5BRKA

Pmob1-lats1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
192
Chain Sequence
SKFKPKKNIPEELLKHAEALGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOB kinase activator 1A
publication title Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 53
structure length 192
sequence length 203
ec nomenclature
pdb deposition date 2015-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5brkA00
2HJNA 4JIZA 4LQQB 5B6BA 5BRKA 4J1VA 5B5VA 1R3BA 5B5WA 4LQSB 1PI1A 5BRMA
chains in the Genus database with same CATH superfamily
1WS9A 1Y8NA 3Q23A 4MP2A 4Q0TA 4L3ZA 2J7AA 2YYLA 1S26A 3CRLA 4H85A 1SC5A 3C46A 2REHA 3D9DA 4X28A 3VADA 1XFVA 3F29A 2YGWA 4L1FA 1Y0VA 3GM6A 2AZEA 4HKSA 1GU6A 4QICA 4DOYA 4E00A 3D9FA 2CJ7A 4Q1OA 3UBRA 2WBIA 1R3BA 2BTZA 3OWAA 1XFYA 3CRKA 3D1IA 3MPIA 1QDBA 2AO2A 3BNJA 4G97A 1GJVA 1BUCA 2D29A 4X28C 3X0XA 4FF2A 2VF1A 1K90A 2DVLA 3CE2A 2ZDXA 4KCFA 3MXLA 1R2JA 4Q5CA 4KTOA 2FP2A 2Z1QA 2EBAA 3D6BA 3GQTA 3VKHA 2CX9A 4DZYA 2YYJA 3Q24A 3C3LA 5M4PA 4IRNA 2XS8A 1GKXA 1RP3A 2E0AA 2JBRA 1XFUA 3FO3A 3RKHA 2IX6A 3AFEA 3Q22A 5B6BA 1K8TA 1SIRA 2JIFA 2ZAFA 3S7WA 4FZ4A 2JBSA 4MPNA 5BRMA 2VR0A 1PK0A 2ZDYA 2Q8IA 2FONA 4LQQB 5GJWE 3X0YA 2RDZA 3TORA 5M4NA 1IS2A 1FS7A 4KSFA 4KS9A 2YYKA 4M9AA 4LQSB 3EOMA 3OIBA 3D9EA 1U8VA 3TZ4A 3Q0AA 2GBBA 1JM6A 1X91A 3OWMA 3P4TA 4MP7A 4FF3A 2R05A 4AKIA 4AKGA 3VKGA 4WJYA 1IVHA 3R7KA 3SXQA 3N0RA 1EGDA 2BU5A 2C0UA 1UDYA 2C12A 2VIGA 4JIZA 4KSAA 5K3HA 4JIOA 3HWCA 5B5VA 2PG0A 2OEVA 2OEXA 3C2PA 2F6LA 1PI1A 1XFXA 2EBHX 3LG1A 2BU7A 5BRKA 3SWOA 3NF4A 2DDHA 2QR4A 3UU9A 4J1VA 4RM7A 3BNHA 3TZ0A 2EBFX 2A1TA 4L38A 4L3YA 1LVCA 1SIQA 1EGEA 1Y8PA 1RX0A 2R02A 2ZO5A 3LGQA 3MPJA 4O5MA 2OT4A 3SCEA 3BNFA 4E02A 4Q5BA 1XFZA 3B96A 5K3GA 1X90A 3MDEA 4V25A 2HJNA 4JEKA 4AKHA 3FCJA 1JQIA 4HKRA 1XFWA 2CJ4A 3D9GA 4MPEA 2Q8FA 4F0XA 4FF1A 4U83A 3TZ2A 3MDDA 3II9A 2BU8A 4NXLA 4G5EA 2Q8GA 2Q8HA 4FF4A 4H7QA 4E01A 2XQRB 2FP1A 3KMLA 3AFFA 1FS8A 2R0MA 1UKWA 2R0NA 2PO4A 5GJVE 4AI6A 4H81A 1SK6A 1OAHA 5J71A 2BU2A 4OO2A 5K3JA 5M4MA 4P13A 1EGCA 1FS9A 1Y8OA 2UXWA 3BNGA 4MPCA 1T9GA 2CJ5A 5B5WA 3TZ5A 2PNRA 2OR0A 4XVXA 3SF6A 2ZKJA 4ZXVA 3L1TA 2IX5A 1RJ4A 3PFDA 2EC5A 4P79A 5K3IA 2YYMA 1K93A 2E80A 2RFQA 2BU6A 2RF7A 3GNCA 1GKZA 1W07A 2CJ8A 5J6AA 3MKHA 3EONA 4HR3A 4N5FA 2YYGA 1RJ1A 3TTBA 4L3XA 3MMOA 4W9UA 3X29A 1X8ZA 1XG2B 2XS1A 2JBTA 3M9VA 4Q17A 2E81A 2YYIA 2CJ6A 2R03A 3D2RA 4IV6A 2LFWA 4Q4UA 4V26A 4ZYJA 5M4KA 2OJQA
chains in the Genus database with same CATH topology
2HJNA 4JIZA 4LQQB 5B6BA 5BRKA 4J1VA 5B5VA 1R3BA 5B5WA 4LQSB 1PI1A 5BRMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJN A;  4JIZ A;  4LQQ B;  5B6B A;  5BRK A;  4J1V A;  5B5V A;  1R3B A;  5B5W A;  4LQS B;  1PI1 A;  5BRM A; 
#chains in the Genus database with same CATH topology
 1WS9 A;  1Y8N A;  3Q23 A;  4MP2 A;  4Q0T A;  4L3Z A;  2J7A A;  2YYL A;  1S26 A;  3CRL A;  4H85 A;  1SC5 A;  3C46 A;  2REH A;  3D9D A;  4X28 A;  3VAD A;  1XFV A;  3F29 A;  2YGW A;  4L1F A;  1Y0V A;  3GM6 A;  2AZE A;  4HKS A;  1GU6 A;  4QIC A;  4DOY A;  4E00 A;  3D9F A;  2CJ7 A;  4Q1O A;  3UBR A;  2WBI A;  1R3B A;  2BTZ A;  3OWA A;  1XFY A;  3CRK A;  3D1I A;  3MPI A;  1QDB A;  2AO2 A;  3BNJ A;  4G97 A;  1GJV A;  1BUC A;  2D29 A;  4X28 C;  3X0X A;  4FF2 A;  2VF1 A;  1K90 A;  2DVL A;  3CE2 A;  2ZDX A;  4KCF A;  3MXL A;  1R2J A;  4Q5C A;  4KTO A;  2FP2 A;  2Z1Q A;  2EBA A;  3D6B A;  3GQT A;  3VKH A;  2CX9 A;  4DZY A;  2YYJ A;  3Q24 A;  3C3L A;  5M4P A;  4IRN A;  2XS8 A;  1GKX A;  1RP3 A;  2E0A A;  2JBR A;  1XFU A;  3FO3 A;  3RKH A;  2IX6 A;  3AFE A;  3Q22 A;  5B6B A;  1K8T A;  1SIR A;  2JIF A;  2ZAF A;  3S7W A;  4FZ4 A;  2JBS A;  4MPN A;  5BRM A;  2VR0 A;  1PK0 A;  2ZDY A;  2Q8I A;  2FON A;  4LQQ B;  5GJW E;  3X0Y A;  2RDZ A;  3TOR A;  5M4N A;  1IS2 A;  1FS7 A;  4KSF A;  4KS9 A;  2YYK A;  4M9A A;  4LQS B;  3EOM A;  3OIB A;  3D9E A;  1U8V A;  3TZ4 A;  3Q0A A;  2GBB A;  1JM6 A;  1X91 A;  3OWM A;  3P4T A;  4MP7 A;  4FF3 A;  2R05 A;  4AKI A;  4AKG A;  3VKG A;  4WJY A;  1IVH A;  3R7K A;  3SXQ A;  3N0R A;  1EGD A;  2BU5 A;  2C0U A;  1UDY A;  2C12 A;  2VIG A;  4JIZ A;  4KSA A;  5K3H A;  4JIO A;  3HWC A;  5B5V A;  2PG0 A;  2OEV A;  2OEX A;  3C2P A;  2F6L A;  1PI1 A;  1XFX A;  2EBH X;  3LG1 A;  2BU7 A;  5BRK A;  3SWO A;  3NF4 A;  2DDH A;  2QR4 A;  3UU9 A;  4J1V A;  4RM7 A;  3BNH A;  3TZ0 A;  2EBF X;  2A1T A;  4L38 A;  4L3Y A;  1LVC A;  1SIQ A;  1EGE A;  1Y8P A;  1RX0 A;  2R02 A;  2ZO5 A;  3LGQ A;  3MPJ A;  4O5M A;  2OT4 A;  3SCE A;  3BNF A;  4E02 A;  4Q5B A;  1XFZ A;  3B96 A;  5K3G A;  1X90 A;  3MDE A;  4V25 A;  2HJN A;  4JEK A;  4AKH A;  3FCJ A;  1JQI A;  4HKR A;  1XFW A;  2CJ4 A;  3D9G A;  4MPE A;  2Q8F A;  4F0X A;  4FF1 A;  4U83 A;  3TZ2 A;  3MDD A;  3II9 A;  2BU8 A;  4NXL A;  4G5E A;  2Q8G A;  2Q8H A;  4FF4 A;  4H7Q A;  4E01 A;  2XQR B;  2FP1 A;  3KML A;  3AFF A;  1FS8 A;  2R0M A;  1UKW A;  2R0N A;  2PO4 A;  5GJV E;  4AI6 A;  4H81 A;  1SK6 A;  1OAH A;  5J71 A;  2BU2 A;  4OO2 A;  5K3J A;  5M4M A;  4P13 A;  1EGC A;  1FS9 A;  1Y8O A;  2UXW A;  3BNG A;  4MPC A;  1T9G A;  2CJ5 A;  5B5W A;  3TZ5 A;  2PNR A;  2OR0 A;  4XVX A;  3SF6 A;  2ZKJ A;  4ZXV A;  3L1T A;  2IX5 A;  1RJ4 A;  3PFD A;  2EC5 A;  4P79 A;  5K3I A;  2YYM A;  1K93 A;  2E80 A;  2RFQ A;  2BU6 A;  2RF7 A;  3GNC A;  1GKZ A;  1W07 A;  2CJ8 A;  5J6A A;  3MKH A;  3EON A;  4HR3 A;  4N5F A;  2YYG A;  1RJ1 A;  3TTB A;  4L3X A;  3MMO A;  4W9U A;  3X29 A;  1X8Z A;  1XG2 B;  2XS1 A;  2JBT A;  3M9V A;  4Q17 A;  2E81 A;  2YYI A;  2CJ6 A;  2R03 A;  3D2R A;  4IV6 A;  2LFW A;  4Q4U A;  4V26 A;  4ZYJ A;  5M4K A;  2OJQ A; 
#chains in the Genus database with same CATH homology
 2HJN A;  4JIZ A;  4LQQ B;  5B6B A;  5BRK A;  4J1V A;  5B5V A;  1R3B A;  5B5W A;  4LQS B;  1PI1 A;  5BRM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...