4XVXA

Crystal structure of an acyl-acp dehydrogenase
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
377
structure length
371
Chain Sequence
SDLDDFRGLLAKAFDERVVAWTAEAEAQERFPRQLIEHLGVCGVFDAKWATDARPDVGKLVELAFALGQLASAGIGVGVSLHDSAIAILRRFGKSDYLRDICDQAIRGAAVLCIGASEESGGSDLQIVETEIRSRDGGFEVRGVKKFVSLSPIADHIMVVARSVDHGNVAVVAVPAAQVSVQTPYRKVGAGPLDTAAVCIDTWVPADALVARAGTGLAAISWGLAHERMSIAGQIAASCQRAIGITLARMMSRRQFGQTLFEHQALRLRMADLQARVDLLRYALHGIAEQGRLELRTAAAVKVTAARLGEEVISECMHIFGGAGYLVDETTLGKWWRDMKLARVGGGTDEVLWELVAAGMTPDHDGYAAVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Acyl-[acyl-carrier-protein] dehydrogenase MbtN
publication title A covalent adduct of MbtN, an acyl-ACP dehydrogenase from Mycobacterium tuberculosis, reveals an unusual acyl-binding pocket.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 148
structure length 371
sequence length 377
chains with identical sequence B
ec nomenclature ec 1.3.99.-:
pdb deposition date 2015-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain
A PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain
A PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.540.10 Mainly Alpha Orthogonal Bundle Butyryl-Coa Dehydrogenase, subunit A; domain 1 Acyl-CoA dehydrogenase/oxidase, N-terminal domain 4xvxA01
1.20.140.10 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A, domain 3 4xvxA03
2.40.110.10 Mainly Beta Beta Barrel Butyryl-CoA Dehydrogenase, subunit A; domain 2 Butyryl-CoA Dehydrogenase, subunit A, domain 2 4xvxA02
3BNHA 3BNGA 2E80A 1SIQA 1U8VA 2JBTA 3SWOA 4Q5CA 4L1FA 2R0MA 4NXLA 1QDBA 4W9UA 1JQIA 3D9GA 3UBRA 2OR0A 3D9FA 3SCEA 3B96A 1OAHA 4ZYJA 2VR0A 1T9GA 2YYMA 1EGDA 5K3JA 3BNFA 3F29A 2FONA 1GU6A 2YYLA 3LGQA 3RKHA 2R0NA 4X28C 3R7KA 4N5FA 3NF4A 4X28A 4P13A 4RM7A 3SF6A 1IS2A 3X0XA 3MPIA 2C0UA 3II9A 2IX5A 2DDHA 3FO3A 3MMOA 1UDYA 2RDZA 3UU9A 4L3YA 2A1TA 2YYIA 1RX0A 3M9VA 4IRNA 1SIRA 2WBIA 3MPJA 2Z1QA 3OIBA 3D9EA 2ZO5A 3LG1A 3D9DA 3OWAA 2C12A 4U83A 5K3IA 3SXQA 4Q0TA 4OO2A 3S7WA 3HWCA 4O5MA 2E81A 2D29A 4L3ZA 2VIGA 2J7AA 1FS8A 2OT4A 1IVHA 2DVLA 1WS9A 5K3HA 2CX9A 4XVXA 1FS9A 4M9AA 2YYJA 2RF7A 4Q1OA 4HR3A 4Q5BA 2UXWA 3OWMA 2ZAFA 4G5EA 3MXLA 3FCJA 1R2JA 4L3XA 3GQTA 3D6BA 3GNCA 1EGCA 4ZXVA 2JIFA 4IV6A 1W07A 2IX6A 2REHA 4KTOA 3GM6A 3AFFA 2PG0A 3L1TA 3EOMA 4Q4UA 4Q17A 5K3GA 2RFQA 1EGEA 1UKWA 3BNJA 4WJYA 3PFDA 4KCFA 1BUCA 3TORA 4DOYA 3MDDA 2YYGA 3AFEA 3TTBA 4L38A 3EONA 2YYKA 2JBSA 2EBAA 2JBRA 3MDEA 3P4TA 3D1IA 3X0YA 1FS7A 3MKHA 4JEKA
chains in the Genus database with same CATH superfamily
2PNRA 3BNHA 1X8ZA 3BNGA 2E80A 1SIQA 4JIZA 1U8VA 2JBTA 2CJ7A 3SWOA 2BU5A 4Q5CA 5M4KA 2FP2A 4L1FA 3CRKA 4H85A 2R0MA 4NXLA 3U33A 2CJ4A 1QDBA 4W9UA 1JQIA 3D9GA 1XFYA 4QICA 2OR0A 3D9FA 3TZ4A 3UBRA 4AI6A 2E0AA 3SCEA 3B96A 1SC5A 4E01A 1OAHA 4ZYJA 1SK6A 1T9GA 2VR0A 2YYMA 4H7QA 1EGDA 3DJLA 5K3JA 2BU2A 4KSFA 5B5VA 5BRKA 3BNFA 2EBHX 3F29A 2FONA 1GU6A 1Y0VA 2YYLA 2XS8A 3LGQA 2R0NA 4X28C 4LQSB 3RKHA 3TZ2A 3R7KA 4FF3A 4N5FA 3NF4A 5M4NA 4X28A 4P13A 4RM7A 4KSAA 1GKZA 1S26A 3C3LA 2BU7A 5J6AA 3SF6A 2QR4A 1IS2A 3X0XA 3MPIA 2C0UA 2EC5A 2R05A 4AKIA 3II9A 4JIOA 2IX5A 4J1VA 3X29A 4FF4A 2DDHA 3FO3A 1X90A 1UDYA 2RDZA 3MMOA 3UU9A 4L3YA 2OEXA 1XFZA 2A1TA 2YYIA 1RX0A 3M9VA 2AO2A 4IRNA 2EBFX 1SIRA 2BU6A 3Q22A 4MPCA 2WBIA 1LVCA 2XS1A 3MPJA 2Z1QA 3OIBA 1JM6A 3D9EA 2ZDXA 4G97A 4KS9A 2ZO5A 3LG1A 3D9DA 2R03A 3OWAA 2C12A 4U83A 5K3IA 2R02A 4Q0TA 4OO2A 3S7WA 3SXQA 3HWCA 4HKSA 4O5MA 2E81A 2D29A 2HJNA 4L3ZA 2VIGA 2J7AA 2XQRB 1FS8A 2OT4A 1IVHA 3CRLA 2DVLA 2LFWA 4MPEA 1WS9A 5EZ3A 5K3HA 2CX9A 4XVXA 1FS9A 4M9AA 2YYJA 2RF7A 4H81A 4Q1OA 5GJWE 2ZKJA 5GJVE 1K8TA 5B5WA 4HR3A 4Q5BA 2UXWA 3OWMA 2Q8FA 2ZAFA 4G5EA 4F0XA 4FF2A 3MXLA 3FCJA 1R2JA 4L3XA 3KMLA 1RP3A 3GQTA 3Q24A 3VADA 4MP2A 4AKHA 3D6BA 1GKXA 3VKGA 3GNCA 2Q8HA 2FP1A 1EGCA 4ZXVA 2JIFA 5B6BA 4IV6A 3N0RA 3D2RA 1W07A 2IX6A 3TZ5A 4MPNA 4DZYA 4E00A 2REHA 4KTOA 3GM6A 1K93A 1XFVA 3Q23A 5M4PA 2BTZA 3C46A 3AFFA 2PG0A 3L1TA 2Q8IA 3EOMA 4P79A 4V25A 2PO4A 2Q8GA 4Q4UA 4Q17A 2OJQA 4MP7A 5K3GA 1RJ1A 5M4MA 2RFQA 2BU8A 1K90A 3CE2A 2ZDYA 1EGEA 1UKWA 3BNJA 3VKHA 2VF1A 2AZEA 4LQQB 1XG2B 2CJ6A 2GBBA 1GJVA 2YGWA 4WJYA 3PFDA 4FZ4A 4KCFA 5BRMA 3Q0AA 1BUCA 2CJ8A 1XFWA 4DOYA 2OEVA 3MDDA 1PI1A 2YYGA 3TORA 4E02A 4HKRA 4FF1A 2CJ5A 2F6LA 1RJ4A 1X91A 1XFUA 1PK0A 1Y8NA 3AFEA 3TTBA 3TZ0A 4L38A 3C2PA 1R3BA 3EONA 2YYKA 2JBSA 4AKGA 2EBAA 1Y8OA 5J71A 1XFXA 4V26A 2JBRA 3MDEA 3P4TA 1Y8PA 3D1IA 3X0YA 1FS7A 3MKHA 4JEKA
chains in the Genus database with same CATH topology
3BNHA 3BNGA 2E80A 1SIQA 1U8VA 2JBTA 3SWOA 4Q5CA 4L1FA 2R0MA 4NXLA 1QDBA 4W9UA 1JQIA 3D9GA 3UBRA 2OR0A 3D9FA 3SCEA 3B96A 1OAHA 4ZYJA 2VR0A 1T9GA 2YYMA 1EGDA 5K3JA 3BNFA 3F29A 2FONA 1GU6A 2YYLA 3LGQA 3RKHA 2R0NA 4X28C 3R7KA 4N5FA 3NF4A 4X28A 4P13A 4RM7A 3SF6A 1IS2A 3X0XA 3MPIA 2C0UA 3II9A 2IX5A 2DDHA 3FO3A 3MMOA 1UDYA 2RDZA 3UU9A 4L3YA 2A1TA 2YYIA 1RX0A 3M9VA 4IRNA 1SIRA 2WBIA 3MPJA 2Z1QA 3OIBA 3D9EA 2ZO5A 3LG1A 3D9DA 3OWAA 2C12A 4U83A 5K3IA 3SXQA 4Q0TA 4OO2A 3S7WA 3HWCA 4O5MA 2E81A 2D29A 4L3ZA 2VIGA 2J7AA 1FS8A 2OT4A 1IVHA 2DVLA 1WS9A 5K3HA 2CX9A 4XVXA 1FS9A 4M9AA 2YYJA 2RF7A 4Q1OA 4HR3A 4Q5BA 2UXWA 3OWMA 2ZAFA 4G5EA 3MXLA 3FCJA 1R2JA 4L3XA 3GQTA 3D6BA 3GNCA 1EGCA 4ZXVA 2JIFA 4IV6A 1W07A 2IX6A 2REHA 4KTOA 3GM6A 3AFFA 2PG0A 3L1TA 3EOMA 4Q4UA 4Q17A 5K3GA 2RFQA 1EGEA 1UKWA 3BNJA 4WJYA 3PFDA 4KCFA 1BUCA 3TORA 4DOYA 3MDDA 2YYGA 3AFEA 3TTBA 4L38A 3EONA 2YYKA 2JBSA 2EBAA 2JBRA 3MDEA 3P4TA 3D1IA 3X0YA 1FS7A 3MKHA 4JEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BNH A;  3BNG A;  2E80 A;  1SIQ A;  1U8V A;  2JBT A;  3SWO A;  4Q5C A;  4L1F A;  2R0M A;  4NXL A;  1QDB A;  4W9U A;  1JQI A;  3D9G A;  3UBR A;  2OR0 A;  3D9F A;  3SCE A;  3B96 A;  1OAH A;  4ZYJ A;  2VR0 A;  1T9G A;  2YYM A;  1EGD A;  5K3J A;  3BNF A;  3F29 A;  2FON A;  1GU6 A;  2YYL A;  3LGQ A;  3RKH A;  2R0N A;  4X28 C;  3R7K A;  4N5F A;  3NF4 A;  4X28 A;  4P13 A;  4RM7 A;  3SF6 A;  1IS2 A;  3X0X A;  3MPI A;  2C0U A;  3II9 A;  2IX5 A;  2DDH A;  3FO3 A;  3MMO A;  1UDY A;  2RDZ A;  3UU9 A;  4L3Y A;  2A1T A;  2YYI A;  1RX0 A;  3M9V A;  4IRN A;  1SIR A;  2WBI A;  3MPJ A;  2Z1Q A;  3OIB A;  3D9E A;  2ZO5 A;  3LG1 A;  3D9D A;  3OWA A;  2C12 A;  4U83 A;  5K3I A;  3SXQ A;  4Q0T A;  4OO2 A;  3S7W A;  3HWC A;  4O5M A;  2E81 A;  2D29 A;  4L3Z A;  2VIG A;  2J7A A;  1FS8 A;  2OT4 A;  1IVH A;  2DVL A;  1WS9 A;  5K3H A;  2CX9 A;  4XVX A;  1FS9 A;  4M9A A;  2YYJ A;  2RF7 A;  4Q1O A;  4HR3 A;  4Q5B A;  2UXW A;  3OWM A;  2ZAF A;  4G5E A;  3MXL A;  3FCJ A;  1R2J A;  4L3X A;  3GQT A;  3D6B A;  3GNC A;  1EGC A;  4ZXV A;  2JIF A;  4IV6 A;  1W07 A;  2IX6 A;  2REH A;  4KTO A;  3GM6 A;  3AFF A;  2PG0 A;  3L1T A;  3EOM A;  4Q4U A;  4Q17 A;  5K3G A;  2RFQ A;  1EGE A;  1UKW A;  3BNJ A;  4WJY A;  3PFD A;  4KCF A;  1BUC A;  3TOR A;  4DOY A;  3MDD A;  2YYG A;  3AFE A;  3TTB A;  4L38 A;  3EON A;  2YYK A;  2JBS A;  2EBA A;  2JBR A;  3MDE A;  3P4T A;  3D1I A;  3X0Y A;  1FS7 A;  3MKH A;  4JEK A; 
#chains in the Genus database with same CATH topology
 2PNR A;  3BNH A;  1X8Z A;  3BNG A;  2E80 A;  1SIQ A;  4JIZ A;  1U8V A;  2JBT A;  2CJ7 A;  3SWO A;  2BU5 A;  4Q5C A;  5M4K A;  2FP2 A;  4L1F A;  3CRK A;  4H85 A;  2R0M A;  4NXL A;  3U33 A;  2CJ4 A;  1QDB A;  4W9U A;  1JQI A;  3D9G A;  1XFY A;  4QIC A;  2OR0 A;  3D9F A;  3TZ4 A;  3UBR A;  4AI6 A;  2E0A A;  3SCE A;  3B96 A;  1SC5 A;  4E01 A;  1OAH A;  4ZYJ A;  1SK6 A;  1T9G A;  2VR0 A;  2YYM A;  4H7Q A;  1EGD A;  3DJL A;  5K3J A;  2BU2 A;  4KSF A;  5B5V A;  5BRK A;  3BNF A;  2EBH X;  3F29 A;  2FON A;  1GU6 A;  1Y0V A;  2YYL A;  2XS8 A;  3LGQ A;  2R0N A;  4X28 C;  4LQS B;  3RKH A;  3TZ2 A;  3R7K A;  4FF3 A;  4N5F A;  3NF4 A;  5M4N A;  4X28 A;  4P13 A;  4RM7 A;  4KSA A;  1GKZ A;  1S26 A;  3C3L A;  2BU7 A;  5J6A A;  3SF6 A;  2QR4 A;  1IS2 A;  3X0X A;  3MPI A;  2C0U A;  2EC5 A;  2R05 A;  4AKI A;  3II9 A;  4JIO A;  2IX5 A;  4J1V A;  3X29 A;  4FF4 A;  2DDH A;  3FO3 A;  1X90 A;  1UDY A;  2RDZ A;  3MMO A;  3UU9 A;  4L3Y A;  2OEX A;  1XFZ A;  2A1T A;  2YYI A;  1RX0 A;  3M9V A;  2AO2 A;  4IRN A;  2EBF X;  1SIR A;  2BU6 A;  3Q22 A;  4MPC A;  2WBI A;  1LVC A;  2XS1 A;  3MPJ A;  2Z1Q A;  3OIB A;  1JM6 A;  3D9E A;  2ZDX A;  4G97 A;  4KS9 A;  2ZO5 A;  3LG1 A;  3D9D A;  2R03 A;  3OWA A;  2C12 A;  4U83 A;  5K3I A;  2R02 A;  4Q0T A;  4OO2 A;  3S7W A;  3SXQ A;  3HWC A;  4HKS A;  4O5M A;  2E81 A;  2D29 A;  2HJN A;  4L3Z A;  2VIG A;  2J7A A;  2XQR B;  1FS8 A;  2OT4 A;  1IVH A;  3CRL A;  2DVL A;  2LFW A;  4MPE A;  1WS9 A;  5EZ3 A;  5K3H A;  2CX9 A;  4XVX A;  1FS9 A;  4M9A A;  2YYJ A;  2RF7 A;  4H81 A;  4Q1O A;  5GJW E;  2ZKJ A;  5GJV E;  1K8T A;  5B5W A;  4HR3 A;  4Q5B A;  2UXW A;  3OWM A;  2Q8F A;  2ZAF A;  4G5E A;  4F0X A;  4FF2 A;  3MXL A;  3FCJ A;  1R2J A;  4L3X A;  3KML A;  1RP3 A;  3GQT A;  3Q24 A;  3VAD A;  4MP2 A;  4AKH A;  3D6B A;  1GKX A;  3VKG A;  3GNC A;  2Q8H A;  2FP1 A;  1EGC A;  4ZXV A;  2JIF A;  5B6B A;  4IV6 A;  3N0R A;  3D2R A;  1W07 A;  2IX6 A;  3TZ5 A;  4MPN A;  4DZY A;  4E00 A;  2REH A;  4KTO A;  3GM6 A;  1K93 A;  1XFV A;  3Q23 A;  5M4P A;  2BTZ A;  3C46 A;  3AFF A;  2PG0 A;  3L1T A;  2Q8I A;  3EOM A;  4P79 A;  4V25 A;  2PO4 A;  2Q8G A;  4Q4U A;  4Q17 A;  2OJQ A;  4MP7 A;  5K3G A;  1RJ1 A;  5M4M A;  2RFQ A;  2BU8 A;  1K90 A;  3CE2 A;  2ZDY A;  1EGE A;  1UKW A;  3BNJ A;  3VKH A;  2VF1 A;  2AZE A;  4LQQ B;  1XG2 B;  2CJ6 A;  2GBB A;  1GJV A;  2YGW A;  4WJY A;  3PFD A;  4FZ4 A;  4KCF A;  5BRM A;  3Q0A A;  1BUC A;  2CJ8 A;  1XFW A;  4DOY A;  2OEV A;  3MDD A;  1PI1 A;  2YYG A;  3TOR A;  4E02 A;  4HKR A;  4FF1 A;  2CJ5 A;  2F6L A;  1RJ4 A;  1X91 A;  1XFU A;  1PK0 A;  1Y8N A;  3AFE A;  3TTB A;  3TZ0 A;  4L38 A;  3C2P A;  1R3B A;  3EON A;  2YYK A;  2JBS A;  4AKG A;  2EBA A;  1Y8O A;  5J71 A;  1XFX A;  4V26 A;  2JBR A;  3MDE A;  3P4T A;  1Y8P A;  3D1I A;  3X0Y A;  1FS7 A;  3MKH A;  4JEK A; 
#chains in the Genus database with same CATH homology
 3BNH A;  3BNG A;  2E80 A;  1SIQ A;  1U8V A;  2JBT A;  3SWO A;  4Q5C A;  4L1F A;  2R0M A;  4NXL A;  1QDB A;  4W9U A;  1JQI A;  3D9G A;  3UBR A;  2OR0 A;  3D9F A;  3SCE A;  3B96 A;  1OAH A;  4ZYJ A;  2VR0 A;  1T9G A;  2YYM A;  1EGD A;  5K3J A;  3BNF A;  3F29 A;  2FON A;  1GU6 A;  2YYL A;  3LGQ A;  3RKH A;  2R0N A;  4X28 C;  3R7K A;  4N5F A;  3NF4 A;  4X28 A;  4P13 A;  4RM7 A;  3SF6 A;  1IS2 A;  3X0X A;  3MPI A;  2C0U A;  3II9 A;  2IX5 A;  2DDH A;  3FO3 A;  3MMO A;  1UDY A;  2RDZ A;  3UU9 A;  4L3Y A;  2A1T A;  2YYI A;  1RX0 A;  3M9V A;  4IRN A;  1SIR A;  2WBI A;  3MPJ A;  2Z1Q A;  3OIB A;  3D9E A;  2ZO5 A;  3LG1 A;  3D9D A;  3OWA A;  2C12 A;  4U83 A;  5K3I A;  3SXQ A;  4Q0T A;  4OO2 A;  3S7W A;  3HWC A;  4O5M A;  2E81 A;  2D29 A;  4L3Z A;  2VIG A;  2J7A A;  1FS8 A;  2OT4 A;  1IVH A;  2DVL A;  1WS9 A;  5K3H A;  2CX9 A;  4XVX A;  1FS9 A;  4M9A A;  2YYJ A;  2RF7 A;  4Q1O A;  4HR3 A;  4Q5B A;  2UXW A;  3OWM A;  2ZAF A;  4G5E A;  3MXL A;  3FCJ A;  1R2J A;  4L3X A;  3GQT A;  3D6B A;  3GNC A;  1EGC A;  4ZXV A;  2JIF A;  4IV6 A;  1W07 A;  2IX6 A;  2REH A;  4KTO A;  3GM6 A;  3AFF A;  2PG0 A;  3L1T A;  3EOM A;  4Q4U A;  4Q17 A;  5K3G A;  2RFQ A;  1EGE A;  1UKW A;  3BNJ A;  4WJY A;  3PFD A;  4KCF A;  1BUC A;  3TOR A;  4DOY A;  3MDD A;  2YYG A;  3AFE A;  3TTB A;  4L38 A;  3EON A;  2YYK A;  2JBS A;  2EBA A;  2JBR A;  3MDE A;  3P4T A;  3D1I A;  3X0Y A;  1FS7 A;  3MKH A;  4JEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...