2WBIA

Crystal structure of human acyl-coa dehydrogenase 11
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
404
structure length
394
Chain Sequence
VQTRKGQEVLIKVKHFMKQHILPAEKEVTEKWGKPLVIDKLKEMAKVEGLWNLFLPAVSGLSHVDYALIAEETGKCFFAPDVFNCQAPDTGNMEVLHLYGSEEQKKQWLEPLLQGNITSCFCMTEPDVASSDATNIECSIQRDEDSYVINGKKWWSSGAGNPKCKIAIVLGRTQNTSLSRHKQHSMILVPMNTPGVKIIRPLSVFGYTDNFHGGHFEIHFNQVRVPATNLILGEGRGFEISQGRLGPGRIHHCMRTVGLAERALQIMCERATQRIAFKKKLYAHEVVAHWIAESRIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords ACYL-COA DEHYDROGENASE FAMILY MEMBER 11
publication title Crystal Structure of Human Acyl-Coa Dehydrogenase 11
rcsb
source organism Homo sapiens
total genus 146
structure length 394
sequence length 404
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain
A PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain
A PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.540.10 Mainly Alpha Orthogonal Bundle Butyryl-Coa Dehydrogenase, subunit A; domain 1 Acyl-CoA dehydrogenase/oxidase, N-terminal domain 2wbiA01
1.20.140.10 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A, domain 3 2wbiA03
2.40.110.10 Mainly Beta Beta Barrel Butyryl-CoA Dehydrogenase, subunit A; domain 2 Butyryl-CoA Dehydrogenase, subunit A, domain 2 2wbiA02
4X28C 1UKWA 2ZO5A 3MDDA 3MDEA 3OIBA 3L1TA 1GU6A 1RX0A 2YYGA 2VR0A 2D29A 3TTBA 3M9VA 2E81A 3D9FA 4L1FA 3GM6A 3P4TA 2Z1QA 4KCFA 1T9GA 3SF6A 2YYLA 1BUCA 3MPIA 2VIGA 4G5EA 2JBTA 1UDYA 3S7WA 5K3JA 2J7AA 3SCEA 4IV6A 3D9DA 3SXQA 4ZYJA 2A1TA 4P13A 4W9UA 3BNJA 4XVXA 5K3IA 2CX9A 4OO2A 4Q5CA 1EGDA 5K3HA 1FS7A 1FS8A 4WJYA 4Q4UA 3NF4A 2JIFA 2IX5A 3GNCA 1R2JA 3UU9A 4HR3A 3D9GA 4L3YA 2RF7A 2OR0A 3FO3A 1W07A 1FS9A 4L3ZA 2FONA 4Q1OA 3BNHA 1IVHA 3TORA 1U8VA 3D6BA 3MMOA 1IS2A 4L3XA 2ZAFA 3X0YA 3AFFA 3GQTA 2YYIA 4Q17A 2E80A 2C12A 2R0NA 2OT4A 3OWAA 2YYJA 4NXLA 3EOMA 4JEKA 3UBRA 2IX6A 4N5FA 2YYKA 2EBAA 3HWCA 3LGQA 3LG1A 1EGEA 2DVLA 3MXLA 4U83A 3RKHA 2R0MA 4O5MA 1SIQA 2REHA 3EONA 4X28A 2RFQA 2JBRA 5K3GA 2RDZA 3X0XA 3D9EA 4Q0TA 2UXWA 2C0UA 2WBIA 1EGCA 4Q5BA 2PG0A 3BNGA 4M9AA 3MPJA 4RM7A 3R7KA 1JQIA 2JBSA 4KTOA 3B96A 4L38A 2DDHA 3II9A 2YYMA 1SIRA 3AFEA 1QDBA 3D1IA 4ZXVA 3OWMA 1WS9A 3FCJA 1OAHA 3PFDA 3BNFA 4DOYA 3F29A 3SWOA 4IRNA 3MKHA
chains in the Genus database with same CATH superfamily
4X28C 1UKWA 2ZO5A 4KSFA 3MDDA 3MDEA 2FP1A 2R03A 2ZKJA 4G97A 3OIBA 1JM6A 1RJ1A 2FP2A 3L1TA 4H7QA 5M4MA 1GU6A 2QR4A 4FF2A 1RX0A 4FF3A 2YYGA 3DJLA 2VR0A 2D29A 4FZ4A 3TTBA 3M9VA 2E81A 3D9FA 2Q8HA 4L1FA 3GM6A 3P4TA 2Z1QA 4KCFA 1T9GA 3SF6A 2CJ4A 1SC5A 1BUCA 3MPIA 2YYLA 3Q0AA 2ZDYA 3Q22A 2CJ5A 2VIGA 4G5EA 3VADA 2JBTA 2Q8GA 1UDYA 4FF1A 3U33A 3S7WA 2R05A 5K3JA 1PK0A 5B5VA 4F0XA 1R3BA 4MPNA 5EZ3A 2J7AA 3N0RA 3SCEA 2OEVA 4IV6A 4MPEA 3TZ4A 4E02A 3D9DA 5J6AA 3CRLA 3SXQA 4ZYJA 1K8TA 2A1TA 4P13A 2EBFX 4W9UA 3BNJA 4XVXA 5GJVE 5K3IA 2CX9A 4OO2A 4Q5CA 1EGDA 5K3HA 1FS7A 3C3LA 1XFYA 1FS8A 4WJYA 4Q4UA 3CRKA 1SK6A 3NF4A 2JIFA 2XS8A 2BU5A 2IX5A 3GNCA 2AO2A 2R02A 1XFUA 1R2JA 3UU9A 5BRKA 2YGWA 4HR3A 2Q8FA 1K90A 3D9GA 4L3YA 2RF7A 2OR0A 1Y0VA 2PNRA 3FO3A 1W07A 1FS9A 1GJVA 1X90A 2F6LA 4L3ZA 3TZ0A 2FONA 4MP7A 4Q1OA 3BNHA 5J71A 1IVHA 2Q8IA 3TORA 4H81A 1U8VA 3D6BA 3MMOA 5M4PA 4E00A 1IS2A 4L3XA 2ZAFA 3X0YA 3AFFA 3GQTA 1K93A 2HJNA 2YYIA 4H85A 4Q17A 2BU6A 1GKZA 5BRMA 2E80A 2C12A 2R0NA 3KMLA 4LQQB 2OJQA 2OT4A 3VKHA 3OWAA 1Y8PA 2EBHX 4MP2A 2YYJA 2OEXA 4NXLA 1XFVA 1XFXA 3EOMA 4JEKA 3UBRA 5B6BA 2IX6A 4N5FA 4E01A 2YYKA 3C2PA 1RP3A 2VF1A 2EBAA 3HWCA 4MPCA 3LGQA 3TZ2A 3LG1A 3VKGA 1EGEA 2DVLA 3MXLA 2GBBA 4JIOA 4U83A 3TZ5A 1S26A 3RKHA 2R0MA 4O5MA 2CJ6A 2EC5A 2CJ8A 1Y8OA 3D2RA 1SIQA 2XQRB 4KSAA 2E0AA 2REHA 3EONA 4X28A 1XG2B 2RFQA 2JBRA 5K3GA 1XFZA 4J1VA 1GKXA 4HKSA 2RDZA 3X0XA 3D9EA 4KS9A 4AKHA 3C46A 2BU2A 2ZDXA 4AKGA 2PO4A 2UXWA 1PI1A 4Q0TA 2C0UA 2WBIA 4FF4A 1EGCA 2BU7A 2CJ7A 4V25A 1LVCA 2LFWA 2PG0A 4Q5BA 5B5WA 1X91A 4DZYA 3BNGA 4AI6A 4M9AA 3MPJA 4RM7A 1X8ZA 2AZEA 2XS1A 3Q24A 3CE2A 2BTZA 2BU8A 3X29A 3R7KA 1JQIA 4HKRA 2JBSA 4KTOA 3B96A 4AKIA 4L38A 2DDHA 1RJ4A 4V26A 3II9A 2YYMA 1SIRA 3Q23A 3AFEA 1QDBA 3D1IA 5GJWE 5M4KA 4ZXVA 3OWMA 1WS9A 3FCJA 1OAHA 4QICA 3PFDA 3BNFA 4P79A 4DOYA 3F29A 3SWOA 1XFWA 4IRNA 4LQSB 5M4NA 4JIZA 3MKHA 1Y8NA
chains in the Genus database with same CATH topology
4X28C 1UKWA 2ZO5A 3MDDA 3MDEA 3OIBA 3L1TA 1GU6A 1RX0A 2YYGA 2VR0A 2D29A 3TTBA 3M9VA 2E81A 3D9FA 4L1FA 3GM6A 3P4TA 2Z1QA 4KCFA 1T9GA 3SF6A 2YYLA 1BUCA 3MPIA 2VIGA 4G5EA 2JBTA 1UDYA 3S7WA 5K3JA 2J7AA 3SCEA 4IV6A 3D9DA 3SXQA 4ZYJA 2A1TA 4P13A 4W9UA 3BNJA 4XVXA 5K3IA 2CX9A 4OO2A 4Q5CA 1EGDA 5K3HA 1FS7A 1FS8A 4WJYA 4Q4UA 3NF4A 2JIFA 2IX5A 3GNCA 1R2JA 3UU9A 4HR3A 3D9GA 4L3YA 2RF7A 2OR0A 3FO3A 1W07A 1FS9A 4L3ZA 2FONA 4Q1OA 3BNHA 1IVHA 3TORA 1U8VA 3D6BA 3MMOA 1IS2A 4L3XA 2ZAFA 3X0YA 3AFFA 3GQTA 2YYIA 4Q17A 2E80A 2C12A 2R0NA 2OT4A 3OWAA 2YYJA 4NXLA 3EOMA 4JEKA 3UBRA 2IX6A 4N5FA 2YYKA 2EBAA 3HWCA 3LGQA 3LG1A 1EGEA 2DVLA 3MXLA 4U83A 3RKHA 2R0MA 4O5MA 1SIQA 2REHA 3EONA 4X28A 2RFQA 2JBRA 5K3GA 2RDZA 3X0XA 3D9EA 4Q0TA 2UXWA 2C0UA 2WBIA 1EGCA 4Q5BA 2PG0A 3BNGA 4M9AA 3MPJA 4RM7A 3R7KA 1JQIA 2JBSA 4KTOA 3B96A 4L38A 2DDHA 3II9A 2YYMA 1SIRA 3AFEA 1QDBA 3D1IA 4ZXVA 3OWMA 1WS9A 3FCJA 1OAHA 3PFDA 3BNFA 4DOYA 3F29A 3SWOA 4IRNA 3MKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X28 C;  1UKW A;  2ZO5 A;  3MDD A;  3MDE A;  3OIB A;  3L1T A;  1GU6 A;  1RX0 A;  2YYG A;  2VR0 A;  2D29 A;  3TTB A;  3M9V A;  2E81 A;  3D9F A;  4L1F A;  3GM6 A;  3P4T A;  2Z1Q A;  4KCF A;  1T9G A;  3SF6 A;  2YYL A;  1BUC A;  3MPI A;  2VIG A;  4G5E A;  2JBT A;  1UDY A;  3S7W A;  5K3J A;  2J7A A;  3SCE A;  4IV6 A;  3D9D A;  3SXQ A;  4ZYJ A;  2A1T A;  4P13 A;  4W9U A;  3BNJ A;  4XVX A;  5K3I A;  2CX9 A;  4OO2 A;  4Q5C A;  1EGD A;  5K3H A;  1FS7 A;  1FS8 A;  4WJY A;  4Q4U A;  3NF4 A;  2JIF A;  2IX5 A;  3GNC A;  1R2J A;  3UU9 A;  4HR3 A;  3D9G A;  4L3Y A;  2RF7 A;  2OR0 A;  3FO3 A;  1W07 A;  1FS9 A;  4L3Z A;  2FON A;  4Q1O A;  3BNH A;  1IVH A;  3TOR A;  1U8V A;  3D6B A;  3MMO A;  1IS2 A;  4L3X A;  2ZAF A;  3X0Y A;  3AFF A;  3GQT A;  2YYI A;  4Q17 A;  2E80 A;  2C12 A;  2R0N A;  2OT4 A;  3OWA A;  2YYJ A;  4NXL A;  3EOM A;  4JEK A;  3UBR A;  2IX6 A;  4N5F A;  2YYK A;  2EBA A;  3HWC A;  3LGQ A;  3LG1 A;  1EGE A;  2DVL A;  3MXL A;  4U83 A;  3RKH A;  2R0M A;  4O5M A;  1SIQ A;  2REH A;  3EON A;  4X28 A;  2RFQ A;  2JBR A;  5K3G A;  2RDZ A;  3X0X A;  3D9E A;  4Q0T A;  2UXW A;  2C0U A;  2WBI A;  1EGC A;  4Q5B A;  2PG0 A;  3BNG A;  4M9A A;  3MPJ A;  4RM7 A;  3R7K A;  1JQI A;  2JBS A;  4KTO A;  3B96 A;  4L38 A;  2DDH A;  3II9 A;  2YYM A;  1SIR A;  3AFE A;  1QDB A;  3D1I A;  4ZXV A;  3OWM A;  1WS9 A;  3FCJ A;  1OAH A;  3PFD A;  3BNF A;  4DOY A;  3F29 A;  3SWO A;  4IRN A;  3MKH A; 
#chains in the Genus database with same CATH topology
 4X28 C;  1UKW A;  2ZO5 A;  4KSF A;  3MDD A;  3MDE A;  2FP1 A;  2R03 A;  2ZKJ A;  4G97 A;  3OIB A;  1JM6 A;  1RJ1 A;  2FP2 A;  3L1T A;  4H7Q A;  5M4M A;  1GU6 A;  2QR4 A;  4FF2 A;  1RX0 A;  4FF3 A;  2YYG A;  3DJL A;  2VR0 A;  2D29 A;  4FZ4 A;  3TTB A;  3M9V A;  2E81 A;  3D9F A;  2Q8H A;  4L1F A;  3GM6 A;  3P4T A;  2Z1Q A;  4KCF A;  1T9G A;  3SF6 A;  2CJ4 A;  1SC5 A;  1BUC A;  3MPI A;  2YYL A;  3Q0A A;  2ZDY A;  3Q22 A;  2CJ5 A;  2VIG A;  4G5E A;  3VAD A;  2JBT A;  2Q8G A;  1UDY A;  4FF1 A;  3U33 A;  3S7W A;  2R05 A;  5K3J A;  1PK0 A;  5B5V A;  4F0X A;  1R3B A;  4MPN A;  5EZ3 A;  2J7A A;  3N0R A;  3SCE A;  2OEV A;  4IV6 A;  4MPE A;  3TZ4 A;  4E02 A;  3D9D A;  5J6A A;  3CRL A;  3SXQ A;  4ZYJ A;  1K8T A;  2A1T A;  4P13 A;  2EBF X;  4W9U A;  3BNJ A;  4XVX A;  5GJV E;  5K3I A;  2CX9 A;  4OO2 A;  4Q5C A;  1EGD A;  5K3H A;  1FS7 A;  3C3L A;  1XFY A;  1FS8 A;  4WJY A;  4Q4U A;  3CRK A;  1SK6 A;  3NF4 A;  2JIF A;  2XS8 A;  2BU5 A;  2IX5 A;  3GNC A;  2AO2 A;  2R02 A;  1XFU A;  1R2J A;  3UU9 A;  5BRK A;  2YGW A;  4HR3 A;  2Q8F A;  1K90 A;  3D9G A;  4L3Y A;  2RF7 A;  2OR0 A;  1Y0V A;  2PNR A;  3FO3 A;  1W07 A;  1FS9 A;  1GJV A;  1X90 A;  2F6L A;  4L3Z A;  3TZ0 A;  2FON A;  4MP7 A;  4Q1O A;  3BNH A;  5J71 A;  1IVH A;  2Q8I A;  3TOR A;  4H81 A;  1U8V A;  3D6B A;  3MMO A;  5M4P A;  4E00 A;  1IS2 A;  4L3X A;  2ZAF A;  3X0Y A;  3AFF A;  3GQT A;  1K93 A;  2HJN A;  2YYI A;  4H85 A;  4Q17 A;  2BU6 A;  1GKZ A;  5BRM A;  2E80 A;  2C12 A;  2R0N A;  3KML A;  4LQQ B;  2OJQ A;  2OT4 A;  3VKH A;  3OWA A;  1Y8P A;  2EBH X;  4MP2 A;  2YYJ A;  2OEX A;  4NXL A;  1XFV A;  1XFX A;  3EOM A;  4JEK A;  3UBR A;  5B6B A;  2IX6 A;  4N5F A;  4E01 A;  2YYK A;  3C2P A;  1RP3 A;  2VF1 A;  2EBA A;  3HWC A;  4MPC A;  3LGQ A;  3TZ2 A;  3LG1 A;  3VKG A;  1EGE A;  2DVL A;  3MXL A;  2GBB A;  4JIO A;  4U83 A;  3TZ5 A;  1S26 A;  3RKH A;  2R0M A;  4O5M A;  2CJ6 A;  2EC5 A;  2CJ8 A;  1Y8O A;  3D2R A;  1SIQ A;  2XQR B;  4KSA A;  2E0A A;  2REH A;  3EON A;  4X28 A;  1XG2 B;  2RFQ A;  2JBR A;  5K3G A;  1XFZ A;  4J1V A;  1GKX A;  4HKS A;  2RDZ A;  3X0X A;  3D9E A;  4KS9 A;  4AKH A;  3C46 A;  2BU2 A;  2ZDX A;  4AKG A;  2PO4 A;  2UXW A;  1PI1 A;  4Q0T A;  2C0U A;  2WBI A;  4FF4 A;  1EGC A;  2BU7 A;  2CJ7 A;  4V25 A;  1LVC A;  2LFW A;  2PG0 A;  4Q5B A;  5B5W A;  1X91 A;  4DZY A;  3BNG A;  4AI6 A;  4M9A A;  3MPJ A;  4RM7 A;  1X8Z A;  2AZE A;  2XS1 A;  3Q24 A;  3CE2 A;  2BTZ A;  2BU8 A;  3X29 A;  3R7K A;  1JQI A;  4HKR A;  2JBS A;  4KTO A;  3B96 A;  4AKI A;  4L38 A;  2DDH A;  1RJ4 A;  4V26 A;  3II9 A;  2YYM A;  1SIR A;  3Q23 A;  3AFE A;  1QDB A;  3D1I A;  5GJW E;  5M4K A;  4ZXV A;  3OWM A;  1WS9 A;  3FCJ A;  1OAH A;  4QIC A;  3PFD A;  3BNF A;  4P79 A;  4DOY A;  3F29 A;  3SWO A;  1XFW A;  4IRN A;  4LQS B;  5M4N A;  4JIZ A;  3MKH A;  1Y8N A; 
#chains in the Genus database with same CATH homology
 4X28 C;  1UKW A;  2ZO5 A;  3MDD A;  3MDE A;  3OIB A;  3L1T A;  1GU6 A;  1RX0 A;  2YYG A;  2VR0 A;  2D29 A;  3TTB A;  3M9V A;  2E81 A;  3D9F A;  4L1F A;  3GM6 A;  3P4T A;  2Z1Q A;  4KCF A;  1T9G A;  3SF6 A;  2YYL A;  1BUC A;  3MPI A;  2VIG A;  4G5E A;  2JBT A;  1UDY A;  3S7W A;  5K3J A;  2J7A A;  3SCE A;  4IV6 A;  3D9D A;  3SXQ A;  4ZYJ A;  2A1T A;  4P13 A;  4W9U A;  3BNJ A;  4XVX A;  5K3I A;  2CX9 A;  4OO2 A;  4Q5C A;  1EGD A;  5K3H A;  1FS7 A;  1FS8 A;  4WJY A;  4Q4U A;  3NF4 A;  2JIF A;  2IX5 A;  3GNC A;  1R2J A;  3UU9 A;  4HR3 A;  3D9G A;  4L3Y A;  2RF7 A;  2OR0 A;  3FO3 A;  1W07 A;  1FS9 A;  4L3Z A;  2FON A;  4Q1O A;  3BNH A;  1IVH A;  3TOR A;  1U8V A;  3D6B A;  3MMO A;  1IS2 A;  4L3X A;  2ZAF A;  3X0Y A;  3AFF A;  3GQT A;  2YYI A;  4Q17 A;  2E80 A;  2C12 A;  2R0N A;  2OT4 A;  3OWA A;  2YYJ A;  4NXL A;  3EOM A;  4JEK A;  3UBR A;  2IX6 A;  4N5F A;  2YYK A;  2EBA A;  3HWC A;  3LGQ A;  3LG1 A;  1EGE A;  2DVL A;  3MXL A;  4U83 A;  3RKH A;  2R0M A;  4O5M A;  1SIQ A;  2REH A;  3EON A;  4X28 A;  2RFQ A;  2JBR A;  5K3G A;  2RDZ A;  3X0X A;  3D9E A;  4Q0T A;  2UXW A;  2C0U A;  2WBI A;  1EGC A;  4Q5B A;  2PG0 A;  3BNG A;  4M9A A;  3MPJ A;  4RM7 A;  3R7K A;  1JQI A;  2JBS A;  4KTO A;  3B96 A;  4L38 A;  2DDH A;  3II9 A;  2YYM A;  1SIR A;  3AFE A;  1QDB A;  3D1I A;  4ZXV A;  3OWM A;  1WS9 A;  3FCJ A;  1OAH A;  3PFD A;  3BNF A;  4DOY A;  3F29 A;  3SWO A;  4IRN A;  3MKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...