAVVSDHWAVLSPHCEAAHFGLWRICTKRGEKNCSYFSISAAAISVFSLGFLIMGTICALMAFRKKRDYLLRPASMFYVFAGLCLFVSLEVMRQSVKRMIEYYYSWSFACACAAFVLLFLGGISLLLFSLPRMPQNPWESCM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 44
structure length 166
sequence length 216
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13903 Claudin_2 PMP-22/EMP/MP20/Claudin tight junction
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.150 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 5gjwE00
5GJVE 3X29A 4P79A 5GJWE
chains in the Genus database with same CATH superfamily
2R0MA 4FF1A 2LFWA 4O5MA 3N0RA 1SIQA 4H7QA 2Z1QA 1XG2B 4FZ4A 3MKHA 1GU6A 3PFDA 5M4KA 3TZ5A 3C3LA 3F29A 2IX5A 3TTBA 3LG1A 5M4NA 2PO4A 3MMOA 3FCJA 4JEKA 3II9A 5GJWE 2EC5A 3OWAA 5K3GA 1X8ZA 1SIRA 3C2PA 3EONA 2CJ5A 2PG0A 2EBAA 2CJ4A 2JBRA 1WS9A 2YYMA 4DOYA 1R2JA 4P13A 3VADA 4J1VA 1Y8PA 3GNCA 4NXLA 5K3JA 3HWCA 2REHA 4LQQB 1XFWA 5M4MA 4MP7A 2C0UA 1RJ1A 2QR4A 1UDYA 3BNGA 4Q4UA 3R7KA 3VKHA 4IRNA 1JQIA 3VKGA 3FO3A 1X91A 2Q8FA 4QICA 1Y8OA 2BU7A 2XS1A 3X29A 2YYIA 4MP2A 3X0YA 2BU8A 2R02A 4XVXA 4AKIA 2EBHX 3BNJA 3BNFA 3GQTA 2OR0A 4HR3A 1XFXA 4V26A 2ZDXA 3MXLA 4KSFA 2FP2A 5B5VA 2FP1A 5J71A 4AI6A 4G97A 1U8VA 2PNRA 2R03A 3Q22A 2E80A 2DVLA 3M9VA 4E00A 1S26A 4F0XA 1OAHA 3SXQA 4JIZA 2WBIA 4N5FA 1IS2A 4KCFA 4L1FA 4LQSB 4M9AA 4L3YA 1FS8A 4MPEA 3TORA 2ZO5A 3UU9A 4Q17A 5GJVE 3Q0AA 4L3ZA 2JIFA 5K3IA 5B6BA 2J7AA 2GBBA 2Q8GA 2BTZA 3D9GA 3RKHA 3P4TA 2JBTA 2E0AA 1K93A 2IX6A 2YYKA 2YYGA 1GJVA 2ZAFA 4E02A 2C12A 1GKXA 2YYLA 3LGQA 2R0NA 2XQRB 4IV6A 1W07A 3AFEA 1K8TA 3D2RA 3KMLA 1EGDA 4ZYJA 1UKWA 2VF1A 3MDDA 3Q24A 3TZ4A 2Q8IA 2UXWA 3CRKA 1PI1A 4WJYA 2CJ8A 5BRKA 4AKGA 2JBSA 2YGWA 2OEVA 1K90A 3L1TA 4V25A 2FONA 4E01A 3D6BA 2RF7A 1EGCA 5B5WA 3OIBA 4Q1OA 2ZKJA 1QDBA 4JIOA 2A1TA 4OO2A 4P79A 4U83A 3TZ0A 5K3HA 1JM6A 3OWMA 1RJ4A 4HKRA 3C46A 2DDHA 4KS9A 4G5EA 2D29A 3MDEA 2CJ7A 3X0XA 4FF4A 3MPIA 1FS9A 4Q5CA 4HKSA 1GKZA 1PK0A 1IVHA 1EGEA 3TZ2A 1XFYA 4FF3A 3CRLA 4AKHA 1T9GA 2CJ6A 3CE2A 2VR0A 4W9UA 4DZYA 3SF6A 2AZEA 4MPNA 1XFZA 4MPCA 1RP3A 1XFVA 4KTOA 1Y0VA 1R3BA 1X90A 2AO2A 2F6LA 4KSAA 2VIGA 5BRMA 3S7WA 2YYJA 1BUCA 1SC5A 2ZDYA 4X28C 2OJQA 2RFQA 4FF2A 2BU6A 1XFUA 3AFFA 3D9FA 4H81A 5J6AA 2CX9A 4Q0TA 3D1IA 3SCEA 3SWOA 1RX0A 2EBFX 4ZXVA 2BU2A 3Q23A 1FS7A 4L3XA 5M4PA 2HJNA 4RM7A 2Q8HA 3UBRA 1SK6A 2OEXA 2RDZA 3BNHA 3EOMA 3MPJA 4L38A 2BU5A 3B96A 3D9EA 3D9DA 3GM6A 4H85A 1Y8NA 4Q5BA 2E81A 2XS8A 4X28A 2OT4A 1LVCA 3NF4A 2R05A
chains in the Genus database with same CATH topology
1XFYA 2VF1A 2EBHX 4FF1A 4FF3A 2LFWA 3CE2A 4AKHA 3N0RA 2AZEA 4FZ4A 1XFXA 1XFZA 4KSFA 2FP2A 1XFVA 1RP3A 3C3LA 2FP1A 4AKGA 1Y0VA 2AO2A 1K90A 2YGWA 2F6LA 2PO4A 4KSAA 4AI6A 4G97A 3Q22A 5GJWE 1SC5A 4FF2A 3Q24A 1S26A 2EC5A 4F0XA 1XFUA 3C2PA 4P79A 3Q0AA 2EBFX 5GJVE 4HKRA 3Q23A 3C46A 2GBBA 4KS9A 1XFWA 1SK6A 1K93A 2QR4A 4FF4A 3VKHA 4HKSA 4AKIA 3VKGA 1PK0A 4QICA 1LVCA 3X29A 3KMLA 1K8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJV E;  3X29 A;  4P79 A;  5GJW E; 
#chains in the Genus database with same CATH topology
 2R0M A;  4FF1 A;  2LFW A;  4O5M A;  3N0R A;  1SIQ A;  4H7Q A;  2Z1Q A;  1XG2 B;  4FZ4 A;  3MKH A;  1GU6 A;  3PFD A;  5M4K A;  3TZ5 A;  3C3L A;  3F29 A;  2IX5 A;  3TTB A;  3LG1 A;  5M4N A;  2PO4 A;  3MMO A;  3FCJ A;  4JEK A;  3II9 A;  5GJW E;  2EC5 A;  3OWA A;  5K3G A;  1X8Z A;  1SIR A;  3C2P A;  3EON A;  2CJ5 A;  2PG0 A;  2EBA A;  2CJ4 A;  2JBR A;  1WS9 A;  2YYM A;  4DOY A;  1R2J A;  4P13 A;  3VAD A;  4J1V A;  1Y8P A;  3GNC A;  4NXL A;  5K3J A;  3HWC A;  2REH A;  4LQQ B;  1XFW A;  5M4M A;  4MP7 A;  2C0U A;  1RJ1 A;  2QR4 A;  1UDY A;  3BNG A;  4Q4U A;  3R7K A;  3VKH A;  4IRN A;  1JQI A;  3VKG A;  3FO3 A;  1X91 A;  2Q8F A;  4QIC A;  1Y8O A;  2BU7 A;  2XS1 A;  3X29 A;  2YYI A;  4MP2 A;  3X0Y A;  2BU8 A;  2R02 A;  4XVX A;  4AKI A;  2EBH X;  3BNJ A;  3BNF A;  3GQT A;  2OR0 A;  4HR3 A;  1XFX A;  4V26 A;  2ZDX A;  3MXL A;  4KSF A;  2FP2 A;  5B5V A;  2FP1 A;  5J71 A;  4AI6 A;  4G97 A;  1U8V A;  2PNR A;  2R03 A;  3Q22 A;  2E80 A;  2DVL A;  3M9V A;  4E00 A;  1S26 A;  4F0X A;  1OAH A;  3SXQ A;  4JIZ A;  2WBI A;  4N5F A;  1IS2 A;  4KCF A;  4L1F A;  4LQS B;  4M9A A;  4L3Y A;  1FS8 A;  4MPE A;  3TOR A;  2ZO5 A;  3UU9 A;  4Q17 A;  5GJV E;  3Q0A A;  4L3Z A;  2JIF A;  5K3I A;  5B6B A;  2J7A A;  2GBB A;  2Q8G A;  2BTZ A;  3D9G A;  3RKH A;  3P4T A;  2JBT A;  2E0A A;  1K93 A;  2IX6 A;  2YYK A;  2YYG A;  1GJV A;  2ZAF A;  4E02 A;  2C12 A;  1GKX A;  2YYL A;  3LGQ A;  2R0N A;  2XQR B;  4IV6 A;  1W07 A;  3AFE A;  1K8T A;  3D2R A;  3KML A;  1EGD A;  4ZYJ A;  1UKW A;  2VF1 A;  3MDD A;  3Q24 A;  3TZ4 A;  2Q8I A;  2UXW A;  3CRK A;  1PI1 A;  4WJY A;  2CJ8 A;  5BRK A;  4AKG A;  2JBS A;  2YGW A;  2OEV A;  1K90 A;  3L1T A;  4V25 A;  2FON A;  4E01 A;  3D6B A;  2RF7 A;  1EGC A;  5B5W A;  3OIB A;  4Q1O A;  2ZKJ A;  1QDB A;  4JIO A;  2A1T A;  4OO2 A;  4P79 A;  4U83 A;  3TZ0 A;  5K3H A;  1JM6 A;  3OWM A;  1RJ4 A;  4HKR A;  3C46 A;  2DDH A;  4KS9 A;  4G5E A;  2D29 A;  3MDE A;  2CJ7 A;  3X0X A;  4FF4 A;  3MPI A;  1FS9 A;  4Q5C A;  4HKS A;  1GKZ A;  1PK0 A;  1IVH A;  1EGE A;  3TZ2 A;  1XFY A;  4FF3 A;  3CRL A;  4AKH A;  1T9G A;  2CJ6 A;  3CE2 A;  2VR0 A;  4W9U A;  4DZY A;  3SF6 A;  2AZE A;  4MPN A;  1XFZ A;  4MPC A;  1RP3 A;  1XFV A;  4KTO A;  1Y0V A;  1R3B A;  1X90 A;  2AO2 A;  2F6L A;  4KSA A;  2VIG A;  5BRM A;  3S7W A;  2YYJ A;  1BUC A;  1SC5 A;  2ZDY A;  4X28 C;  2OJQ A;  2RFQ A;  4FF2 A;  2BU6 A;  1XFU A;  3AFF A;  3D9F A;  4H81 A;  5J6A A;  2CX9 A;  4Q0T A;  3D1I A;  3SCE A;  3SWO A;  1RX0 A;  2EBF X;  4ZXV A;  2BU2 A;  3Q23 A;  1FS7 A;  4L3X A;  5M4P A;  2HJN A;  4RM7 A;  2Q8H A;  3UBR A;  1SK6 A;  2OEX A;  2RDZ A;  3BNH A;  3EOM A;  3MPJ A;  4L38 A;  2BU5 A;  3B96 A;  3D9E A;  3D9D A;  3GM6 A;  4H85 A;  1Y8N A;  4Q5B A;  2E81 A;  2XS8 A;  4X28 A;  2OT4 A;  1LVC A;  3NF4 A;  2R05 A; 
#chains in the Genus database with same CATH homology
 1XFY A;  2VF1 A;  2EBH X;  4FF1 A;  4FF3 A;  2LFW A;  3CE2 A;  4AKH A;  3N0R A;  2AZE A;  4FZ4 A;  1XFX A;  1XFZ A;  4KSF A;  2FP2 A;  1XFV A;  1RP3 A;  3C3L A;  2FP1 A;  4AKG A;  1Y0V A;  2AO2 A;  1K90 A;  2YGW A;  2F6L A;  2PO4 A;  4KSA A;  4AI6 A;  4G97 A;  3Q22 A;  5GJW E;  1SC5 A;  4FF2 A;  3Q24 A;  1S26 A;  2EC5 A;  4F0X A;  1XFU A;  3C2P A;  4P79 A;  3Q0A A;  2EBF X;  5GJV E;  4HKR A;  3Q23 A;  3C46 A;  2GBB A;  4KS9 A;  1XFW A;  1SK6 A;  1K93 A;  2QR4 A;  4FF4 A;  3VKH A;  4HKS A;  4AKI A;  3VKG A;  1PK0 A;  4QIC A;  1LVC A;  3X29 A;  3KML A;  1K8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...