5BRKA

Pmob1-lats1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
192
Chain Sequence
SKFKPKKNIPEELLKHAEALGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/signaling protein
molecule keywords MOB kinase activator 1A
publication title Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 192
sequence length 203
ec nomenclature
pdb deposition date 2015-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5brkA00
1R3BA 4LQSB 5BRKA 5B6BA 4J1VA 2HJNA 5B5WA 5B5VA 5BRMA 4LQQB 1PI1A 4JIZA
chains in the Genus database with same CATH superfamily
1K93A 4ZXVA 2XQRB 3F29A 4W9UA 4L3XA 4H81A 4U83A 1S26A 4FF3A 3CRKA 4H85A 4H7QA 3C2PA 1K90A 3D9FA 4Q17A 3UBRA 2PG0A 1JQIA 2RDZA 4HKSA 3LGQA 4JIZA 2Q8HA 3AFEA 3OWMA 4FF1A 2JIFA 2CJ8A 3D2RA 1X91A 2R03A 3BNFA 2BU6A 5B6BA 1XFVA 3D9GA 4AKGA 3LG1A 3MDDA 5GJWE 4E02A 3C3LA 4FF2A 4F0XA 4Q4UA 1XFZA 1SC5A 1Y8OA 1FS8A 2Z1QA 3EONA 2R05A 2WBIA 4L1FA 2OEVA 4P13A 4MP2A 2DDHA 4MP7A 3RKHA 4KS9A 2E80A 1RP3A 3FO3A 1X90A 1RJ4A 3NF4A 4IRNA 3Q0AA 4AI6A 2VR0A 5K3IA 4KSAA 5M4MA 3MXLA 1FS7A 4HR3A 2DVLA 4J1VA 3X0YA 3TZ0A 5B5WA 1IS2A 2CX9A 2IX6A 3AFFA 3R7KA 3P4TA 1PI1A 1GKZA 4FF4A 3OWAA 3CE2A 2R0NA 4LQSB 3SCEA 2R02A 4V26A 2Q8GA 4KTOA 2PO4A 2ZO5A 5M4NA 3GQTA 1QDBA 4RM7A 2FONA 4KCFA 4WJYA 2OJQA 3SWOA 1GU6A 1GKXA 2YYGA 3Q23A 3TTBA 1SIRA 2XS1A 2FP1A 5M4KA 1Y0VA 3OIBA 3UU9A 3PFDA 4E00A 1RX0A 1FS9A 2JBRA 2E0AA 1Y8NA 3II9A 3TZ4A 4MPNA 3D9EA 1OAHA 3FCJA 4Q1OA 1LVCA 4M9AA 1R2JA 3X29A 3Q22A 2D29A 4NXLA 2CJ6A 1EGCA 2YYJA 3Q24A 5BRKA 2VIGA 3MPJA 1GJVA 2FP2A 2Q8FA 2E81A 2OEXA 3BNHA 3GM6A 1WS9A 3S7WA 4MPEA 3VKGA 4XVXA 1XG2B 2R0MA 4AKIA 2OR0A 2YYKA 3VADA 1BUCA 2YYIA 1UKWA 2GBBA 3D1IA 3M9VA 1UDYA 2BU5A 4HKRA 5K3JA 3TZ5A 4ZYJA 3TORA 2JBSA 4Q5CA 4X28A 2YYMA 1RJ1A 2EC5A 1EGDA 3HWCA 4OO2A 3BNGA 1Y8PA 2J7AA 2PNRA 2YYLA 2HJNA 3CRLA 5M4PA 2RF7A 4L3YA 2XS8A 5BRMA 1U8VA 2ZDXA 4G97A 1K8TA 3MKHA 1IVHA 3GNCA 1R3BA 5J71A 2IX5A 2JBTA 3KMLA 3N0RA 3B96A 2C12A 4N5FA 4O5MA 2REHA 1SIQA 3SXQA 1XFXA 3MPIA 2EBHX 2C0UA 2QR4A 2YGWA 2BU7A 1EGEA 3EOMA 2CJ7A 4IV6A 5GJVE 1PK0A 2BU2A 2BTZA 3BNJA 2AZEA 2BU8A 4P79A 3X0XA 4DOYA 1SK6A 2A1TA 1XFWA 2CJ4A 4X28C 2LFWA 1T9GA 4JEKA 1W07A 2AO2A 1X8ZA 5K3GA 2EBFX 3C46A 4KSFA 1JM6A 4Q5BA 5B5VA 3D9DA 4FZ4A 2VF1A 2ZKJA 2EBAA 2F6LA 3SF6A 4QICA 4E01A 2ZAFA 2Q8IA 5J6AA 4AKHA 4Q0TA 3D6BA 3MMOA 2CJ5A 4JIOA 2UXWA 4LQQB 4MPCA 3L1TA 1XFUA 3MDEA 3TZ2A 4DZYA 2OT4A 4L38A 1XFYA 2RFQA 4G5EA 5K3HA 3VKHA 2ZDYA 4V25A 4L3ZA
chains in the Genus database with same CATH topology
1R3BA 4LQSB 5BRKA 5B6BA 4J1VA 2HJNA 5B5WA 5B5VA 5BRMA 4LQQB 1PI1A 4JIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3B A;  4LQS B;  5BRK A;  5B6B A;  4J1V A;  2HJN A;  5B5W A;  5B5V A;  5BRM A;  4LQQ B;  1PI1 A;  4JIZ A; 
#chains in the Genus database with same CATH topology
 1K93 A;  4ZXV A;  2XQR B;  3F29 A;  4W9U A;  4L3X A;  4H81 A;  4U83 A;  1S26 A;  4FF3 A;  3CRK A;  4H85 A;  4H7Q A;  3C2P A;  1K90 A;  3D9F A;  4Q17 A;  3UBR A;  2PG0 A;  1JQI A;  2RDZ A;  4HKS A;  3LGQ A;  4JIZ A;  2Q8H A;  3AFE A;  3OWM A;  4FF1 A;  2JIF A;  2CJ8 A;  3D2R A;  1X91 A;  2R03 A;  3BNF A;  2BU6 A;  5B6B A;  1XFV A;  3D9G A;  4AKG A;  3LG1 A;  3MDD A;  5GJW E;  4E02 A;  3C3L A;  4FF2 A;  4F0X A;  4Q4U A;  1XFZ A;  1SC5 A;  1Y8O A;  1FS8 A;  2Z1Q A;  3EON A;  2R05 A;  2WBI A;  4L1F A;  2OEV A;  4P13 A;  4MP2 A;  2DDH A;  4MP7 A;  3RKH A;  4KS9 A;  2E80 A;  1RP3 A;  3FO3 A;  1X90 A;  1RJ4 A;  3NF4 A;  4IRN A;  3Q0A A;  4AI6 A;  2VR0 A;  5K3I A;  4KSA A;  5M4M A;  3MXL A;  1FS7 A;  4HR3 A;  2DVL A;  4J1V A;  3X0Y A;  3TZ0 A;  5B5W A;  1IS2 A;  2CX9 A;  2IX6 A;  3AFF A;  3R7K A;  3P4T A;  1PI1 A;  1GKZ A;  4FF4 A;  3OWA A;  3CE2 A;  2R0N A;  4LQS B;  3SCE A;  2R02 A;  4V26 A;  2Q8G A;  4KTO A;  2PO4 A;  2ZO5 A;  5M4N A;  3GQT A;  1QDB A;  4RM7 A;  2FON A;  4KCF A;  4WJY A;  2OJQ A;  3SWO A;  1GU6 A;  1GKX A;  2YYG A;  3Q23 A;  3TTB A;  1SIR A;  2XS1 A;  2FP1 A;  5M4K A;  1Y0V A;  3OIB A;  3UU9 A;  3PFD A;  4E00 A;  1RX0 A;  1FS9 A;  2JBR A;  2E0A A;  1Y8N A;  3II9 A;  3TZ4 A;  4MPN A;  3D9E A;  1OAH A;  3FCJ A;  4Q1O A;  1LVC A;  4M9A A;  1R2J A;  3X29 A;  3Q22 A;  2D29 A;  4NXL A;  2CJ6 A;  1EGC A;  2YYJ A;  3Q24 A;  5BRK A;  2VIG A;  3MPJ A;  1GJV A;  2FP2 A;  2Q8F A;  2E81 A;  2OEX A;  3BNH A;  3GM6 A;  1WS9 A;  3S7W A;  4MPE A;  3VKG A;  4XVX A;  1XG2 B;  2R0M A;  4AKI A;  2OR0 A;  2YYK A;  3VAD A;  1BUC A;  2YYI A;  1UKW A;  2GBB A;  3D1I A;  3M9V A;  1UDY A;  2BU5 A;  4HKR A;  5K3J A;  3TZ5 A;  4ZYJ A;  3TOR A;  2JBS A;  4Q5C A;  4X28 A;  2YYM A;  1RJ1 A;  2EC5 A;  1EGD A;  3HWC A;  4OO2 A;  3BNG A;  1Y8P A;  2J7A A;  2PNR A;  2YYL A;  2HJN A;  3CRL A;  5M4P A;  2RF7 A;  4L3Y A;  2XS8 A;  5BRM A;  1U8V A;  2ZDX A;  4G97 A;  1K8T A;  3MKH A;  1IVH A;  3GNC A;  1R3B A;  5J71 A;  2IX5 A;  2JBT A;  3KML A;  3N0R A;  3B96 A;  2C12 A;  4N5F A;  4O5M A;  2REH A;  1SIQ A;  3SXQ A;  1XFX A;  3MPI A;  2EBH X;  2C0U A;  2QR4 A;  2YGW A;  2BU7 A;  1EGE A;  3EOM A;  2CJ7 A;  4IV6 A;  5GJV E;  1PK0 A;  2BU2 A;  2BTZ A;  3BNJ A;  2AZE A;  2BU8 A;  4P79 A;  3X0X A;  4DOY A;  1SK6 A;  2A1T A;  1XFW A;  2CJ4 A;  4X28 C;  2LFW A;  1T9G A;  4JEK A;  1W07 A;  2AO2 A;  1X8Z A;  5K3G A;  2EBF X;  3C46 A;  4KSF A;  1JM6 A;  4Q5B A;  5B5V A;  3D9D A;  4FZ4 A;  2VF1 A;  2ZKJ A;  2EBA A;  2F6L A;  3SF6 A;  4QIC A;  4E01 A;  2ZAF A;  2Q8I A;  5J6A A;  4AKH A;  4Q0T A;  3D6B A;  3MMO A;  2CJ5 A;  4JIO A;  2UXW A;  4LQQ B;  4MPC A;  3L1T A;  1XFU A;  3MDE A;  3TZ2 A;  4DZY A;  2OT4 A;  4L38 A;  1XFY A;  2RFQ A;  4G5E A;  5K3H A;  3VKH A;  2ZDY A;  4V25 A;  4L3Z A; 
#chains in the Genus database with same CATH homology
 1R3B A;  4LQS B;  5BRK A;  5B6B A;  4J1V A;  2HJN A;  5B5W A;  5B5V A;  5BRM A;  4LQQ B;  1PI1 A;  4JIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...