3X29A

Crystal structure of mouse claudin-19 in complex with c-terminal fragment of clostridium perfringens enterotoxin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
182
structure length
166
Chain Sequence
SGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASGQVQCKLYDGHIQSARALMVVAVLLGFVAMVLSVVGMKNPTAKSRVAISGGALFLLAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAMLGGSFLAAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Claudin-19
publication title Structural insight into tight junction disassembly by Clostridium perfringens enterotoxin
pubmed doi rcsb
source organism Mus musculus
total genus 58
structure length 166
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00822 PMP22_Claudin PMP-22/EMP/MP20/Claudin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.150 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 3x29A00
5GJWE 3X29A 5GJVE 4P79A
chains in the Genus database with same CATH superfamily
2UXWA 3X29A 2JIFA 1EGCA 2BU6A 3TZ2A 2R0MA 5B6BA 5K3IA 1JM6A 3S7WA 2Q8HA 4AKHA 2VF1A 2CJ6A 4L1FA 1LVCA 2RF7A 4JIZA 4P79A 3TZ5A 2ZAFA 5J71A 4L3YA 3D6BA 4Q4UA 4DZYA 3CRKA 3L1TA 1S26A 1Y0VA 5M4NA 1SC5A 1K90A 4ZYJA 1GKXA 2CX9A 2C12A 3FCJA 1EGEA 2BU5A 5M4KA 3X0XA 2ZKJA 1XFYA 4L3ZA 4MPEA 5M4MA 2E80A 2OT4A 3D9EA 2DVLA 4AKIA 5M4PA 1SK6A 2XQRB 4JIOA 1JQIA 2ZDXA 1GJVA 2VIGA 2D29A 2YYLA 3Q23A 1K93A 4E01A 4HR3A 4MPNA 5K3JA 4P13A 1PK0A 2R02A 2A1TA 3GNCA 3MDEA 3TORA 4FF1A 1XFWA 2VR0A 3LG1A 4IRNA 2PNRA 1XFZA 5J6AA 2EBAA 3C3LA 2PO4A 4Q5BA 2BU8A 3GM6A 4MP2A 3NF4A 4KSFA 3TZ4A 4H81A 2BU2A 4FF3A 2CJ5A 2OEVA 2ZO5A 3HWCA 4X28A 3MPIA 3CE2A 1SIRA 3UBRA 4X28C 2C0UA 1Y8NA 2E81A 2RFQA 2JBTA 3B96A 4XVXA 4JEKA 4HKRA 5K3GA 1IS2A 3AFEA 3LGQA 3MXLA 2Q8GA 3II9A 2YYJA 4MP7A 2YYKA 2JBRA 3SF6A 2REHA 2ZDYA 4J1VA 4E02A 4KCFA 1RP3A 3FO3A 1W07A 1K8TA 1BUCA 3OIBA 1PI1A 1Y8OA 3BNFA 4QICA 3P4TA 4V25A 3BNHA 1FS7A 4Q0TA 4IV6A 4Q1OA 5B5WA 3KMLA 1XFUA 3M9VA 4NXLA 3SWOA 2YYMA 1X8ZA 2BU7A 2BTZA 3MPJA 5B5VA 4U83A 3VKGA 2CJ7A 1X90A 2OR0A 3UU9A 2F6LA 4HKSA 3PFDA 2EBFX 3D9GA 3D9DA 4DOYA 2XS8A 1GKZA 2IX6A 2LFWA 2R03A 3BNJA 3VADA 3Q24A 3D9FA 4G97A 2AZEA 3VKHA 2WBIA 3Q22A 2CJ4A 4H85A 1R3BA 1UKWA 5GJVE 1RJ4A 2QR4A 2E0AA 2FP1A 3AFFA 4O5MA 4V26A 4W9UA 2YGWA 2Q8IA 3X0YA 4LQQB 4LQSB 1Y8PA 4KTOA 2XS1A 4N5FA 1FS8A 3C46A 3N0RA 4M9AA 3R7KA 1SIQA 4WJYA 4ZXVA 2YYIA 2OEXA 4L38A 2FP2A 2AO2A 1R2JA 1UDYA 4Q17A 1RX0A 2CJ8A 1T9GA 1X91A 1GU6A 2J7AA 2YYGA 3BNGA 3RKHA 3SXQA 1EGDA 3TZ0A 2IX5A 2R05A 4KS9A 1XG2B 4F0XA 2JBSA 5K3HA 3OWMA 1OAHA 3F29A 4E00A 2OJQA 1RJ1A 3GQTA 4FZ4A 4Q5CA 5BRMA 3EOMA 3TTBA 2EBHX 5BRKA 4FF2A 2PG0A 1XFXA 2FONA 1U8VA 3CRLA 4MPCA 2R0NA 4H7QA 4KSAA 4L3XA 4RM7A 3OWAA 4AKGA 5GJWE 1QDBA 2RDZA 3MDDA 1WS9A 2GBBA 1IVHA 3D2RA 3EONA 3MMOA 2DDHA 2HJNA 4FF4A 3SCEA 3C2PA 3MKHA 2Q8FA 3Q0AA 2EC5A 2Z1QA 4AI6A 4OO2A 4G5EA 1FS9A 3D1IA 1XFVA
chains in the Genus database with same CATH topology
4FF1A 3KMLA 1XFUA 3X29A 1XFWA 4AKHA 1XFZA 2VF1A 3C3LA 3VKGA 2PO4A 4FF3A 1LVCA 4KS9A 4KSFA 4P79A 4F0XA 2F6LA 4HKSA 2EBFX 1S26A 1Y0VA 3CE2A 4FZ4A 1SC5A 1K90A 2LFWA 2EBHX 3Q24A 4FF2A 1XFXA 4G97A 2AZEA 3VKHA 4HKRA 3Q22A 3Q0AA 4KSAA 1XFYA 5GJVE 4AKGA 2QR4A 5GJWE 2FP1A 4AKIA 2GBBA 1SK6A 2YGWA 1RP3A 3C46A 3N0RA 3Q23A 1K8TA 4FF4A 3C2PA 1K93A 4AI6A 2EC5A 4QICA 2FP2A 2AO2A 1XFVA 1PK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJW E;  3X29 A;  5GJV E;  4P79 A; 
#chains in the Genus database with same CATH topology
 2UXW A;  3X29 A;  2JIF A;  1EGC A;  2BU6 A;  3TZ2 A;  2R0M A;  5B6B A;  5K3I A;  1JM6 A;  3S7W A;  2Q8H A;  4AKH A;  2VF1 A;  2CJ6 A;  4L1F A;  1LVC A;  2RF7 A;  4JIZ A;  4P79 A;  3TZ5 A;  2ZAF A;  5J71 A;  4L3Y A;  3D6B A;  4Q4U A;  4DZY A;  3CRK A;  3L1T A;  1S26 A;  1Y0V A;  5M4N A;  1SC5 A;  1K90 A;  4ZYJ A;  1GKX A;  2CX9 A;  2C12 A;  3FCJ A;  1EGE A;  2BU5 A;  5M4K A;  3X0X A;  2ZKJ A;  1XFY A;  4L3Z A;  4MPE A;  5M4M A;  2E80 A;  2OT4 A;  3D9E A;  2DVL A;  4AKI A;  5M4P A;  1SK6 A;  2XQR B;  4JIO A;  1JQI A;  2ZDX A;  1GJV A;  2VIG A;  2D29 A;  2YYL A;  3Q23 A;  1K93 A;  4E01 A;  4HR3 A;  4MPN A;  5K3J A;  4P13 A;  1PK0 A;  2R02 A;  2A1T A;  3GNC A;  3MDE A;  3TOR A;  4FF1 A;  1XFW A;  2VR0 A;  3LG1 A;  4IRN A;  2PNR A;  1XFZ A;  5J6A A;  2EBA A;  3C3L A;  2PO4 A;  4Q5B A;  2BU8 A;  3GM6 A;  4MP2 A;  3NF4 A;  4KSF A;  3TZ4 A;  4H81 A;  2BU2 A;  4FF3 A;  2CJ5 A;  2OEV A;  2ZO5 A;  3HWC A;  4X28 A;  3MPI A;  3CE2 A;  1SIR A;  3UBR A;  4X28 C;  2C0U A;  1Y8N A;  2E81 A;  2RFQ A;  2JBT A;  3B96 A;  4XVX A;  4JEK A;  4HKR A;  5K3G A;  1IS2 A;  3AFE A;  3LGQ A;  3MXL A;  2Q8G A;  3II9 A;  2YYJ A;  4MP7 A;  2YYK A;  2JBR A;  3SF6 A;  2REH A;  2ZDY A;  4J1V A;  4E02 A;  4KCF A;  1RP3 A;  3FO3 A;  1W07 A;  1K8T A;  1BUC A;  3OIB A;  1PI1 A;  1Y8O A;  3BNF A;  4QIC A;  3P4T A;  4V25 A;  3BNH A;  1FS7 A;  4Q0T A;  4IV6 A;  4Q1O A;  5B5W A;  3KML A;  1XFU A;  3M9V A;  4NXL A;  3SWO A;  2YYM A;  1X8Z A;  2BU7 A;  2BTZ A;  3MPJ A;  5B5V A;  4U83 A;  3VKG A;  2CJ7 A;  1X90 A;  2OR0 A;  3UU9 A;  2F6L A;  4HKS A;  3PFD A;  2EBF X;  3D9G A;  3D9D A;  4DOY A;  2XS8 A;  1GKZ A;  2IX6 A;  2LFW A;  2R03 A;  3BNJ A;  3VAD A;  3Q24 A;  3D9F A;  4G97 A;  2AZE A;  3VKH A;  2WBI A;  3Q22 A;  2CJ4 A;  4H85 A;  1R3B A;  1UKW A;  5GJV E;  1RJ4 A;  2QR4 A;  2E0A A;  2FP1 A;  3AFF A;  4O5M A;  4V26 A;  4W9U A;  2YGW A;  2Q8I A;  3X0Y A;  4LQQ B;  4LQS B;  1Y8P A;  4KTO A;  2XS1 A;  4N5F A;  1FS8 A;  3C46 A;  3N0R A;  4M9A A;  3R7K A;  1SIQ A;  4WJY A;  4ZXV A;  2YYI A;  2OEX A;  4L38 A;  2FP2 A;  2AO2 A;  1R2J A;  1UDY A;  4Q17 A;  1RX0 A;  2CJ8 A;  1T9G A;  1X91 A;  1GU6 A;  2J7A A;  2YYG A;  3BNG A;  3RKH A;  3SXQ A;  1EGD A;  3TZ0 A;  2IX5 A;  2R05 A;  4KS9 A;  1XG2 B;  4F0X A;  2JBS A;  5K3H A;  3OWM A;  1OAH A;  3F29 A;  4E00 A;  2OJQ A;  1RJ1 A;  3GQT A;  4FZ4 A;  4Q5C A;  5BRM A;  3EOM A;  3TTB A;  2EBH X;  5BRK A;  4FF2 A;  2PG0 A;  1XFX A;  2FON A;  1U8V A;  3CRL A;  4MPC A;  2R0N A;  4H7Q A;  4KSA A;  4L3X A;  4RM7 A;  3OWA A;  4AKG A;  5GJW E;  1QDB A;  2RDZ A;  3MDD A;  1WS9 A;  2GBB A;  1IVH A;  3D2R A;  3EON A;  3MMO A;  2DDH A;  2HJN A;  4FF4 A;  3SCE A;  3C2P A;  3MKH A;  2Q8F A;  3Q0A A;  2EC5 A;  2Z1Q A;  4AI6 A;  4OO2 A;  4G5E A;  1FS9 A;  3D1I A;  1XFV A; 
#chains in the Genus database with same CATH homology
 4FF1 A;  3KML A;  1XFU A;  3X29 A;  1XFW A;  4AKH A;  1XFZ A;  2VF1 A;  3C3L A;  3VKG A;  2PO4 A;  4FF3 A;  1LVC A;  4KS9 A;  4KSF A;  4P79 A;  4F0X A;  2F6L A;  4HKS A;  2EBF X;  1S26 A;  1Y0V A;  3CE2 A;  4FZ4 A;  1SC5 A;  1K90 A;  2LFW A;  2EBH X;  3Q24 A;  4FF2 A;  1XFX A;  4G97 A;  2AZE A;  3VKH A;  4HKR A;  3Q22 A;  3Q0A A;  4KSA A;  1XFY A;  5GJV E;  4AKG A;  2QR4 A;  5GJW E;  2FP1 A;  4AKI A;  2GBB A;  1SK6 A;  2YGW A;  1RP3 A;  3C46 A;  3N0R A;  3Q23 A;  1K8T A;  4FF4 A;  3C2P A;  1K93 A;  4AI6 A;  2EC5 A;  4QIC A;  2FP2 A;  2AO2 A;  1XFV A;  1PK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...