2HJNA

Structural and functional analysis of saccharomyces cerevisiae mob1
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
Knots found
sequence length
233
structure length
206
Chain Sequence
PVLTTNVTDFNYTPSHQKPFLDIKQIVEMTLGSEGVAVKLPRGEDENEWLAVHCVDFYNQINMLYGSITEFCSPQTCPRMIATNEYEYLWAFQKGQPPVSVSAPKYVECLMRWCQDQFDDESLFPSKVTGTFPEGFIQRVIQPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFAQEFELLRPADFGPLLELVMELRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Maintenance of ploidy protein MOB1
publication title Structural and Functional Analysis of Saccharomyces cerevisiae Mob1.
pubmed doi rcsb
total genus 63
structure length 206
sequence length 233
other databases KnotProt 2.0: S +31
ec nomenclature
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 2hjnA00
4LQQB 4LQSB 5BRKA 5BRMA 4JIZA 5B6BA 5B5VA 5B5WA 4J1VA 2HJNA 1PI1A 1R3BA
chains in the Genus database with same CATH superfamily
2F6LA 4LQQB 1GKXA 4AKHA 4MPEA 4V25A 1JM6A 5K3GA 4HKSA 2R02A 2JBSA 2PNRA 1K90A 1R2JA 5M4NA 3GQTA 2PO4A 2J7AA 2CJ4A 3L1TA 4L3XA 2YYGA 3CE2A 4L3ZA 2BU8A 4Q5BA 2OT4A 3NF4A 3R7KA 2FP2A 3S7WA 3MXLA 4RM7A 4U83A 1SIRA 4X28A 4ZYJA 4E01A 2BU6A 4X28C 3FCJA 5K3HA 2Q8HA 4Q1OA 1GKZA 1SK6A 4XVXA 3BNFA 1XFUA 4JEKA 4Q0TA 1LVCA 3TZ4A 4IV6A 2JIFA 1IVHA 2VF1A 4Q17A 2RFQA 3MPIA 1GJVA 3PFDA 1K8TA 4ZXVA 1RP3A 2BU5A 5B6BA 4L3YA 4OO2A 2YYKA 1XG2B 4H85A 2R05A 2GBBA 1Y8PA 1PK0A 2HJNA 4KSAA 3RKHA 3BNHA 3X29A 3Q24A 3VADA 4LQSB 1K93A 2JBTA 5BRMA 1XFWA 1XFZA 2AO2A 2E0AA 5GJWE 4MP2A 1EGEA 4KSFA 3AFFA 2E80A 1R3BA 3CRLA 2OEVA 4NXLA 2YYIA 5BRKA 3C2PA 4FF1A 3KMLA 1JQIA 3C3LA 2R03A 3TTBA 4AKIA 2XS8A 4MPCA 2OEXA 2YYMA 3GM6A 3OWMA 3UBRA 4FF4A 3UU9A 1EGCA 3M9VA 1RJ1A 4H7QA 4JIZA 3TORA 2XS1A 2CJ8A 2D29A 3D9FA 5B5WA 4Q5CA 1IS2A 2EBAA 5K3JA 2Q8IA 5M4KA 1X8ZA 1XFYA 4O5MA 3LGQA 1EGDA 2PG0A 2EBHX 4AKGA 4H81A 1QDBA 3F29A 2IX5A 4V26A 3D9DA 3TZ5A 2XQRB 2DVLA 5J6AA 4P79A 3AFEA 1S26A 2R0NA 4J1VA 2RDZA 3Q23A 1RX0A 3SF6A 3D9EA 2VR0A 1XFXA 3MDEA 4FZ4A 3MPJA 2ZO5A 4KS9A 3TZ2A 4E02A 2YYJA 3C46A 4Q4UA 2VIGA 4DZYA 4FF2A 3VKGA 2REHA 3D2RA 2BU2A 3X0YA 1W07A 3VKHA 1SC5A 4WJYA 4E00A 4FF3A 1SIQA 3D6BA 2Q8FA 1PI1A 1BUCA 2CJ7A 5GJVE 3OWAA 3X0XA 5J71A 2IX6A 3GNCA 1FS7A 2FP1A 2ZDXA 2AZEA 4HR3A 4MP7A 1WS9A 1Y0VA 4W9UA 1UKWA 2E81A 2OR0A 4G97A 3BNGA 3MMOA 3P4TA 4HKRA 1U8VA 3EONA 4M9AA 4L38A 3N0RA 1XFVA 2RF7A 3BNJA 4JIOA 1T9GA 1OAHA 1Y8NA 2R0MA 3II9A 4KCFA 3MDDA 2A1TA 2CJ6A 4KTOA 2Z1QA 4L1FA 1GU6A 2EBFX 4G5EA 3SWOA 2C12A 4MPNA 2ZDYA 3HWCA 1X91A 3MKHA 2WBIA 5M4PA 4IRNA 1UDYA 2UXWA 4AI6A 2LFWA 3B96A 3CRKA 3D1IA 1RJ4A 3SCEA 2QR4A 3FO3A 3LG1A 1FS8A 3OIBA 5B5VA 4F0XA 3TZ0A 3Q22A 3SXQA 2DDHA 2BU7A 1FS9A 2EC5A 2OJQA 2YGWA 2CX9A 2ZKJA 4N5FA 2CJ5A 3EOMA 2JBRA 4P13A 5M4MA 1Y8OA 2BTZA 3Q0AA 4DOYA 2C0UA 2Q8GA 5K3IA 2YYLA 2ZAFA 2FONA 3D9GA 1X90A 4QICA
chains in the Genus database with same CATH topology
4LQQB 4LQSB 5BRKA 5BRMA 4JIZA 5B6BA 5B5VA 5B5WA 4J1VA 2HJNA 1PI1A 1R3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQQ B;  4LQS B;  5BRK A;  5BRM A;  4JIZ A;  5B6B A;  5B5V A;  5B5W A;  4J1V A;  2HJN A;  1PI1 A;  1R3B A; 
#chains in the Genus database with same CATH topology
 2F6L A;  4LQQ B;  1GKX A;  4AKH A;  4MPE A;  4V25 A;  1JM6 A;  5K3G A;  4HKS A;  2R02 A;  2JBS A;  2PNR A;  1K90 A;  1R2J A;  5M4N A;  3GQT A;  2PO4 A;  2J7A A;  2CJ4 A;  3L1T A;  4L3X A;  2YYG A;  3CE2 A;  4L3Z A;  2BU8 A;  4Q5B A;  2OT4 A;  3NF4 A;  3R7K A;  2FP2 A;  3S7W A;  3MXL A;  4RM7 A;  4U83 A;  1SIR A;  4X28 A;  4ZYJ A;  4E01 A;  2BU6 A;  4X28 C;  3FCJ A;  5K3H A;  2Q8H A;  4Q1O A;  1GKZ A;  1SK6 A;  4XVX A;  3BNF A;  1XFU A;  4JEK A;  4Q0T A;  1LVC A;  3TZ4 A;  4IV6 A;  2JIF A;  1IVH A;  2VF1 A;  4Q17 A;  2RFQ A;  3MPI A;  1GJV A;  3PFD A;  1K8T A;  4ZXV A;  1RP3 A;  2BU5 A;  5B6B A;  4L3Y A;  4OO2 A;  2YYK A;  1XG2 B;  4H85 A;  2R05 A;  2GBB A;  1Y8P A;  1PK0 A;  2HJN A;  4KSA A;  3RKH A;  3BNH A;  3X29 A;  3Q24 A;  3VAD A;  4LQS B;  1K93 A;  2JBT A;  5BRM A;  1XFW A;  1XFZ A;  2AO2 A;  2E0A A;  5GJW E;  4MP2 A;  1EGE A;  4KSF A;  3AFF A;  2E80 A;  1R3B A;  3CRL A;  2OEV A;  4NXL A;  2YYI A;  5BRK A;  3C2P A;  4FF1 A;  3KML A;  1JQI A;  3C3L A;  2R03 A;  3TTB A;  4AKI A;  2XS8 A;  4MPC A;  2OEX A;  2YYM A;  3GM6 A;  3OWM A;  3UBR A;  4FF4 A;  3UU9 A;  1EGC A;  3M9V A;  1RJ1 A;  4H7Q A;  4JIZ A;  3TOR A;  2XS1 A;  2CJ8 A;  2D29 A;  3D9F A;  5B5W A;  4Q5C A;  1IS2 A;  2EBA A;  5K3J A;  2Q8I A;  5M4K A;  1X8Z A;  1XFY A;  4O5M A;  3LGQ A;  1EGD A;  2PG0 A;  2EBH X;  4AKG A;  4H81 A;  1QDB A;  3F29 A;  2IX5 A;  4V26 A;  3D9D A;  3TZ5 A;  2XQR B;  2DVL A;  5J6A A;  4P79 A;  3AFE A;  1S26 A;  2R0N A;  4J1V A;  2RDZ A;  3Q23 A;  1RX0 A;  3SF6 A;  3D9E A;  2VR0 A;  1XFX A;  3MDE A;  4FZ4 A;  3MPJ A;  2ZO5 A;  4KS9 A;  3TZ2 A;  4E02 A;  2YYJ A;  3C46 A;  4Q4U A;  2VIG A;  4DZY A;  4FF2 A;  3VKG A;  2REH A;  3D2R A;  2BU2 A;  3X0Y A;  1W07 A;  3VKH A;  1SC5 A;  4WJY A;  4E00 A;  4FF3 A;  1SIQ A;  3D6B A;  2Q8F A;  1PI1 A;  1BUC A;  2CJ7 A;  5GJV E;  3OWA A;  3X0X A;  5J71 A;  2IX6 A;  3GNC A;  1FS7 A;  2FP1 A;  2ZDX A;  2AZE A;  4HR3 A;  4MP7 A;  1WS9 A;  1Y0V A;  4W9U A;  1UKW A;  2E81 A;  2OR0 A;  4G97 A;  3BNG A;  3MMO A;  3P4T A;  4HKR A;  1U8V A;  3EON A;  4M9A A;  4L38 A;  3N0R A;  1XFV A;  2RF7 A;  3BNJ A;  4JIO A;  1T9G A;  1OAH A;  1Y8N A;  2R0M A;  3II9 A;  4KCF A;  3MDD A;  2A1T A;  2CJ6 A;  4KTO A;  2Z1Q A;  4L1F A;  1GU6 A;  2EBF X;  4G5E A;  3SWO A;  2C12 A;  4MPN A;  2ZDY A;  3HWC A;  1X91 A;  3MKH A;  2WBI A;  5M4P A;  4IRN A;  1UDY A;  2UXW A;  4AI6 A;  2LFW A;  3B96 A;  3CRK A;  3D1I A;  1RJ4 A;  3SCE A;  2QR4 A;  3FO3 A;  3LG1 A;  1FS8 A;  3OIB A;  5B5V A;  4F0X A;  3TZ0 A;  3Q22 A;  3SXQ A;  2DDH A;  2BU7 A;  1FS9 A;  2EC5 A;  2OJQ A;  2YGW A;  2CX9 A;  2ZKJ A;  4N5F A;  2CJ5 A;  3EOM A;  2JBR A;  4P13 A;  5M4M A;  1Y8O A;  2BTZ A;  3Q0A A;  4DOY A;  2C0U A;  2Q8G A;  5K3I A;  2YYL A;  2ZAF A;  2FON A;  3D9G A;  1X90 A;  4QIC A; 
#chains in the Genus database with same CATH homology
 4LQQ B;  4LQS B;  5BRK A;  5BRM A;  4JIZ A;  5B6B A;  5B5V A;  5B5W A;  4J1V A;  2HJN A;  1PI1 A;  1R3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...