2WBIA

Crystal structure of human acyl-coa dehydrogenase 11
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
404
structure length
394
Chain Sequence
VQTRKGQEVLIKVKHFMKQHILPAEKEVTEKWGKPLVIDKLKEMAKVEGLWNLFLPAVSGLSHVDYALIAEETGKCFFAPDVFNCQAPDTGNMEVLHLYGSEEQKKQWLEPLLQGNITSCFCMTEPDVASSDATNIECSIQRDEDSYVINGKKWWSSGAGNPKCKIAIVLGRTQNTSLSRHKQHSMILVPMNTPGVKIIRPLSVFGYTDNFHGGHFEIHFNQVRVPATNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERALQIMCERATQRIAFKKKLYAHEVVAHWIAESRIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA DEHYDROGENASE FAMILY MEMBER 11
publication title Crystal Structure of Human Acyl-Coa Dehydrogenase 11
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 146
structure length 394
sequence length 404
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain
A PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain
A PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.540.10 Mainly Alpha Orthogonal Bundle Butyryl-Coa Dehydrogenase, subunit A; domain 1 Acyl-CoA dehydrogenase/oxidase, N-terminal domain 2wbiA01
1.20.140.10 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A, domain 3 2wbiA03
2.40.110.10 Mainly Beta Beta Barrel Butyryl-CoA Dehydrogenase, subunit A; domain 2 Butyryl-CoA Dehydrogenase, subunit A, domain 2 2wbiA02
4P13A 3D9EA 3BNJA 2ZO5A 1FS8A 3II9A 4NXLA 3GQTA 2ZAFA 4L3ZA 1QDBA 2IX5A 2J7AA 1RX0A 4L1FA 4KTOA 3D9FA 2REHA 3F29A 4O5MA 1UKWA 3EOMA 4WJYA 3FCJA 3MKHA 2YYKA 3BNGA 2RF7A 3OWAA 3TORA 4IV6A 1SIRA 4Q4UA 4X28A 1OAHA 3SXQA 4ZYJA 2JBTA 4Q5BA 1EGCA 1FS9A 3MDDA 4JEKA 5K3HA 3R7KA 2YYMA 5K3GA 3SWOA 2OT4A 3AFEA 4Q1OA 3SF6A 2CX9A 2EBAA 3OIBA 3L1TA 5K3IA 3HWCA 3FO3A 3P4TA 3GM6A 4XVXA 3UU9A 4G5EA 2C0UA 3RKHA 4L38A 3MXLA 3PFDA 3M9VA 3BNHA 3D1IA 2E81A 1R2JA 2YYGA 4L3YA 1JQIA 4W9UA 2RDZA 2DDHA 1UDYA 3MPIA 4RM7A 3B96A 2A1TA 3MMOA 4N5FA 1WS9A 3TTBA 3MDEA 4OO2A 4X28C 2Z1QA 3OWMA 2R0NA 2JBRA 2RFQA 1IS2A 2OR0A 4U83A 1EGEA 3EONA 2WBIA 3D9GA 3X0YA 4ZXVA 2VR0A 4KCFA 4Q17A 2UXWA 4Q5CA 3UBRA 1W07A 2YYIA 2YYLA 3AFFA 2IX6A 3NF4A 3GNCA 2YYJA 4Q0TA 1FS7A 3X0XA 3MPJA 2C12A 2DVLA 1IVHA 1BUCA 1T9GA 1EGDA 1U8VA 4L3XA 3S7WA 4M9AA 3BNFA 3SCEA 3D9DA 2D29A 2E80A 2JIFA 2PG0A 2R0MA 5K3JA 3D6BA 3LGQA 2VIGA 2FONA 4IRNA 4DOYA 4HR3A 1SIQA 3LG1A 2JBSA 1GU6A
chains in the Genus database with same CATH superfamily
4P13A 3D9EA 4E00A 3BNJA 1XG2B 4JIOA 2ZO5A 1FS8A 1K90A 3II9A 2EC5A 4NXLA 3GQTA 1X91A 4FF2A 2ZAFA 4L3ZA 1QDBA 3TZ5A 2IX5A 2J7AA 1Y8PA 1RX0A 4MPCA 4L1FA 4KTOA 5B5WA 4FF4A 3D9FA 4LQSB 2REHA 5B6BA 3F29A 4O5MA 1UKWA 1Y0VA 3Q22A 3EOMA 5M4MA 4WJYA 3FCJA 3MKHA 2FP2A 2YYKA 3BNGA 4KSAA 2OEVA 2RF7A 3OWAA 5GJVE 3TORA 5J71A 4AI6A 2BU2A 4IV6A 2Q8FA 1SIRA 3VADA 4FF3A 4Q4UA 4X28A 1JM6A 1OAHA 1S26A 1X8ZA 2OJQA 3D2RA 4V25A 4MP2A 2CJ5A 3SXQA 4ZYJA 3TZ0A 1XFYA 2BTZA 2JBTA 4Q5BA 1EGCA 1FS9A 2CJ7A 4HKRA 3MDDA 4JEKA 5K3HA 3R7KA 2YYMA 1XFXA 5K3GA 3SWOA 2XS1A 4H7QA 2OT4A 2BU6A 3AFEA 2VF1A 4Q1OA 1RJ4A 4E02A 2F6LA 4AKIA 3SF6A 1RP3A 2LFWA 3TZ4A 5M4PA 2CX9A 1SC5A 2R05A 2EBAA 3OIBA 4KSFA 3L1TA 2BU5A 5K3IA 2R02A 3HWCA 1GKXA 1XFWA 2GBBA 3FO3A 3P4TA 3GM6A 4XVXA 3UU9A 4G5EA 2C0UA 3RKHA 4L38A 5BRKA 3MXLA 3PFDA 3M9VA 2CJ6A 3BNHA 1X90A 3D1IA 2E81A 4LQQB 3DJLA 1R2JA 5J6AA 5GJWE 4MPEA 4HKSA 1PI1A 1PK0A 2EBHX 3CE2A 3VKGA 2YYGA 4L3YA 1JQIA 1K8TA 1XFVA 4W9UA 2XQRB 5B5VA 2Q8IA 2ZDYA 4FF1A 5M4NA 3C3LA 2RDZA 2DDHA 1UDYA 3MPIA 4RM7A 1R3BA 3B96A 3C2PA 4FZ4A 2A1TA 3MMOA 4N5FA 1WS9A 3CRKA 3TTBA 4P79A 1GJVA 3MDEA 4H85A 1SK6A 4OO2A 4X28C 1Y8OA 4G97A 2Z1QA 3OWMA 2BU7A 1Y8NA 2R0NA 3Q24A 4MPNA 5M4KA 4H81A 2JBRA 1K93A 4QICA 2RFQA 1IS2A 2OR0A 4AKGA 4U83A 1EGEA 3EONA 2QR4A 2WBIA 2E0AA 1XFUA 3D9GA 2ZDXA 5BRMA 2AZEA 3X0YA 4ZXVA 2PO4A 4J1VA 4KS9A 2OEXA 3TZ2A 2VR0A 5EZ3A 4KCFA 3X29A 4Q17A 2UXWA 4JIZA 4Q5CA 3UBRA 1W07A 1GKZA 2YYIA 2YYLA 3AFFA 2IX6A 2XS8A 3NF4A 3GNCA 2YYJA 1LVCA 4Q0TA 1FS7A 2AO2A 3U33A 3X0XA 3MPJA 2C12A 2DVLA 1IVHA 1BUCA 1T9GA 2ZKJA 4MP7A 2R03A 2Q8HA 1EGDA 2CJ4A 1U8VA 2YGWA 3N0RA 1XFZA 4L3XA 3S7WA 3Q23A 4M9AA 2EBFX 2HJNA 3Q0AA 2PNRA 3BNFA 3SCEA 4F0XA 3D9DA 2Q8GA 1RJ1A 3C46A 2D29A 2E80A 2JIFA 3CRLA 3VKHA 2PG0A 2R0MA 5K3JA 3D6BA 2CJ8A 3LGQA 4AKHA 2VIGA 2FONA 4IRNA 4DOYA 4V26A 4HR3A 2FP1A 1SIQA 2BU8A 3LG1A 3KMLA 2JBSA 4DZYA 1GU6A 4E01A
chains in the Genus database with same CATH topology
4P13A 3D9EA 3BNJA 2ZO5A 1FS8A 3II9A 4NXLA 3GQTA 2ZAFA 4L3ZA 1QDBA 2IX5A 2J7AA 1RX0A 4L1FA 4KTOA 3D9FA 2REHA 3F29A 4O5MA 1UKWA 3EOMA 4WJYA 3FCJA 3MKHA 2YYKA 3BNGA 2RF7A 3OWAA 3TORA 4IV6A 1SIRA 4Q4UA 4X28A 1OAHA 3SXQA 4ZYJA 2JBTA 4Q5BA 1EGCA 1FS9A 3MDDA 4JEKA 5K3HA 3R7KA 2YYMA 5K3GA 3SWOA 2OT4A 3AFEA 4Q1OA 3SF6A 2CX9A 2EBAA 3OIBA 3L1TA 5K3IA 3HWCA 3FO3A 3P4TA 3GM6A 4XVXA 3UU9A 4G5EA 2C0UA 3RKHA 4L38A 3MXLA 3PFDA 3M9VA 3BNHA 3D1IA 2E81A 1R2JA 2YYGA 4L3YA 1JQIA 4W9UA 2RDZA 2DDHA 1UDYA 3MPIA 4RM7A 3B96A 2A1TA 3MMOA 4N5FA 1WS9A 3TTBA 3MDEA 4OO2A 4X28C 2Z1QA 3OWMA 2R0NA 2JBRA 2RFQA 1IS2A 2OR0A 4U83A 1EGEA 3EONA 2WBIA 3D9GA 3X0YA 4ZXVA 2VR0A 4KCFA 4Q17A 2UXWA 4Q5CA 3UBRA 1W07A 2YYIA 2YYLA 3AFFA 2IX6A 3NF4A 3GNCA 2YYJA 4Q0TA 1FS7A 3X0XA 3MPJA 2C12A 2DVLA 1IVHA 1BUCA 1T9GA 1EGDA 1U8VA 4L3XA 3S7WA 4M9AA 3BNFA 3SCEA 3D9DA 2D29A 2E80A 2JIFA 2PG0A 2R0MA 5K3JA 3D6BA 3LGQA 2VIGA 2FONA 4IRNA 4DOYA 4HR3A 1SIQA 3LG1A 2JBSA 1GU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P13 A;  3D9E A;  3BNJ A;  2ZO5 A;  1FS8 A;  3II9 A;  4NXL A;  3GQT A;  2ZAF A;  4L3Z A;  1QDB A;  2IX5 A;  2J7A A;  1RX0 A;  4L1F A;  4KTO A;  3D9F A;  2REH A;  3F29 A;  4O5M A;  1UKW A;  3EOM A;  4WJY A;  3FCJ A;  3MKH A;  2YYK A;  3BNG A;  2RF7 A;  3OWA A;  3TOR A;  4IV6 A;  1SIR A;  4Q4U A;  4X28 A;  1OAH A;  3SXQ A;  4ZYJ A;  2JBT A;  4Q5B A;  1EGC A;  1FS9 A;  3MDD A;  4JEK A;  5K3H A;  3R7K A;  2YYM A;  5K3G A;  3SWO A;  2OT4 A;  3AFE A;  4Q1O A;  3SF6 A;  2CX9 A;  2EBA A;  3OIB A;  3L1T A;  5K3I A;  3HWC A;  3FO3 A;  3P4T A;  3GM6 A;  4XVX A;  3UU9 A;  4G5E A;  2C0U A;  3RKH A;  4L38 A;  3MXL A;  3PFD A;  3M9V A;  3BNH A;  3D1I A;  2E81 A;  1R2J A;  2YYG A;  4L3Y A;  1JQI A;  4W9U A;  2RDZ A;  2DDH A;  1UDY A;  3MPI A;  4RM7 A;  3B96 A;  2A1T A;  3MMO A;  4N5F A;  1WS9 A;  3TTB A;  3MDE A;  4OO2 A;  4X28 C;  2Z1Q A;  3OWM A;  2R0N A;  2JBR A;  2RFQ A;  1IS2 A;  2OR0 A;  4U83 A;  1EGE A;  3EON A;  2WBI A;  3D9G A;  3X0Y A;  4ZXV A;  2VR0 A;  4KCF A;  4Q17 A;  2UXW A;  4Q5C A;  3UBR A;  1W07 A;  2YYI A;  2YYL A;  3AFF A;  2IX6 A;  3NF4 A;  3GNC A;  2YYJ A;  4Q0T A;  1FS7 A;  3X0X A;  3MPJ A;  2C12 A;  2DVL A;  1IVH A;  1BUC A;  1T9G A;  1EGD A;  1U8V A;  4L3X A;  3S7W A;  4M9A A;  3BNF A;  3SCE A;  3D9D A;  2D29 A;  2E80 A;  2JIF A;  2PG0 A;  2R0M A;  5K3J A;  3D6B A;  3LGQ A;  2VIG A;  2FON A;  4IRN A;  4DOY A;  4HR3 A;  1SIQ A;  3LG1 A;  2JBS A;  1GU6 A; 
#chains in the Genus database with same CATH topology
 4P13 A;  3D9E A;  4E00 A;  3BNJ A;  1XG2 B;  4JIO A;  2ZO5 A;  1FS8 A;  1K90 A;  3II9 A;  2EC5 A;  4NXL A;  3GQT A;  1X91 A;  4FF2 A;  2ZAF A;  4L3Z A;  1QDB A;  3TZ5 A;  2IX5 A;  2J7A A;  1Y8P A;  1RX0 A;  4MPC A;  4L1F A;  4KTO A;  5B5W A;  4FF4 A;  3D9F A;  4LQS B;  2REH A;  5B6B A;  3F29 A;  4O5M A;  1UKW A;  1Y0V A;  3Q22 A;  3EOM A;  5M4M A;  4WJY A;  3FCJ A;  3MKH A;  2FP2 A;  2YYK A;  3BNG A;  4KSA A;  2OEV A;  2RF7 A;  3OWA A;  5GJV E;  3TOR A;  5J71 A;  4AI6 A;  2BU2 A;  4IV6 A;  2Q8F A;  1SIR A;  3VAD A;  4FF3 A;  4Q4U A;  4X28 A;  1JM6 A;  1OAH A;  1S26 A;  1X8Z A;  2OJQ A;  3D2R A;  4V25 A;  4MP2 A;  2CJ5 A;  3SXQ A;  4ZYJ A;  3TZ0 A;  1XFY A;  2BTZ A;  2JBT A;  4Q5B A;  1EGC A;  1FS9 A;  2CJ7 A;  4HKR A;  3MDD A;  4JEK A;  5K3H A;  3R7K A;  2YYM A;  1XFX A;  5K3G A;  3SWO A;  2XS1 A;  4H7Q A;  2OT4 A;  2BU6 A;  3AFE A;  2VF1 A;  4Q1O A;  1RJ4 A;  4E02 A;  2F6L A;  4AKI A;  3SF6 A;  1RP3 A;  2LFW A;  3TZ4 A;  5M4P A;  2CX9 A;  1SC5 A;  2R05 A;  2EBA A;  3OIB A;  4KSF A;  3L1T A;  2BU5 A;  5K3I A;  2R02 A;  3HWC A;  1GKX A;  1XFW A;  2GBB A;  3FO3 A;  3P4T A;  3GM6 A;  4XVX A;  3UU9 A;  4G5E A;  2C0U A;  3RKH A;  4L38 A;  5BRK A;  3MXL A;  3PFD A;  3M9V A;  2CJ6 A;  3BNH A;  1X90 A;  3D1I A;  2E81 A;  4LQQ B;  3DJL A;  1R2J A;  5J6A A;  5GJW E;  4MPE A;  4HKS A;  1PI1 A;  1PK0 A;  2EBH X;  3CE2 A;  3VKG A;  2YYG A;  4L3Y A;  1JQI A;  1K8T A;  1XFV A;  4W9U A;  2XQR B;  5B5V A;  2Q8I A;  2ZDY A;  4FF1 A;  5M4N A;  3C3L A;  2RDZ A;  2DDH A;  1UDY A;  3MPI A;  4RM7 A;  1R3B A;  3B96 A;  3C2P A;  4FZ4 A;  2A1T A;  3MMO A;  4N5F A;  1WS9 A;  3CRK A;  3TTB A;  4P79 A;  1GJV A;  3MDE A;  4H85 A;  1SK6 A;  4OO2 A;  4X28 C;  1Y8O A;  4G97 A;  2Z1Q A;  3OWM A;  2BU7 A;  1Y8N A;  2R0N A;  3Q24 A;  4MPN A;  5M4K A;  4H81 A;  2JBR A;  1K93 A;  4QIC A;  2RFQ A;  1IS2 A;  2OR0 A;  4AKG A;  4U83 A;  1EGE A;  3EON A;  2QR4 A;  2WBI A;  2E0A A;  1XFU A;  3D9G A;  2ZDX A;  5BRM A;  2AZE A;  3X0Y A;  4ZXV A;  2PO4 A;  4J1V A;  4KS9 A;  2OEX A;  3TZ2 A;  2VR0 A;  5EZ3 A;  4KCF A;  3X29 A;  4Q17 A;  2UXW A;  4JIZ A;  4Q5C A;  3UBR A;  1W07 A;  1GKZ A;  2YYI A;  2YYL A;  3AFF A;  2IX6 A;  2XS8 A;  3NF4 A;  3GNC A;  2YYJ A;  1LVC A;  4Q0T A;  1FS7 A;  2AO2 A;  3U33 A;  3X0X A;  3MPJ A;  2C12 A;  2DVL A;  1IVH A;  1BUC A;  1T9G A;  2ZKJ A;  4MP7 A;  2R03 A;  2Q8H A;  1EGD A;  2CJ4 A;  1U8V A;  2YGW A;  3N0R A;  1XFZ A;  4L3X A;  3S7W A;  3Q23 A;  4M9A A;  2EBF X;  2HJN A;  3Q0A A;  2PNR A;  3BNF A;  3SCE A;  4F0X A;  3D9D A;  2Q8G A;  1RJ1 A;  3C46 A;  2D29 A;  2E80 A;  2JIF A;  3CRL A;  3VKH A;  2PG0 A;  2R0M A;  5K3J A;  3D6B A;  2CJ8 A;  3LGQ A;  4AKH A;  2VIG A;  2FON A;  4IRN A;  4DOY A;  4V26 A;  4HR3 A;  2FP1 A;  1SIQ A;  2BU8 A;  3LG1 A;  3KML A;  2JBS A;  4DZY A;  1GU6 A;  4E01 A; 
#chains in the Genus database with same CATH homology
 4P13 A;  3D9E A;  3BNJ A;  2ZO5 A;  1FS8 A;  3II9 A;  4NXL A;  3GQT A;  2ZAF A;  4L3Z A;  1QDB A;  2IX5 A;  2J7A A;  1RX0 A;  4L1F A;  4KTO A;  3D9F A;  2REH A;  3F29 A;  4O5M A;  1UKW A;  3EOM A;  4WJY A;  3FCJ A;  3MKH A;  2YYK A;  3BNG A;  2RF7 A;  3OWA A;  3TOR A;  4IV6 A;  1SIR A;  4Q4U A;  4X28 A;  1OAH A;  3SXQ A;  4ZYJ A;  2JBT A;  4Q5B A;  1EGC A;  1FS9 A;  3MDD A;  4JEK A;  5K3H A;  3R7K A;  2YYM A;  5K3G A;  3SWO A;  2OT4 A;  3AFE A;  4Q1O A;  3SF6 A;  2CX9 A;  2EBA A;  3OIB A;  3L1T A;  5K3I A;  3HWC A;  3FO3 A;  3P4T A;  3GM6 A;  4XVX A;  3UU9 A;  4G5E A;  2C0U A;  3RKH A;  4L38 A;  3MXL A;  3PFD A;  3M9V A;  3BNH A;  3D1I A;  2E81 A;  1R2J A;  2YYG A;  4L3Y A;  1JQI A;  4W9U A;  2RDZ A;  2DDH A;  1UDY A;  3MPI A;  4RM7 A;  3B96 A;  2A1T A;  3MMO A;  4N5F A;  1WS9 A;  3TTB A;  3MDE A;  4OO2 A;  4X28 C;  2Z1Q A;  3OWM A;  2R0N A;  2JBR A;  2RFQ A;  1IS2 A;  2OR0 A;  4U83 A;  1EGE A;  3EON A;  2WBI A;  3D9G A;  3X0Y A;  4ZXV A;  2VR0 A;  4KCF A;  4Q17 A;  2UXW A;  4Q5C A;  3UBR A;  1W07 A;  2YYI A;  2YYL A;  3AFF A;  2IX6 A;  3NF4 A;  3GNC A;  2YYJ A;  4Q0T A;  1FS7 A;  3X0X A;  3MPJ A;  2C12 A;  2DVL A;  1IVH A;  1BUC A;  1T9G A;  1EGD A;  1U8V A;  4L3X A;  3S7W A;  4M9A A;  3BNF A;  3SCE A;  3D9D A;  2D29 A;  2E80 A;  2JIF A;  2PG0 A;  2R0M A;  5K3J A;  3D6B A;  3LGQ A;  2VIG A;  2FON A;  4IRN A;  4DOY A;  4HR3 A;  1SIQ A;  3LG1 A;  2JBS A;  1GU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...