5BRMA

Structural basis for mob1-dependent activation of the core mst-lats kinase cascade in hippo signaling
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
154
Chain Sequence
DLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOB kinase activator 1A
publication title Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 52
structure length 154
sequence length 160
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5brmA00
5B6BA 5BRKA 5B5WA 2HJNA 4LQQB 4LQSB 4JIZA 4J1VA 1R3BA 5B5VA 5BRMA 1PI1A
chains in the Genus database with same CATH superfamily
4Q5CA 2JBRA 2JBSA 4Q0TA 3Q22A 1XFYA 2IX6A 3EONA 2ZDXA 3D9EA 4Q5BA 5BRMA 1RP3A 1R2JA 4OO2A 2VIGA 2VF1A 1WS9A 4ZXVA 2J7AA 1XFZA 4FF3A 3UBRA 2DDHA 2CJ4A 4MP2A 2OEVA 5M4KA 2HJNA 1X91A 1IS2A 4P13A 3SWOA 2RFQA 2BU2A 3MMOA 3EOMA 4X28A 3VKGA 1K93A 1PI1A 4Q1OA 3D2RA 3M9VA 2EBAA 2QR4A 2DVLA 2OT4A 2BTZA 1RX0A 2E0AA 3SF6A 2BU7A 4L3XA 2EC5A 2ZO5A 3LG1A 4H85A 3TTBA 2FP2A 2JBTA 4P79A 1T9GA 1UKWA 4KTOA 4IRNA 4E00A 1XFVA 2Q8FA 3D9FA 2YYJA 4FZ4A 4NXLA 1K90A 1FS9A 2AZEA 4RM7A 4AKIA 4O5MA 3C3LA 5M4PA 3B96A 4LQQB 1EGEA 1JM6A 1W07A 4HKRA 2EBHX 1GKXA 4F0XA 4FF4A 1Y8OA 3FO3A 2ZDYA 4HR3A 3X0YA 2RF7A 2PNRA 3MDDA 1OAHA 5B6BA 3CRLA 1QDBA 2XQRB 4N5FA 5B5WA 2XS8A 2CX9A 5M4NA 4QICA 1R3BA 5K3HA 4JEKA 4L3YA 4DZYA 3BNJA 2BU5A 4HKSA 4L1FA 3N0RA 3KMLA 3D1IA 4MP7A 2YYMA 3C46A 2BU6A 3MKHA 2IX5A 2OR0A 3GQTA 4FF2A 1Y8NA 5J6AA 3RKHA 3F29A 4E01A 4KSAA 2C0UA 4AI6A 3Q23A 1X8ZA 1GJVA 3VADA 5K3IA 4JIZA 1XFUA 3Q0AA 1PK0A 1XFWA 2VR0A 3BNFA 1JQIA 1SIRA 1XG2B 1EGCA 4H7QA 4JIOA 3TZ4A 3HWCA 3OWMA 4LQSB 3SXQA 3MDEA 2AO2A 3VKHA 1LVCA 3D6BA 2PG0A 1U8VA 2CJ5A 4X28C 4M9AA 1GKZA 3TZ0A 2REHA 5BRKA 4KCFA 3UU9A 2A1TA 2OEXA 3TZ5A 3MPJA 2Z1QA 4H81A 4U83A 2EBFX 3CRKA 4V26A 2FP1A 5B5VA 3C2PA 4AKHA 2R03A 3TZ2A 2YGWA 2YYLA 3D9GA 3GM6A 2R0NA 2E80A 5K3GA 1S26A 2UXWA 3OIBA 2R0MA 3R7KA 1FS8A 1SK6A 2FONA 4G5EA 1Y8PA 2GBBA 1UDYA 2WBIA 1SIQA 4IV6A 4V25A 2LFWA 4WJYA 2Q8IA 4DOYA 1EGDA 3BNGA 2Q8GA 1XFXA 2CJ8A 3X0XA 2Q8HA 2ZKJA 2OJQA 3AFFA 2R05A 4KS9A 3X29A 2C12A 3LGQA 3S7WA 1IVHA 2JIFA 2YYKA 2YYIA 3CE2A 4W9UA 4FF1A 4KSFA 3TORA 3OWAA 3P4TA 1FS7A 1BUCA 3MXLA 5J71A 4AKGA 2E81A 3NF4A 4Q17A 2XS1A 2PO4A 2RDZA 2ZAFA 5GJVE 3II9A 1RJ1A 3D9DA 1Y0VA 2R02A 1K8TA 5M4MA 4MPNA 3SCEA 4G97A 1RJ4A 3FCJA 3L1TA 3BNHA 2D29A 4Q4UA 4E02A 2BU8A 4ZYJA 1X90A 3Q24A 2CJ6A 2F6LA 4MPEA 3AFEA 2YYGA 3MPIA 4L38A 4MPCA 5K3JA 1GU6A 5GJWE 4J1VA 1SC5A 3PFDA 4L3ZA 4XVXA 2CJ7A 3GNCA
chains in the Genus database with same CATH topology
5B6BA 5BRKA 5B5WA 2HJNA 4LQQB 4LQSB 4JIZA 4J1VA 1R3BA 5B5VA 5BRMA 1PI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6B A;  5BRK A;  5B5W A;  2HJN A;  4LQQ B;  4LQS B;  4JIZ A;  4J1V A;  1R3B A;  5B5V A;  5BRM A;  1PI1 A; 
#chains in the Genus database with same CATH topology
 4Q5C A;  2JBR A;  2JBS A;  4Q0T A;  3Q22 A;  1XFY A;  2IX6 A;  3EON A;  2ZDX A;  3D9E A;  4Q5B A;  5BRM A;  1RP3 A;  1R2J A;  4OO2 A;  2VIG A;  2VF1 A;  1WS9 A;  4ZXV A;  2J7A A;  1XFZ A;  4FF3 A;  3UBR A;  2DDH A;  2CJ4 A;  4MP2 A;  2OEV A;  5M4K A;  2HJN A;  1X91 A;  1IS2 A;  4P13 A;  3SWO A;  2RFQ A;  2BU2 A;  3MMO A;  3EOM A;  4X28 A;  3VKG A;  1K93 A;  1PI1 A;  4Q1O A;  3D2R A;  3M9V A;  2EBA A;  2QR4 A;  2DVL A;  2OT4 A;  2BTZ A;  1RX0 A;  2E0A A;  3SF6 A;  2BU7 A;  4L3X A;  2EC5 A;  2ZO5 A;  3LG1 A;  4H85 A;  3TTB A;  2FP2 A;  2JBT A;  4P79 A;  1T9G A;  1UKW A;  4KTO A;  4IRN A;  4E00 A;  1XFV A;  2Q8F A;  3D9F A;  2YYJ A;  4FZ4 A;  4NXL A;  1K90 A;  1FS9 A;  2AZE A;  4RM7 A;  4AKI A;  4O5M A;  3C3L A;  5M4P A;  3B96 A;  4LQQ B;  1EGE A;  1JM6 A;  1W07 A;  4HKR A;  2EBH X;  1GKX A;  4F0X A;  4FF4 A;  1Y8O A;  3FO3 A;  2ZDY A;  4HR3 A;  3X0Y A;  2RF7 A;  2PNR A;  3MDD A;  1OAH A;  5B6B A;  3CRL A;  1QDB A;  2XQR B;  4N5F A;  5B5W A;  2XS8 A;  2CX9 A;  5M4N A;  4QIC A;  1R3B A;  5K3H A;  4JEK A;  4L3Y A;  4DZY A;  3BNJ A;  2BU5 A;  4HKS A;  4L1F A;  3N0R A;  3KML A;  3D1I A;  4MP7 A;  2YYM A;  3C46 A;  2BU6 A;  3MKH A;  2IX5 A;  2OR0 A;  3GQT A;  4FF2 A;  1Y8N A;  5J6A A;  3RKH A;  3F29 A;  4E01 A;  4KSA A;  2C0U A;  4AI6 A;  3Q23 A;  1X8Z A;  1GJV A;  3VAD A;  5K3I A;  4JIZ A;  1XFU A;  3Q0A A;  1PK0 A;  1XFW A;  2VR0 A;  3BNF A;  1JQI A;  1SIR A;  1XG2 B;  1EGC A;  4H7Q A;  4JIO A;  3TZ4 A;  3HWC A;  3OWM A;  4LQS B;  3SXQ A;  3MDE A;  2AO2 A;  3VKH A;  1LVC A;  3D6B A;  2PG0 A;  1U8V A;  2CJ5 A;  4X28 C;  4M9A A;  1GKZ A;  3TZ0 A;  2REH A;  5BRK A;  4KCF A;  3UU9 A;  2A1T A;  2OEX A;  3TZ5 A;  3MPJ A;  2Z1Q A;  4H81 A;  4U83 A;  2EBF X;  3CRK A;  4V26 A;  2FP1 A;  5B5V A;  3C2P A;  4AKH A;  2R03 A;  3TZ2 A;  2YGW A;  2YYL A;  3D9G A;  3GM6 A;  2R0N A;  2E80 A;  5K3G A;  1S26 A;  2UXW A;  3OIB A;  2R0M A;  3R7K A;  1FS8 A;  1SK6 A;  2FON A;  4G5E A;  1Y8P A;  2GBB A;  1UDY A;  2WBI A;  1SIQ A;  4IV6 A;  4V25 A;  2LFW A;  4WJY A;  2Q8I A;  4DOY A;  1EGD A;  3BNG A;  2Q8G A;  1XFX A;  2CJ8 A;  3X0X A;  2Q8H A;  2ZKJ A;  2OJQ A;  3AFF A;  2R05 A;  4KS9 A;  3X29 A;  2C12 A;  3LGQ A;  3S7W A;  1IVH A;  2JIF A;  2YYK A;  2YYI A;  3CE2 A;  4W9U A;  4FF1 A;  4KSF A;  3TOR A;  3OWA A;  3P4T A;  1FS7 A;  1BUC A;  3MXL A;  5J71 A;  4AKG A;  2E81 A;  3NF4 A;  4Q17 A;  2XS1 A;  2PO4 A;  2RDZ A;  2ZAF A;  5GJV E;  3II9 A;  1RJ1 A;  3D9D A;  1Y0V A;  2R02 A;  1K8T A;  5M4M A;  4MPN A;  3SCE A;  4G97 A;  1RJ4 A;  3FCJ A;  3L1T A;  3BNH A;  2D29 A;  4Q4U A;  4E02 A;  2BU8 A;  4ZYJ A;  1X90 A;  3Q24 A;  2CJ6 A;  2F6L A;  4MPE A;  3AFE A;  2YYG A;  3MPI A;  4L38 A;  4MPC A;  5K3J A;  1GU6 A;  5GJW E;  4J1V A;  1SC5 A;  3PFD A;  4L3Z A;  4XVX A;  2CJ7 A;  3GNC A; 
#chains in the Genus database with same CATH homology
 5B6B A;  5BRK A;  5B5W A;  2HJN A;  4LQQ B;  4LQS B;  4JIZ A;  4J1V A;  1R3B A;  5B5V A;  5BRM A;  1PI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...