5BRMA

Structural basis for mob1-dependent activation of the core mst-lats kinase cascade in hippo signaling
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
154
Chain Sequence
DLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/signaling protein
molecule keywords MOB kinase activator 1A
publication title Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 154
sequence length 160
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-05-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5brmA00
5BRKA 4JIZA 4LQSB 5B5WA 5B5VA 5B6BA 4J1VA 1PI1A 4LQQB 5BRMA 2HJNA 1R3BA
chains in the Genus database with same CATH superfamily
2FP2A 2FONA 1XFWA 2F6LA 2XS8A 2YYLA 4JEKA 2Q8IA 4E00A 4AI6A 3MDEA 4L3YA 2WBIA 4HKRA 3C46A 2EC5A 1QDBA 1Y8NA 3FO3A 2OT4A 1W07A 1FS9A 2PO4A 1WS9A 3OIBA 3P4TA 4Q17A 2YYKA 1GKZA 2E81A 1U8VA 2EBFX 2RFQA 2Z1QA 4DZYA 3II9A 1BUCA 1XFVA 1K90A 1FS7A 2YYIA 3D6BA 2ZDXA 3LG1A 1JM6A 4DOYA 3AFEA 3EOMA 3MMOA 2VR0A 4HR3A 2CJ8A 4KSAA 4Q5BA 2DVLA 4RM7A 4Q5CA 5BRMA 3SXQA 1Y8PA 4XVXA 3M9VA 3GNCA 1XFUA 4M9AA 2XS1A 2BU8A 4MPEA 3Q22A 4FF1A 1IS2A 1EGCA 3D1IA 3N0RA 2DDHA 2ZO5A 4LQQB 4AKGA 1R3BA 2Q8GA 5K3HA 5GJWE 5K3JA 4NXLA 4AKIA 1IVHA 1X8ZA 3PFDA 3X0YA 1LVCA 4P13A 1XFXA 4JIOA 3X0XA 1K93A 1JQIA 3NF4A 5J6AA 5BRKA 4JIZA 3R7KA 4FF3A 3UBRA 3MXLA 2AZEA 4H85A 4H7QA 4WJYA 1RJ4A 1RP3A 2CJ5A 2PG0A 4G97A 3TTBA 4Q0TA 3VKHA 2EBAA 4V26A 1SK6A 4N5FA 5M4NA 2C12A 1X90A 2VF1A 4KTOA 3S7WA 4ZYJA 3FCJA 2ZDYA 1SC5A 2AO2A 2JIFA 2ZKJA 3OWMA 1Y8OA 2E0AA 2IX5A 2CX9A 3D2RA 1XFZA 4IV6A 3RKHA 3D9FA 2JBTA 3CRKA 2XQRB 3BNFA 3CE2A 2VIGA 2PNRA 4Q1OA 4QICA 5GJVE 2OJQA 3VKGA 2R02A 1R2JA 4E02A 1SIQA 2QR4A 3EONA 1RJ1A 3BNHA 4P79A 5B5WA 2BU6A 4W9UA 4AKHA 2Q8HA 3D9EA 4L3XA 2R0NA 4ZXVA 2OR0A 5M4KA 1T9GA 5M4MA 2BU5A 5B6BA 1RX0A 2FP1A 2GBBA 1PI1A 3OWAA 4HKSA 2R03A 5J71A 3VADA 3MPJA 3Q24A 3Q23A 2R0MA 1S26A 4L3ZA 3AFFA 2YYJA 4H81A 2RF7A 3C3LA 3SF6A 3C2PA 2E80A 2ZAFA 3CRLA 2D29A 3TZ0A 2R05A 3D9GA 4U83A 1GJVA 4E01A 3GM6A 1XFYA 1XG2B 4L38A 3TZ2A 2JBRA 1GKXA 2OEVA 3MDDA 3TZ5A 3BNJA 3B96A 1K8TA 4G5EA 4L1FA 1EGDA 1GU6A 1SIRA 3BNGA 4MP7A 4F0XA 4V25A 4KS9A 1X91A 5M4PA 2BTZA 2J7AA 1FS8A 2OEXA 2YGWA 3MPIA 4LQSB 4X28C 3MKHA 2C0UA 3LGQA 4KCFA 1OAHA 2REHA 2EBHX 2RDZA 4O5MA 3TZ4A 4FZ4A 3TORA 2BU2A 3Q0AA 3UU9A 4KSFA 2BU7A 4FF4A 3KMLA 2JBSA 3HWCA 4IRNA 5K3IA 4X28A 5K3GA 1EGEA 3D9DA 1UDYA 2HJNA 4MPCA 4MP2A 1Y0VA 4OO2A 3SCEA 1PK0A 1UKWA 2CJ6A 2CJ4A 2YYGA 4MPNA 4Q4UA 5B5VA 2Q8FA 3F29A 2YYMA 4J1VA 2IX6A 4FF2A 3GQTA 3X29A 2CJ7A 2LFWA 3SWOA 3L1TA 2UXWA 2A1TA
chains in the Genus database with same CATH topology
5BRKA 4JIZA 4LQSB 5B5WA 5B5VA 5B6BA 4J1VA 1PI1A 4LQQB 5BRMA 2HJNA 1R3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BRK A;  4JIZ A;  4LQS B;  5B5W A;  5B5V A;  5B6B A;  4J1V A;  1PI1 A;  4LQQ B;  5BRM A;  2HJN A;  1R3B A; 
#chains in the Genus database with same CATH topology
 2FP2 A;  2FON A;  1XFW A;  2F6L A;  2XS8 A;  2YYL A;  4JEK A;  2Q8I A;  4E00 A;  4AI6 A;  3MDE A;  4L3Y A;  2WBI A;  4HKR A;  3C46 A;  2EC5 A;  1QDB A;  1Y8N A;  3FO3 A;  2OT4 A;  1W07 A;  1FS9 A;  2PO4 A;  1WS9 A;  3OIB A;  3P4T A;  4Q17 A;  2YYK A;  1GKZ A;  2E81 A;  1U8V A;  2EBF X;  2RFQ A;  2Z1Q A;  4DZY A;  3II9 A;  1BUC A;  1XFV A;  1K90 A;  1FS7 A;  2YYI A;  3D6B A;  2ZDX A;  3LG1 A;  1JM6 A;  4DOY A;  3AFE A;  3EOM A;  3MMO A;  2VR0 A;  4HR3 A;  2CJ8 A;  4KSA A;  4Q5B A;  2DVL A;  4RM7 A;  4Q5C A;  5BRM A;  3SXQ A;  1Y8P A;  4XVX A;  3M9V A;  3GNC A;  1XFU A;  4M9A A;  2XS1 A;  2BU8 A;  4MPE A;  3Q22 A;  4FF1 A;  1IS2 A;  1EGC A;  3D1I A;  3N0R A;  2DDH A;  2ZO5 A;  4LQQ B;  4AKG A;  1R3B A;  2Q8G A;  5K3H A;  5GJW E;  5K3J A;  4NXL A;  4AKI A;  1IVH A;  1X8Z A;  3PFD A;  3X0Y A;  1LVC A;  4P13 A;  1XFX A;  4JIO A;  3X0X A;  1K93 A;  1JQI A;  3NF4 A;  5J6A A;  5BRK A;  4JIZ A;  3R7K A;  4FF3 A;  3UBR A;  3MXL A;  2AZE A;  4H85 A;  4H7Q A;  4WJY A;  1RJ4 A;  1RP3 A;  2CJ5 A;  2PG0 A;  4G97 A;  3TTB A;  4Q0T A;  3VKH A;  2EBA A;  4V26 A;  1SK6 A;  4N5F A;  5M4N A;  2C12 A;  1X90 A;  2VF1 A;  4KTO A;  3S7W A;  4ZYJ A;  3FCJ A;  2ZDY A;  1SC5 A;  2AO2 A;  2JIF A;  2ZKJ A;  3OWM A;  1Y8O A;  2E0A A;  2IX5 A;  2CX9 A;  3D2R A;  1XFZ A;  4IV6 A;  3RKH A;  3D9F A;  2JBT A;  3CRK A;  2XQR B;  3BNF A;  3CE2 A;  2VIG A;  2PNR A;  4Q1O A;  4QIC A;  5GJV E;  2OJQ A;  3VKG A;  2R02 A;  1R2J A;  4E02 A;  1SIQ A;  2QR4 A;  3EON A;  1RJ1 A;  3BNH A;  4P79 A;  5B5W A;  2BU6 A;  4W9U A;  4AKH A;  2Q8H A;  3D9E A;  4L3X A;  2R0N A;  4ZXV A;  2OR0 A;  5M4K A;  1T9G A;  5M4M A;  2BU5 A;  5B6B A;  1RX0 A;  2FP1 A;  2GBB A;  1PI1 A;  3OWA A;  4HKS A;  2R03 A;  5J71 A;  3VAD A;  3MPJ A;  3Q24 A;  3Q23 A;  2R0M A;  1S26 A;  4L3Z A;  3AFF A;  2YYJ A;  4H81 A;  2RF7 A;  3C3L A;  3SF6 A;  3C2P A;  2E80 A;  2ZAF A;  3CRL A;  2D29 A;  3TZ0 A;  2R05 A;  3D9G A;  4U83 A;  1GJV A;  4E01 A;  3GM6 A;  1XFY A;  1XG2 B;  4L38 A;  3TZ2 A;  2JBR A;  1GKX A;  2OEV A;  3MDD A;  3TZ5 A;  3BNJ A;  3B96 A;  1K8T A;  4G5E A;  4L1F A;  1EGD A;  1GU6 A;  1SIR A;  3BNG A;  4MP7 A;  4F0X A;  4V25 A;  4KS9 A;  1X91 A;  5M4P A;  2BTZ A;  2J7A A;  1FS8 A;  2OEX A;  2YGW A;  3MPI A;  4LQS B;  4X28 C;  3MKH A;  2C0U A;  3LGQ A;  4KCF A;  1OAH A;  2REH A;  2EBH X;  2RDZ A;  4O5M A;  3TZ4 A;  4FZ4 A;  3TOR A;  2BU2 A;  3Q0A A;  3UU9 A;  4KSF A;  2BU7 A;  4FF4 A;  3KML A;  2JBS A;  3HWC A;  4IRN A;  5K3I A;  4X28 A;  5K3G A;  1EGE A;  3D9D A;  1UDY A;  2HJN A;  4MPC A;  4MP2 A;  1Y0V A;  4OO2 A;  3SCE A;  1PK0 A;  1UKW A;  2CJ6 A;  2CJ4 A;  2YYG A;  4MPN A;  4Q4U A;  5B5V A;  2Q8F A;  3F29 A;  2YYM A;  4J1V A;  2IX6 A;  4FF2 A;  3GQT A;  3X29 A;  2CJ7 A;  2LFW A;  3SWO A;  3L1T A;  2UXW A;  2A1T A; 
#chains in the Genus database with same CATH homology
 5BRK A;  4JIZ A;  4LQS B;  5B5W A;  5B5V A;  5B6B A;  4J1V A;  1PI1 A;  4LQQ B;  5BRM A;  2HJN A;  1R3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...