5BRKA

Pmob1-lats1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
192
Chain Sequence
b'SKFKPKKNIPEELLKHAEALGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOB kinase activator 1A
publication title Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
total genus 53
structure length 192
sequence length 203
ec nomenclature
pdb deposition date 2015-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5brkA00
5BRMA 4LQQB 1PI1A 4JIZA 4LQSB 5B6BA 1R3BA 4J1VA 5B5WA 5B5VA 5BRKA 2HJNA
chains in the Genus database with same CATH superfamily
1Y8NA 4X28C 1T9GA 1K90A 2EBFX 1LVCA 1X8ZA 2REHA 1GKXA 3EOMA 1S26A 1U8VA 2OEVA 3OWMA 4KS9A 1W07A 4XVXA 2A1TA 3TZ2A 1XFUA 2BU5A 2CJ7A 3LG1A 4O5MA 1XFWA 3FCJA 1UKWA 2BU8A 2LFWA 3BNJA 2RFQA 4J1VA 1X91A 2CJ6A 1X90A 2RF7A 1FS8A 1SK6A 2OJQA 2YYKA 2CX9A 3MXLA 1XFVA 3BNFA 3CE2A 4FZ4A 4L3XA 2YYGA 2Q8HA 4DZYA 2D29A 4V25A 5M4MA 4X28A 3P4TA 1EGCA 2DDHA 1BUCA 2PO4A 4ZYJA 3SCEA 4MPEA 4LQQB 2FP1A 3II9A 2E81A 3L1TA 1R3BA 2C12A 1SC5A 1SIRA 4MP7A 3R7KA 3X0XA 3C2PA 2YYLA 5M4NA 1XFZA 5J6AA 4AKIA 5GJVE 1K8TA 3AFFA 5J71A 5M4PA 3SWOA 3C3LA 2BTZA 4QICA 5K3GA 2ZDXA 3Q24A 2Z1QA 1Y8OA 2BU7A 2YYMA 4AI6A 4G97A 4ZXVA 3X0YA 2IX5A 4JEKA 3D2RA 3TTBA 3VKHA 2EBHX 4G5EA 1K93A 1FS9A 2BU2A 2F6LA 4KSAA 2E80A 4L3ZA 3EONA 1GKZA 3TORA 3UBRA 2JBSA 2XS8A 4Q1OA 3D6BA 3UU9A 4IV6A 3SF6A 5B5WA 4FF4A 5B5VA 3SXQA 3PFDA 1R2JA 2XS1A 1PI1A 2ZKJA 4Q0TA 3X29A 1IS2A 2VF1A 4JIZA 2OT4A 2CJ5A 5K3IA 3N0RA 4NXLA 2PNRA 4HKRA 4W9UA 4AKHA 4MPCA 3GM6A 1IVHA 4KCFA 3HWCA 3TZ0A 2R03A 2DVLA 3Q22A 4E00A 2R05A 3D9FA 3FO3A 1WS9A 1UDYA 2J7AA 2PG0A 3CRKA 4H85A 3Q0AA 4DOYA 2UXWA 3MPIA 4FF2A 3TZ4A 3AFEA 3Q23A 3GQTA 2EC5A 4N5FA 4OO2A 5K3HA 3BNGA 3C46A 2EBAA 1PK0A 5M4KA 2JIFA 3B96A 3NF4A 3MKHA 3D9GA 4HR3A 4AKGA 1RP3A 3MDEA 4E02A 4P13A 2R0MA 2CJ4A 2VR0A 2XQRB 1OAHA 4Q5CA 4Q4UA 2RDZA 4JIOA 4FF3A 4M9AA 2Q8FA 3D1IA 3RKHA 1FS7A 4H7QA 4E01A 4U83A 4V26A 2Q8IA 1SIQA 4H81A 4Q17A 3MMOA 2GBBA 3F29A 4L3YA 2YGWA 4WJYA 1XG2B 1JQIA 2FP2A 2AO2A 3LGQA 2CJ8A 4MP2A 2HJNA 2Q8GA 1XFYA 1Y8PA 2C0UA 4P79A 3BNHA 1EGEA 5K3JA 5B6BA 1JM6A 1RX0A 4KTOA 2JBTA 2YYIA 2ZO5A 2R02A 3D9DA 2BU6A 2ZDYA 4L38A 3OWAA 4LQSB 1EGDA 1RJ4A 2FONA 2R0NA 2ZAFA 1GJVA 5GJWE 3TZ5A 3CRLA 3MDDA 2IX6A 4IRNA 2AZEA 4F0XA 3VKGA 4KSFA 2QR4A 1QDBA 2WBIA 4Q5BA 3M9VA 2OR0A 3D9EA 3VADA 3S7WA 3MPJA 4HKSA 1Y0VA 3KMLA 2YYJA 5BRKA 4FF1A 4MPNA 2JBRA 3GNCA 4RM7A 2OEXA 5BRMA 2E0AA 1XFXA 4L1FA 1RJ1A 3OIBA 1GU6A 2VIGA
chains in the Genus database with same CATH topology
5BRMA 4LQQB 1PI1A 4JIZA 4LQSB 5B6BA 1R3BA 4J1VA 5B5WA 5B5VA 5BRKA 2HJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BRM A;  4LQQ B;  1PI1 A;  4JIZ A;  4LQS B;  5B6B A;  1R3B A;  4J1V A;  5B5W A;  5B5V A;  5BRK A;  2HJN A; 
#chains in the Genus database with same CATH topology
 1Y8N A;  4X28 C;  1T9G A;  1K90 A;  2EBF X;  1LVC A;  1X8Z A;  2REH A;  1GKX A;  3EOM A;  1S26 A;  1U8V A;  2OEV A;  3OWM A;  4KS9 A;  1W07 A;  4XVX A;  2A1T A;  3TZ2 A;  1XFU A;  2BU5 A;  2CJ7 A;  3LG1 A;  4O5M A;  1XFW A;  3FCJ A;  1UKW A;  2BU8 A;  2LFW A;  3BNJ A;  2RFQ A;  4J1V A;  1X91 A;  2CJ6 A;  1X90 A;  2RF7 A;  1FS8 A;  1SK6 A;  2OJQ A;  2YYK A;  2CX9 A;  3MXL A;  1XFV A;  3BNF A;  3CE2 A;  4FZ4 A;  4L3X A;  2YYG A;  2Q8H A;  4DZY A;  2D29 A;  4V25 A;  5M4M A;  4X28 A;  3P4T A;  1EGC A;  2DDH A;  1BUC A;  2PO4 A;  4ZYJ A;  3SCE A;  4MPE A;  4LQQ B;  2FP1 A;  3II9 A;  2E81 A;  3L1T A;  1R3B A;  2C12 A;  1SC5 A;  1SIR A;  4MP7 A;  3R7K A;  3X0X A;  3C2P A;  2YYL A;  5M4N A;  1XFZ A;  5J6A A;  4AKI A;  5GJV E;  1K8T A;  3AFF A;  5J71 A;  5M4P A;  3SWO A;  3C3L A;  2BTZ A;  4QIC A;  5K3G A;  2ZDX A;  3Q24 A;  2Z1Q A;  1Y8O A;  2BU7 A;  2YYM A;  4AI6 A;  4G97 A;  4ZXV A;  3X0Y A;  2IX5 A;  4JEK A;  3D2R A;  3TTB A;  3VKH A;  2EBH X;  4G5E A;  1K93 A;  1FS9 A;  2BU2 A;  2F6L A;  4KSA A;  2E80 A;  4L3Z A;  3EON A;  1GKZ A;  3TOR A;  3UBR A;  2JBS A;  2XS8 A;  4Q1O A;  3D6B A;  3UU9 A;  4IV6 A;  3SF6 A;  5B5W A;  4FF4 A;  5B5V A;  3SXQ A;  3PFD A;  1R2J A;  2XS1 A;  1PI1 A;  2ZKJ A;  4Q0T A;  3X29 A;  1IS2 A;  2VF1 A;  4JIZ A;  2OT4 A;  2CJ5 A;  5K3I A;  3N0R A;  4NXL A;  2PNR A;  4HKR A;  4W9U A;  4AKH A;  4MPC A;  3GM6 A;  1IVH A;  4KCF A;  3HWC A;  3TZ0 A;  2R03 A;  2DVL A;  3Q22 A;  4E00 A;  2R05 A;  3D9F A;  3FO3 A;  1WS9 A;  1UDY A;  2J7A A;  2PG0 A;  3CRK A;  4H85 A;  3Q0A A;  4DOY A;  2UXW A;  3MPI A;  4FF2 A;  3TZ4 A;  3AFE A;  3Q23 A;  3GQT A;  2EC5 A;  4N5F A;  4OO2 A;  5K3H A;  3BNG A;  3C46 A;  2EBA A;  1PK0 A;  5M4K A;  2JIF A;  3B96 A;  3NF4 A;  3MKH A;  3D9G A;  4HR3 A;  4AKG A;  1RP3 A;  3MDE A;  4E02 A;  4P13 A;  2R0M A;  2CJ4 A;  2VR0 A;  2XQR B;  1OAH A;  4Q5C A;  4Q4U A;  2RDZ A;  4JIO A;  4FF3 A;  4M9A A;  2Q8F A;  3D1I A;  3RKH A;  1FS7 A;  4H7Q A;  4E01 A;  4U83 A;  4V26 A;  2Q8I A;  1SIQ A;  4H81 A;  4Q17 A;  3MMO A;  2GBB A;  3F29 A;  4L3Y A;  2YGW A;  4WJY A;  1XG2 B;  1JQI A;  2FP2 A;  2AO2 A;  3LGQ A;  2CJ8 A;  4MP2 A;  2HJN A;  2Q8G A;  1XFY A;  1Y8P A;  2C0U A;  4P79 A;  3BNH A;  1EGE A;  5K3J A;  5B6B A;  1JM6 A;  1RX0 A;  4KTO A;  2JBT A;  2YYI A;  2ZO5 A;  2R02 A;  3D9D A;  2BU6 A;  2ZDY A;  4L38 A;  3OWA A;  4LQS B;  1EGD A;  1RJ4 A;  2FON A;  2R0N A;  2ZAF A;  1GJV A;  5GJW E;  3TZ5 A;  3CRL A;  3MDD A;  2IX6 A;  4IRN A;  2AZE A;  4F0X A;  3VKG A;  4KSF A;  2QR4 A;  1QDB A;  2WBI A;  4Q5B A;  3M9V A;  2OR0 A;  3D9E A;  3VAD A;  3S7W A;  3MPJ A;  4HKS A;  1Y0V A;  3KML A;  2YYJ A;  5BRK A;  4FF1 A;  4MPN A;  2JBR A;  3GNC A;  4RM7 A;  2OEX A;  5BRM A;  2E0A A;  1XFX A;  4L1F A;  1RJ1 A;  3OIB A;  1GU6 A;  2VIG A; 
#chains in the Genus database with same CATH homology
 5BRM A;  4LQQ B;  1PI1 A;  4JIZ A;  4LQS B;  5B6B A;  1R3B A;  4J1V A;  5B5W A;  5B5V A;  5BRK A;  2HJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...