5GJWE

Structure of the mammalian voltage-gated calcium channel cav1.1 complex for classii map
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
216
structure length
166
Chain Sequence
MSPTEAPKVRVTLFCILVGIVLAMTAVVSDHWAVLSPHCEAAHFGLWRICTKRGEKNCSYFSISAAAISVFSLGFLIMGTICALMAFRKKRDYLLRPASMFYVFAGLCLFVSLEVMRQSVKRMIEYYYSWSFACACAAFVLLFLGGISLLLFSLPRMPQNPWESCM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-dependent L-type calcium channel subunit alpha-1S
publication title Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Membrane protein
total genus 44
structure length 166
sequence length 216
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF13903 Claudin_2 PMP-22/EMP/MP20/Claudin tight junction
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.150 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 5gjwE00
4P79A 5GJWE 5GJVE 3X29A
chains in the Genus database with same CATH superfamily
2E81A 3Q22A 2EBHX 1K93A 2CJ4A 4MPEA 2ZDXA 4RM7A 4V25A 1RP3A 2YYJA 2REHA 2CJ8A 5M4KA 2AZEA 1X91A 1SC5A 3HWCA 3MXLA 3FO3A 4NXLA 5B5VA 3UBRA 4FF2A 4P79A 2VR0A 4H81A 2OEXA 2YYMA 4QICA 4KTOA 4Q1OA 1RJ4A 4O5MA 3S7WA 2YYKA 3AFEA 3D6BA 3GM6A 4KCFA 4XVXA 4JIOA 3Q0AA 1SIRA 2E80A 2ZKJA 4L3ZA 2QR4A 3SF6A 3TORA 2FP1A 2PNRA 2YYGA 5J71A 5M4NA 1X8ZA 2OEVA 2R02A 4L3XA 2Q8HA 2IX5A 3N0RA 2ZDYA 1XFWA 3BNHA 3SCEA 1SK6A 2CX9A 4JIZA 4ZXVA 1EGEA 2LFWA 2D29A 3CRLA 3OWAA 2CJ7A 2OR0A 3D9EA 2R03A 4DZYA 4E00A 2JBTA 4U83A 2JBSA 2JIFA 5GJVE 3GNCA 3LG1A 4M9AA 1FS9A 2J7AA 2XS8A 2XQRB 2BU8A 2XS1A 3TZ4A 1Y8OA 1Y8PA 1XFYA 2BU5A 2ZO5A 2GBBA 3D9FA 3MPIA 1IVHA 2BTZA 1GKZA 3FCJA 4Q5BA 1XFXA 2IX6A 4W9UA 5K3HA 1K90A 3LGQA 4OO2A 4V26A 3VKGA 2HJNA 1XFZA 4H85A 4L1FA 3Q23A 3RKHA 4AKIA 4AKGA 4AKHA 1GJVA 4WJYA 4Q5CA 5BRMA 4DOYA 2VF1A 4FF4A 2PG0A 5GJWE 3D2RA 3SWOA 3PFDA 3Q24A 1QDBA 2A1TA 2YYIA 1T9GA 3MKHA 1Y0VA 1GU6A 2JBRA 2EC5A 4FF1A 3NF4A 1Y8NA 1GKXA 4Q17A 1JQIA 4AI6A 2YYLA 2CJ5A 1U8VA 2C0UA 1UDYA 4FZ4A 4H7QA 3TZ0A 4E02A 1OAHA 1W07A 1XG2B 2CJ6A 4MPNA 3SXQA 4MP7A 4KSAA 3B96A 2VIGA 2EBAA 2FP2A 4E01A 5M4MA 4X28A 3X0YA 2PO4A 4Q0TA 1BUCA 4MP2A 5J6AA 3P4TA 1JM6A 2F6LA 3BNFA 2AO2A 3X0XA 2R0NA 1RJ1A 3L1TA 3C2PA 2DVLA 3D9GA 1UKWA 4HKRA 5B6BA 2RFQA 3CE2A 2EBFX 2BU2A 1FS8A 2R05A 4L3YA 4KSFA 2YGWA 5BRKA 2E0AA 3CRKA 4P13A 1R3BA 3TTBA 3GQTA 3MDDA 3MPJA 2Q8GA 4J1VA 1K8TA 4F0XA 4ZYJA 5M4PA 1EGDA 2RDZA 2Z1QA 2ZAFA 3TZ2A 4FF3A 1PK0A 2FONA 4LQQB 4LQSB 3R7KA 4IRNA 3OIBA 2Q8FA 2DDHA 3X29A 3C3LA 1RX0A 1X90A 1XFVA 4N5FA 4IV6A 3KMLA 2Q8IA 3D1IA 1R2JA 2UXWA 1SIQA 3BNJA 2OJQA 3F29A 3M9VA 5K3JA 4HKSA 1WS9A 4KS9A 4HR3A 3TZ5A 3MMOA 2C12A 4L38A 4X28C 2WBIA 3MDEA 4MPCA 1XFUA 3BNGA 4Q4UA 5K3GA 3C46A 3OWMA 2BU7A 4JEKA 3D9DA 3EONA 2RF7A 4G97A 3EOMA 4G5EA 3VADA 3VKHA 1EGCA 1PI1A 2BU6A 3AFFA 2OT4A 1LVCA 1S26A 3UU9A 1FS7A 1IS2A 5K3IA 2R0MA 3II9A 5B5WA
chains in the Genus database with same CATH topology
3Q22A 2EBHX 4FZ4A 4FF3A 1K93A 1PK0A 5GJVE 1RP3A 4KSAA 3C3LA 3X29A 2AZEA 1XFVA 1SC5A 2FP2A 4FF2A 1XFYA 3KMLA 2GBBA 2PO4A 4P79A 1XFXA 3VKGA 1K90A 4QICA 2F6LA 2AO2A 1XFZA 4HKSA 4KS9A 3Q23A 4AKIA 4AKGA 4AKHA 3C2PA 4FF4A 2VF1A 4HKRA 5GJWE 3Q0AA 2QR4A 3CE2A 2EBFX 2FP1A 1XFUA 3C46A 4KSFA 2YGWA 3Q24A 3N0RA 3VKHA 4G97A 1XFWA 1Y0VA 4FF1A 2EC5A 1SK6A 1K8TA 1LVCA 1S26A 4F0XA 2LFWA 4AI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P79 A;  5GJW E;  5GJV E;  3X29 A; 
#chains in the Genus database with same CATH topology
 2E81 A;  3Q22 A;  2EBH X;  1K93 A;  2CJ4 A;  4MPE A;  2ZDX A;  4RM7 A;  4V25 A;  1RP3 A;  2YYJ A;  2REH A;  2CJ8 A;  5M4K A;  2AZE A;  1X91 A;  1SC5 A;  3HWC A;  3MXL A;  3FO3 A;  4NXL A;  5B5V A;  3UBR A;  4FF2 A;  4P79 A;  2VR0 A;  4H81 A;  2OEX A;  2YYM A;  4QIC A;  4KTO A;  4Q1O A;  1RJ4 A;  4O5M A;  3S7W A;  2YYK A;  3AFE A;  3D6B A;  3GM6 A;  4KCF A;  4XVX A;  4JIO A;  3Q0A A;  1SIR A;  2E80 A;  2ZKJ A;  4L3Z A;  2QR4 A;  3SF6 A;  3TOR A;  2FP1 A;  2PNR A;  2YYG A;  5J71 A;  5M4N A;  1X8Z A;  2OEV A;  2R02 A;  4L3X A;  2Q8H A;  2IX5 A;  3N0R A;  2ZDY A;  1XFW A;  3BNH A;  3SCE A;  1SK6 A;  2CX9 A;  4JIZ A;  4ZXV A;  1EGE A;  2LFW A;  2D29 A;  3CRL A;  3OWA A;  2CJ7 A;  2OR0 A;  3D9E A;  2R03 A;  4DZY A;  4E00 A;  2JBT A;  4U83 A;  2JBS A;  2JIF A;  5GJV E;  3GNC A;  3LG1 A;  4M9A A;  1FS9 A;  2J7A A;  2XS8 A;  2XQR B;  2BU8 A;  2XS1 A;  3TZ4 A;  1Y8O A;  1Y8P A;  1XFY A;  2BU5 A;  2ZO5 A;  2GBB A;  3D9F A;  3MPI A;  1IVH A;  2BTZ A;  1GKZ A;  3FCJ A;  4Q5B A;  1XFX A;  2IX6 A;  4W9U A;  5K3H A;  1K90 A;  3LGQ A;  4OO2 A;  4V26 A;  3VKG A;  2HJN A;  1XFZ A;  4H85 A;  4L1F A;  3Q23 A;  3RKH A;  4AKI A;  4AKG A;  4AKH A;  1GJV A;  4WJY A;  4Q5C A;  5BRM A;  4DOY A;  2VF1 A;  4FF4 A;  2PG0 A;  5GJW E;  3D2R A;  3SWO A;  3PFD A;  3Q24 A;  1QDB A;  2A1T A;  2YYI A;  1T9G A;  3MKH A;  1Y0V A;  1GU6 A;  2JBR A;  2EC5 A;  4FF1 A;  3NF4 A;  1Y8N A;  1GKX A;  4Q17 A;  1JQI A;  4AI6 A;  2YYL A;  2CJ5 A;  1U8V A;  2C0U A;  1UDY A;  4FZ4 A;  4H7Q A;  3TZ0 A;  4E02 A;  1OAH A;  1W07 A;  1XG2 B;  2CJ6 A;  4MPN A;  3SXQ A;  4MP7 A;  4KSA A;  3B96 A;  2VIG A;  2EBA A;  2FP2 A;  4E01 A;  5M4M A;  4X28 A;  3X0Y A;  2PO4 A;  4Q0T A;  1BUC A;  4MP2 A;  5J6A A;  3P4T A;  1JM6 A;  2F6L A;  3BNF A;  2AO2 A;  3X0X A;  2R0N A;  1RJ1 A;  3L1T A;  3C2P A;  2DVL A;  3D9G A;  1UKW A;  4HKR A;  5B6B A;  2RFQ A;  3CE2 A;  2EBF X;  2BU2 A;  1FS8 A;  2R05 A;  4L3Y A;  4KSF A;  2YGW A;  5BRK A;  2E0A A;  3CRK A;  4P13 A;  1R3B A;  3TTB A;  3GQT A;  3MDD A;  3MPJ A;  2Q8G A;  4J1V A;  1K8T A;  4F0X A;  4ZYJ A;  5M4P A;  1EGD A;  2RDZ A;  2Z1Q A;  2ZAF A;  3TZ2 A;  4FF3 A;  1PK0 A;  2FON A;  4LQQ B;  4LQS B;  3R7K A;  4IRN A;  3OIB A;  2Q8F A;  2DDH A;  3X29 A;  3C3L A;  1RX0 A;  1X90 A;  1XFV A;  4N5F A;  4IV6 A;  3KML A;  2Q8I A;  3D1I A;  1R2J A;  2UXW A;  1SIQ A;  3BNJ A;  2OJQ A;  3F29 A;  3M9V A;  5K3J A;  4HKS A;  1WS9 A;  4KS9 A;  4HR3 A;  3TZ5 A;  3MMO A;  2C12 A;  4L38 A;  4X28 C;  2WBI A;  3MDE A;  4MPC A;  1XFU A;  3BNG A;  4Q4U A;  5K3G A;  3C46 A;  3OWM A;  2BU7 A;  4JEK A;  3D9D A;  3EON A;  2RF7 A;  4G97 A;  3EOM A;  4G5E A;  3VAD A;  3VKH A;  1EGC A;  1PI1 A;  2BU6 A;  3AFF A;  2OT4 A;  1LVC A;  1S26 A;  3UU9 A;  1FS7 A;  1IS2 A;  5K3I A;  2R0M A;  3II9 A;  5B5W A; 
#chains in the Genus database with same CATH homology
 3Q22 A;  2EBH X;  4FZ4 A;  4FF3 A;  1K93 A;  1PK0 A;  5GJV E;  1RP3 A;  4KSA A;  3C3L A;  3X29 A;  2AZE A;  1XFV A;  1SC5 A;  2FP2 A;  4FF2 A;  1XFY A;  3KML A;  2GBB A;  2PO4 A;  4P79 A;  1XFX A;  3VKG A;  1K90 A;  4QIC A;  2F6L A;  2AO2 A;  1XFZ A;  4HKS A;  4KS9 A;  3Q23 A;  4AKI A;  4AKG A;  4AKH A;  3C2P A;  4FF4 A;  2VF1 A;  4HKR A;  5GJW E;  3Q0A A;  2QR4 A;  3CE2 A;  2EBF X;  2FP1 A;  1XFU A;  3C46 A;  4KSF A;  2YGW A;  3Q24 A;  3N0R A;  3VKH A;  4G97 A;  1XFW A;  1Y0V A;  4FF1 A;  2EC5 A;  1SK6 A;  1K8T A;  1LVC A;  1S26 A;  4F0X A;  2LFW A;  4AI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...