5GJWE

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
166
Chain Sequence
MSPTEAPKVRVTLFCILVGIVLAMTAVVSDHWAVLSPHCEAAHFGLWRICTKRGEKNCSYFSISAAAISVFSLGFLIMGTICALMAFRKKRDYLLRPASMFYVFAGLCLFVSLEVMRQSVKRMIEYYYSWSFACACAAFVLLFLGGISLLLFSLPRMPQNPWESCM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 44
structure length 166
sequence length 216
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13903 Claudin_2 PMP-22/EMP/MP20/Claudin tight junction
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.150 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 5gjwE00
5GJWE 4P79A 5GJVE 3X29A
chains in the Genus database with same CATH superfamily
4JIZA 1Y0VA 2RF7A 4G97A 5GJVE 4HKSA 2YYLA 2A1TA 3KMLA 4X28A 1IVHA 3Q24A 1XFVA 4H7QA 3GQTA 5M4KA 2OJQA 1S26A 4AI6A 1X8ZA 3D9DA 3MKHA 3CE2A 2XQRB 4HKRA 1IS2A 1XFUA 1RJ4A 2YYIA 2AO2A 2RDZA 3TZ0A 3CRKA 1EGDA 3PFDA 4Q17A 3OIBA 1K90A 3TTBA 5M4NA 1GKXA 1K8TA 1SIRA 1W07A 2REHA 2BU6A 4DZYA 2VIGA 4Q1OA 1GKZA 3OWMA 3X0YA 2FP1A 2YYJA 2ZDXA 2Q8HA 2EBHX 3MXLA 2YGWA 4WJYA 4L3YA 2Q8FA 1GJVA 4X28C 4FF1A 4AKIA 4JEKA 1X90A 4MP2A 1QDBA 4KCFA 3TZ2A 2RFQA 2WBIA 2QR4A 4LQQB 2OEVA 3MMOA 3EOMA 3SCEA 3NF4A 4AKGA 3R7KA 4E01A 2JBSA 2ZDYA 3LG1A 5J71A 4MPCA 1SIQA 3TZ4A 2AZEA 4O5MA 1R3BA 5BRMA 1BUCA 2CJ4A 2BU8A 2R0MA 3HWCA 1XG2B 1Y8PA 3UBRA 4LQSB 2J7AA 3X0XA 3C2PA 3BNHA 3L1TA 3D9FA 4L1FA 2PNRA 1SC5A 4G5EA 4M9AA 2CJ8A 5J6AA 1PK0A 2E81A 4OO2A 2EBFX 4L3XA 3UU9A 2EBAA 1Y8NA 1OAHA 2BTZA 4KTOA 4FZ4A 3RKHA 3GNCA 2Q8IA 3Q23A 1EGEA 2HJNA 2PG0A 2XS1A 2R03A 4U83A 2C12A 2F6LA 3D6BA 2GBBA 3CRLA 3TORA 3C46A 2OT4A 2BU2A 1XFXA 2E80A 1RJ1A 3MDDA 4QICA 3FO3A 2C0UA 4ZYJA 2CJ6A 2UXWA 4FF3A 2CJ5A 3D9EA 3LGQA 4FF4A 4RM7A 1JQIA 1UDYA 1XFWA 1GU6A 2PO4A 3B96A 3N0RA 4J1VA 4KSAA 3D1IA 5B6BA 2JBTA 2Z1QA 4L3ZA 2VR0A 1R2JA 3M9VA 5K3JA 5M4PA 5K3HA 2R05A 4NXLA 4Q4UA 2ZKJA 4XVXA 4V26A 2ZO5A 3BNJA 2EC5A 3OWAA 3VADA 2VF1A 5K3GA 4N5FA 4F0XA 2BU7A 1LVCA 4AKHA 4E00A 3MPJA 2E0AA 3II9A 1SK6A 4MPEA 4P79A 2CX9A 3X29A 3D2RA 1FS8A 2D29A 3VKHA 1Y8OA 2OR0A 1XFZA 3SF6A 1K93A 1RX0A 1X91A 2CJ7A 2OEXA 4IRNA 1UKWA 4ZXVA 5B5VA 3Q22A 3MPIA 2LFWA 5M4MA 4V25A 4Q5BA 2YYMA 3F29A 4L38A 5B5WA 4MPNA 2ZAFA 2FP2A 2XS8A 4KS9A 1EGCA 2DVLA 3Q0AA 4IV6A 4H81A 2JBRA 4HR3A 4KSFA 4E02A 4DOYA 3MDEA 3SWOA 3AFEA 3AFFA 3SXQA 2IX5A 1FS7A 5GJWE 3VKGA 1T9GA 1U8VA 2Q8GA 1RP3A 2YYKA 3BNFA 3P4TA 1PI1A 5K3IA 1FS9A 2R02A 4H85A 3S7WA 2DDHA 3BNGA 1XFYA 2JIFA 1JM6A 5BRKA 4JIOA 2YYGA 3EONA 3D9GA 3GM6A 2IX6A 3C3LA 1WS9A 2FONA 2BU5A 4MP7A 4W9UA 4FF2A 2R0NA 3FCJA 4P13A 4Q5CA 3TZ5A 4Q0TA
chains in the Genus database with same CATH topology
3Q22A 4QICA 1Y0VA 2LFWA 4G97A 5GJVE 4HKSA 4AKGA 4FF3A 3KMLA 3Q24A 4FF4A 1XFVA 2AZEA 2FP2A 1XFWA 2PO4A 1S26A 3N0RA 4KS9A 4KSAA 4AI6A 3Q0AA 3CE2A 4KSFA 4HKRA 1XFUA 2AO2A 3C2PA 5GJWE 3VKGA 1K90A 1SC5A 1RP3A 1K8TA 1PK0A 2EC5A 2VF1A 2EBFX 4F0XA 1LVCA 4AKHA 2FP1A 4FZ4A 1XFYA 1SK6A 2EBHX 4P79A 2YGWA 3X29A 3Q23A 4FF1A 4AKIA 3C46A 2F6LA 2GBBA 3C3LA 3VKHA 1XFZA 4FF2A 1K93A 2QR4A 1XFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJW E;  4P79 A;  5GJV E;  3X29 A; 
#chains in the Genus database with same CATH topology
 4JIZ A;  1Y0V A;  2RF7 A;  4G97 A;  5GJV E;  4HKS A;  2YYL A;  2A1T A;  3KML A;  4X28 A;  1IVH A;  3Q24 A;  1XFV A;  4H7Q A;  3GQT A;  5M4K A;  2OJQ A;  1S26 A;  4AI6 A;  1X8Z A;  3D9D A;  3MKH A;  3CE2 A;  2XQR B;  4HKR A;  1IS2 A;  1XFU A;  1RJ4 A;  2YYI A;  2AO2 A;  2RDZ A;  3TZ0 A;  3CRK A;  1EGD A;  3PFD A;  4Q17 A;  3OIB A;  1K90 A;  3TTB A;  5M4N A;  1GKX A;  1K8T A;  1SIR A;  1W07 A;  2REH A;  2BU6 A;  4DZY A;  2VIG A;  4Q1O A;  1GKZ A;  3OWM A;  3X0Y A;  2FP1 A;  2YYJ A;  2ZDX A;  2Q8H A;  2EBH X;  3MXL A;  2YGW A;  4WJY A;  4L3Y A;  2Q8F A;  1GJV A;  4X28 C;  4FF1 A;  4AKI A;  4JEK A;  1X90 A;  4MP2 A;  1QDB A;  4KCF A;  3TZ2 A;  2RFQ A;  2WBI A;  2QR4 A;  4LQQ B;  2OEV A;  3MMO A;  3EOM A;  3SCE A;  3NF4 A;  4AKG A;  3R7K A;  4E01 A;  2JBS A;  2ZDY A;  3LG1 A;  5J71 A;  4MPC A;  1SIQ A;  3TZ4 A;  2AZE A;  4O5M A;  1R3B A;  5BRM A;  1BUC A;  2CJ4 A;  2BU8 A;  2R0M A;  3HWC A;  1XG2 B;  1Y8P A;  3UBR A;  4LQS B;  2J7A A;  3X0X A;  3C2P A;  3BNH A;  3L1T A;  3D9F A;  4L1F A;  2PNR A;  1SC5 A;  4G5E A;  4M9A A;  2CJ8 A;  5J6A A;  1PK0 A;  2E81 A;  4OO2 A;  2EBF X;  4L3X A;  3UU9 A;  2EBA A;  1Y8N A;  1OAH A;  2BTZ A;  4KTO A;  4FZ4 A;  3RKH A;  3GNC A;  2Q8I A;  3Q23 A;  1EGE A;  2HJN A;  2PG0 A;  2XS1 A;  2R03 A;  4U83 A;  2C12 A;  2F6L A;  3D6B A;  2GBB A;  3CRL A;  3TOR A;  3C46 A;  2OT4 A;  2BU2 A;  1XFX A;  2E80 A;  1RJ1 A;  3MDD A;  4QIC A;  3FO3 A;  2C0U A;  4ZYJ A;  2CJ6 A;  2UXW A;  4FF3 A;  2CJ5 A;  3D9E A;  3LGQ A;  4FF4 A;  4RM7 A;  1JQI A;  1UDY A;  1XFW A;  1GU6 A;  2PO4 A;  3B96 A;  3N0R A;  4J1V A;  4KSA A;  3D1I A;  5B6B A;  2JBT A;  2Z1Q A;  4L3Z A;  2VR0 A;  1R2J A;  3M9V A;  5K3J A;  5M4P A;  5K3H A;  2R05 A;  4NXL A;  4Q4U A;  2ZKJ A;  4XVX A;  4V26 A;  2ZO5 A;  3BNJ A;  2EC5 A;  3OWA A;  3VAD A;  2VF1 A;  5K3G A;  4N5F A;  4F0X A;  2BU7 A;  1LVC A;  4AKH A;  4E00 A;  3MPJ A;  2E0A A;  3II9 A;  1SK6 A;  4MPE A;  4P79 A;  2CX9 A;  3X29 A;  3D2R A;  1FS8 A;  2D29 A;  3VKH A;  1Y8O A;  2OR0 A;  1XFZ A;  3SF6 A;  1K93 A;  1RX0 A;  1X91 A;  2CJ7 A;  2OEX A;  4IRN A;  1UKW A;  4ZXV A;  5B5V A;  3Q22 A;  3MPI A;  2LFW A;  5M4M A;  4V25 A;  4Q5B A;  2YYM A;  3F29 A;  4L38 A;  5B5W A;  4MPN A;  2ZAF A;  2FP2 A;  2XS8 A;  4KS9 A;  1EGC A;  2DVL A;  3Q0A A;  4IV6 A;  4H81 A;  2JBR A;  4HR3 A;  4KSF A;  4E02 A;  4DOY A;  3MDE A;  3SWO A;  3AFE A;  3AFF A;  3SXQ A;  2IX5 A;  1FS7 A;  5GJW E;  3VKG A;  1T9G A;  1U8V A;  2Q8G A;  1RP3 A;  2YYK A;  3BNF A;  3P4T A;  1PI1 A;  5K3I A;  1FS9 A;  2R02 A;  4H85 A;  3S7W A;  2DDH A;  3BNG A;  1XFY A;  2JIF A;  1JM6 A;  5BRK A;  4JIO A;  2YYG A;  3EON A;  3D9G A;  3GM6 A;  2IX6 A;  3C3L A;  1WS9 A;  2FON A;  2BU5 A;  4MP7 A;  4W9U A;  4FF2 A;  2R0N A;  3FCJ A;  4P13 A;  4Q5C A;  3TZ5 A;  4Q0T A; 
#chains in the Genus database with same CATH homology
 3Q22 A;  4QIC A;  1Y0V A;  2LFW A;  4G97 A;  5GJV E;  4HKS A;  4AKG A;  4FF3 A;  3KML A;  3Q24 A;  4FF4 A;  1XFV A;  2AZE A;  2FP2 A;  1XFW A;  2PO4 A;  1S26 A;  3N0R A;  4KS9 A;  4KSA A;  4AI6 A;  3Q0A A;  3CE2 A;  4KSF A;  4HKR A;  1XFU A;  2AO2 A;  3C2P A;  5GJW E;  3VKG A;  1K90 A;  1SC5 A;  1RP3 A;  1K8T A;  1PK0 A;  2EC5 A;  2VF1 A;  2EBF X;  4F0X A;  1LVC A;  4AKH A;  2FP1 A;  4FZ4 A;  1XFY A;  1SK6 A;  2EBH X;  4P79 A;  2YGW A;  3X29 A;  3Q23 A;  4FF1 A;  4AKI A;  3C46 A;  2F6L A;  2GBB A;  3C3L A;  3VKH A;  1XFZ A;  4FF2 A;  1K93 A;  2QR4 A;  1XFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...