3X29A

Crystal structure of mouse claudin-19 in complex with c-terminal fragment of clostridium perfringens enterotoxin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
166
Chain Sequence
SGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASGQVQCKLYDGHIQSARALMVVAVLLGFVAMVLSVVGMKNPTAKSRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGSFLAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Claudin-19
publication title Structural insight into tight junction disassembly by Clostridium perfringens enterotoxin
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell adhesion
total genus 58
structure length 166
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00822 PMP22_Claudin PMP-22/EMP/MP20/Claudin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.150 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 3x29A00
3X29A 5GJWE 5GJVE 4P79A
chains in the Genus database with same CATH superfamily
3TTBA 4DOYA 4L3XA 2R02A 4P13A 1R3BA 1SC5A 1K8TA 2BTZA 3C2PA 3FCJA 3TZ5A 1X8ZA 5K3GA 4IV6A 4MP7A 4U83A 5BRKA 2Z1QA 5J6AA 5M4MA 2R03A 3Q24A 4AI6A 1Y8OA 3MKHA 4N5FA 1SIRA 2VIGA 1W07A 2EBAA 1XFYA 3D2RA 4FZ4A 1K93A 1GKXA 1S26A 3BNHA 4H81A 4MP2A 2J7AA 5BRMA 2YYJA 2ZKJA 2YYLA 2RF7A 3D9DA 4H85A 1BUCA 3MXLA 3Q22A 2BU7A 2WBIA 3AFFA 3VADA 4HKSA 3II9A 2AO2A 1SIQA 3GQTA 3C46A 3MDDA 2R0MA 4Q4UA 2ZAFA 2HJNA 2IX5A 3HWCA 4KSFA 4P79A 2CX9A 2D29A 2FONA 5B5WA 3SXQA 3MPJA 1XFUA 3KMLA 1SK6A 1R2JA 2Q8HA 3D6BA 4F0XA 3EONA 3X29A 3D1IA 3X0XA 1RJ1A 3CE2A 2OEVA 2JBSA 3GM6A 4JIZA 3MMOA 4DZYA 3R7KA 2R0NA 2F6LA 1UDYA 2YYMA 3B96A 4Q17A 3D9FA 3P4TA 1GU6A 2OR0A 2Q8FA 2PO4A 4MPCA 3LGQA 1RP3A 1EGCA 1JM6A 4XVXA 3VKGA 3SCEA 1WS9A 4JIOA 3GNCA 4OO2A 3TORA 3TZ0A 4AKHA 2Q8IA 4L3ZA 1PI1A 1FS9A 2LFWA 1Y8NA 2XS8A 4X28C 4AKIA 2YGWA 2E0AA 2FP1A 1U8VA 2BU2A 3F29A 3MDEA 5GJVE 4WJYA 4FF2A 3OWMA 1XFZA 1FS7A 1IS2A 2JBTA 3D9EA 4KTOA 3CRLA 4E02A 3BNFA 5K3JA 3TZ2A 1X91A 2RFQA 1XFWA 4KCFA 2FP2A 2BU5A 2OJQA 2PNRA 4KSAA 2A1TA 4Q5CA 2E81A 2AZEA 3SF6A 3D9GA 2CJ6A 2OEXA 3OWAA 3PFDA 3SWOA 2C12A 4MPNA 4L1FA 4Q1OA 1PK0A 3M9VA 4MPEA 4W9UA 3Q0AA 3TZ4A 2YYKA 5B5VA 2ZDXA 2UXWA 4G5EA 1X90A 3AFEA 4H7QA 1OAHA 5J71A 3X0YA 4AKGA 4ZXVA 2CJ4A 4RM7A 4V26A 2Q8GA 5M4PA 4L38A 2REHA 5GJWE 2ZDYA 4KS9A 2GBBA 1FS8A 4E00A 3BNGA 1UKWA 4NXLA 3VKHA 2DVLA 2XS1A 2C0UA 3UU9A 5B6BA 2CJ7A 1JQIA 4V25A 3Q23A 3N0RA 3UBRA 1IVHA 1Y8PA 2VF1A 4JEKA 1EGDA 3LG1A 2VR0A 2R05A 1XFXA 4E01A 3CRKA 1RX0A 1QDBA 4Q5BA 2IX6A 4ZYJA 1K90A 2EBHX 4HR3A 1RJ4A 2JIFA 1Y0VA 3EOMA 1XG2B 2YYIA 3S7WA 2RDZA 2QR4A 2ZO5A 2EBFX 2DDHA 4IRNA 3NF4A 1EGEA 2BU6A 2E80A 4O5MA 1T9GA 2XQRB 4LQQB 5M4KA 4J1VA 2BU8A 3FO3A 5M4NA 5K3HA 2PG0A 4X28A 1XFVA 4FF1A 2OT4A 3L1TA 4L3YA 1GJVA 2CJ5A 5K3IA 4G97A 4M9AA 3C3LA 1GKZA 2JBRA 3BNJA 4FF4A 3RKHA 3MPIA 4LQSB 4HKRA 2EC5A 4QICA 1LVCA 2YYGA 3OIBA 4FF3A 2CJ8A 4Q0TA
chains in the Genus database with same CATH topology
1XFWA 1XFXA 1XFUA 2FP2A 1SK6A 3KMLA 4F0XA 1SC5A 4KSAA 3X29A 1K8TA 1K90A 2AZEA 3C2PA 2EBHX 3CE2A 1Y0VA 3Q0AA 1PK0A 2F6LA 2QR4A 3Q24A 4AI6A 2EBFX 2PO4A 1XFYA 4FZ4A 1RP3A 1K93A 4AKGA 1S26A 3VKGA 4AKHA 2LFWA 4AKIA 5GJWE 4KS9A 2YGWA 2GBBA 1XFVA 2FP1A 5GJVE 3Q22A 4FF1A 3VKHA 4HKSA 4FF2A 2AO2A 1XFZA 3C3LA 4G97A 4FF4A 3C46A 3Q23A 4HKRA 2EC5A 3N0RA 1LVCA 4P79A 4KSFA 4QICA 2VF1A 4FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X29 A;  5GJW E;  5GJV E;  4P79 A; 
#chains in the Genus database with same CATH topology
 3TTB A;  4DOY A;  4L3X A;  2R02 A;  4P13 A;  1R3B A;  1SC5 A;  1K8T A;  2BTZ A;  3C2P A;  3FCJ A;  3TZ5 A;  1X8Z A;  5K3G A;  4IV6 A;  4MP7 A;  4U83 A;  5BRK A;  2Z1Q A;  5J6A A;  5M4M A;  2R03 A;  3Q24 A;  4AI6 A;  1Y8O A;  3MKH A;  4N5F A;  1SIR A;  2VIG A;  1W07 A;  2EBA A;  1XFY A;  3D2R A;  4FZ4 A;  1K93 A;  1GKX A;  1S26 A;  3BNH A;  4H81 A;  4MP2 A;  2J7A A;  5BRM A;  2YYJ A;  2ZKJ A;  2YYL A;  2RF7 A;  3D9D A;  4H85 A;  1BUC A;  3MXL A;  3Q22 A;  2BU7 A;  2WBI A;  3AFF A;  3VAD A;  4HKS A;  3II9 A;  2AO2 A;  1SIQ A;  3GQT A;  3C46 A;  3MDD A;  2R0M A;  4Q4U A;  2ZAF A;  2HJN A;  2IX5 A;  3HWC A;  4KSF A;  4P79 A;  2CX9 A;  2D29 A;  2FON A;  5B5W A;  3SXQ A;  3MPJ A;  1XFU A;  3KML A;  1SK6 A;  1R2J A;  2Q8H A;  3D6B A;  4F0X A;  3EON A;  3X29 A;  3D1I A;  3X0X A;  1RJ1 A;  3CE2 A;  2OEV A;  2JBS A;  3GM6 A;  4JIZ A;  3MMO A;  4DZY A;  3R7K A;  2R0N A;  2F6L A;  1UDY A;  2YYM A;  3B96 A;  4Q17 A;  3D9F A;  3P4T A;  1GU6 A;  2OR0 A;  2Q8F A;  2PO4 A;  4MPC A;  3LGQ A;  1RP3 A;  1EGC A;  1JM6 A;  4XVX A;  3VKG A;  3SCE A;  1WS9 A;  4JIO A;  3GNC A;  4OO2 A;  3TOR A;  3TZ0 A;  4AKH A;  2Q8I A;  4L3Z A;  1PI1 A;  1FS9 A;  2LFW A;  1Y8N A;  2XS8 A;  4X28 C;  4AKI A;  2YGW A;  2E0A A;  2FP1 A;  1U8V A;  2BU2 A;  3F29 A;  3MDE A;  5GJV E;  4WJY A;  4FF2 A;  3OWM A;  1XFZ A;  1FS7 A;  1IS2 A;  2JBT A;  3D9E A;  4KTO A;  3CRL A;  4E02 A;  3BNF A;  5K3J A;  3TZ2 A;  1X91 A;  2RFQ A;  1XFW A;  4KCF A;  2FP2 A;  2BU5 A;  2OJQ A;  2PNR A;  4KSA A;  2A1T A;  4Q5C A;  2E81 A;  2AZE A;  3SF6 A;  3D9G A;  2CJ6 A;  2OEX A;  3OWA A;  3PFD A;  3SWO A;  2C12 A;  4MPN A;  4L1F A;  4Q1O A;  1PK0 A;  3M9V A;  4MPE A;  4W9U A;  3Q0A A;  3TZ4 A;  2YYK A;  5B5V A;  2ZDX A;  2UXW A;  4G5E A;  1X90 A;  3AFE A;  4H7Q A;  1OAH A;  5J71 A;  3X0Y A;  4AKG A;  4ZXV A;  2CJ4 A;  4RM7 A;  4V26 A;  2Q8G A;  5M4P A;  4L38 A;  2REH A;  5GJW E;  2ZDY A;  4KS9 A;  2GBB A;  1FS8 A;  4E00 A;  3BNG A;  1UKW A;  4NXL A;  3VKH A;  2DVL A;  2XS1 A;  2C0U A;  3UU9 A;  5B6B A;  2CJ7 A;  1JQI A;  4V25 A;  3Q23 A;  3N0R A;  3UBR A;  1IVH A;  1Y8P A;  2VF1 A;  4JEK A;  1EGD A;  3LG1 A;  2VR0 A;  2R05 A;  1XFX A;  4E01 A;  3CRK A;  1RX0 A;  1QDB A;  4Q5B A;  2IX6 A;  4ZYJ A;  1K90 A;  2EBH X;  4HR3 A;  1RJ4 A;  2JIF A;  1Y0V A;  3EOM A;  1XG2 B;  2YYI A;  3S7W A;  2RDZ A;  2QR4 A;  2ZO5 A;  2EBF X;  2DDH A;  4IRN A;  3NF4 A;  1EGE A;  2BU6 A;  2E80 A;  4O5M A;  1T9G A;  2XQR B;  4LQQ B;  5M4K A;  4J1V A;  2BU8 A;  3FO3 A;  5M4N A;  5K3H A;  2PG0 A;  4X28 A;  1XFV A;  4FF1 A;  2OT4 A;  3L1T A;  4L3Y A;  1GJV A;  2CJ5 A;  5K3I A;  4G97 A;  4M9A A;  3C3L A;  1GKZ A;  2JBR A;  3BNJ A;  4FF4 A;  3RKH A;  3MPI A;  4LQS B;  4HKR A;  2EC5 A;  4QIC A;  1LVC A;  2YYG A;  3OIB A;  4FF3 A;  2CJ8 A;  4Q0T A; 
#chains in the Genus database with same CATH homology
 1XFW A;  1XFX A;  1XFU A;  2FP2 A;  1SK6 A;  3KML A;  4F0X A;  1SC5 A;  4KSA A;  3X29 A;  1K8T A;  1K90 A;  2AZE A;  3C2P A;  2EBH X;  3CE2 A;  1Y0V A;  3Q0A A;  1PK0 A;  2F6L A;  2QR4 A;  3Q24 A;  4AI6 A;  2EBF X;  2PO4 A;  1XFY A;  4FZ4 A;  1RP3 A;  1K93 A;  4AKG A;  1S26 A;  3VKG A;  4AKH A;  2LFW A;  4AKI A;  5GJW E;  4KS9 A;  2YGW A;  2GBB A;  1XFV A;  2FP1 A;  5GJV E;  3Q22 A;  4FF1 A;  3VKH A;  4HKS A;  4FF2 A;  2AO2 A;  1XFZ A;  3C3L A;  4G97 A;  4FF4 A;  3C46 A;  3Q23 A;  4HKR A;  2EC5 A;  3N0R A;  1LVC A;  4P79 A;  4KSF A;  4QIC A;  2VF1 A;  4FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...