2F6LA

X-ray structure of chorismate mutase from mycobacterium tuberculosis
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
166
structure length
166
Chain Sequence
DGTSQLAELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSLYQRALTTATQSYCQALPPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Chorismate mutase
publication title Biochemical and structural characterization of the secreted chorismate mutase (Rv1885c) from Mycobacterium tuberculosis H37Rv: an *AroQ enzyme not regulated by the aromatic amino acids.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 70
structure length 166
sequence length 166
chains with identical sequence B
ec nomenclature ec 5.4.99.5: Chorismate mutase.
pdb deposition date 2005-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01817 CM_2 Chorismate mutase type II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.170 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A; domain 3 2f6lA00
2FP1A 2AO2A 2FP2A 2GBBA 2F6LA
chains in the Genus database with same CATH superfamily
2J7AA 5B6BA 3EONA 4L38A 5M4NA 5K3JA 4Q17A 4JIOA 4MPCA 5K3IA 2D29A 2DVLA 2BU8A 2GBBA 3MPJA 1OAHA 4WJYA 2RF7A 4FZ4A 4RM7A 2R05A 1GU6A 1JQIA 1U8VA 2JBRA 3CRLA 2R03A 3LGQA 2Z1QA 4HR3A 4Q4UA 5M4KA 3D9FA 3OWAA 4Q5CA 2EBHX 3Q0AA 1UDYA 2LFWA 2IX6A 2ZAFA 3BNFA 5J6AA 3R7KA 2OEXA 4AKIA 4E00A 2E0AA 3TZ5A 3CRKA 3X0XA 1IVHA 1EGDA 1RJ1A 2OT4A 4O5MA 1LVCA 3VKGA 1GKXA 1Y8PA 1R2JA 2BU5A 3CE2A 2VF1A 1T9GA 1K8TA 3FCJA 4MPEA 4W9UA 2PNRA 4X28C 4U83A 3B96A 4E01A 1RJ4A 2UXWA 3MDEA 2QR4A 4KS9A 3II9A 2ZKJA 1RP3A 3X0YA 4KCFA 4V25A 2XS8A 3TZ0A 4FF4A 2YYLA 2IX5A 4DZYA 4AKGA 2R0NA 2JBSA 5M4MA 4KSAA 3KMLA 3SXQA 3D9DA 4LQSB 1PK0A 2YYKA 2A1TA 4G97A 3UU9A 3AFEA 1XFWA 3M9VA 3MDDA 2JIFA 3MKHA 3UBRA 4KTOA 3EOMA 1Y8OA 1FS8A 2XS1A 2BTZA 1SK6A 3D9EA 4Q0TA 3TZ4A 4X28A 2CJ5A 2ZDYA 3BNGA 1Y8NA 2FP1A 2JBTA 3F29A 1EGEA 3MXLA 2EBFX 2RDZA 2OR0A 3D1IA 3FO3A 3GNCA 3GM6A 4HKSA 4MP7A 4FF2A 3P4TA 4V26A 4N5FA 2AZEA 3NF4A 4JIZA 3Q23A 2YYIA 2VR0A 2PG0A 3BNHA 3TZ2A 1JM6A 3C3LA 4XVXA 2Q8GA 2C0UA 2REHA 3MPIA 4H7QA 1XG2B 5B5WA 5BRKA 2YYJA 2WBIA 4OO2A 1SIQA 2YGWA 3D9GA 4NXLA 4LQQB 1W07A 4L3XA 4J1VA 4AI6A 1X91A 4F0XA 1GJVA 3HWCA 1IS2A 1X8ZA 2BU7A 2OEVA 1S26A 1FS9A 2DDHA 3SCEA 2BU6A 2FONA 2CJ6A 4H85A 4IV6A 4QICA 5K3HA 2Q8IA 3SF6A 2ZO5A 1UKWA 2CJ8A 1SC5A 4ZYJA 3Q24A 1WS9A 2RFQA 3X29A 3C2PA 3C46A 2F6LA 4DOYA 2EBAA 4FF3A 5K3GA 3LG1A 4L3ZA 3Q22A 5GJVE 4IRNA 3GQTA 4P79A 3RKHA 1K90A 2BU2A 2YYMA 2ZDXA 3OIBA 1X90A 2Q8FA 5J71A 3SWOA 3OWMA 1EGCA 2YYGA 3BNJA 3L1TA 5BRMA 1QDBA 2OJQA 2VIGA 4KSFA 1R3BA 3TTBA 4HKRA 3VKHA 2Q8HA 2FP2A 3S7WA 1XFZA 4G5EA 3D6BA 1Y0VA 4L1FA 3PFDA 4MPNA 5GJWE 2AO2A 2E81A 1FS7A 2CJ7A 4L3YA 3TORA 4AKHA 2PO4A 5M4PA 3AFFA 2XQRB 2CX9A 1RX0A 4FF1A 1GKZA 4M9AA 1XFVA 2E80A 2R02A 4Q5BA 1XFYA 3VADA 2C12A 2EC5A 4JEKA 1XFUA 4MP2A 3N0RA 4ZXVA 1PI1A 4Q1OA 1K93A 1SIRA 1XFXA 5B5VA 4E02A 3D2RA 4P13A 2R0MA 2CJ4A 2HJNA 1BUCA 4H81A 3MMOA
chains in the Genus database with same CATH topology
1K8TA 2QR4A 4KS9A 4KSFA 3VKHA 4HKRA 1RP3A 2FP2A 2GBBA 1XFZA 1Y0VA 4FZ4A 5GJWE 2AO2A 2YGWA 4AKHA 4AKGA 2PO4A 4KSAA 3KMLA 4AI6A 4F0XA 1PK0A 4G97A 3Q0AA 2EBHX 1S26A 1XFWA 1XFVA 4FF1A 2LFWA 1XFYA 4QICA 4AKIA 3Q24A 1SC5A 2EC5A 3X29A 1XFUA 1SK6A 3C2PA 2F6LA 3C46A 3N0RA 4FF3A 1LVCA 2FP1A 3Q22A 5GJVE 1K93A 2EBFX 3VKGA 1XFXA 4P79A 1K90A 4HKSA 4FF2A 2AZEA 3CE2A 3Q23A 4FF4A 2VF1A 3C3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FP1 A;  2AO2 A;  2FP2 A;  2GBB A;  2F6L A; 
#chains in the Genus database with same CATH topology
 2J7A A;  5B6B A;  3EON A;  4L38 A;  5M4N A;  5K3J A;  4Q17 A;  4JIO A;  4MPC A;  5K3I A;  2D29 A;  2DVL A;  2BU8 A;  2GBB A;  3MPJ A;  1OAH A;  4WJY A;  2RF7 A;  4FZ4 A;  4RM7 A;  2R05 A;  1GU6 A;  1JQI A;  1U8V A;  2JBR A;  3CRL A;  2R03 A;  3LGQ A;  2Z1Q A;  4HR3 A;  4Q4U A;  5M4K A;  3D9F A;  3OWA A;  4Q5C A;  2EBH X;  3Q0A A;  1UDY A;  2LFW A;  2IX6 A;  2ZAF A;  3BNF A;  5J6A A;  3R7K A;  2OEX A;  4AKI A;  4E00 A;  2E0A A;  3TZ5 A;  3CRK A;  3X0X A;  1IVH A;  1EGD A;  1RJ1 A;  2OT4 A;  4O5M A;  1LVC A;  3VKG A;  1GKX A;  1Y8P A;  1R2J A;  2BU5 A;  3CE2 A;  2VF1 A;  1T9G A;  1K8T A;  3FCJ A;  4MPE A;  4W9U A;  2PNR A;  4X28 C;  4U83 A;  3B96 A;  4E01 A;  1RJ4 A;  2UXW A;  3MDE A;  2QR4 A;  4KS9 A;  3II9 A;  2ZKJ A;  1RP3 A;  3X0Y A;  4KCF A;  4V25 A;  2XS8 A;  3TZ0 A;  4FF4 A;  2YYL A;  2IX5 A;  4DZY A;  4AKG A;  2R0N A;  2JBS A;  5M4M A;  4KSA A;  3KML A;  3SXQ A;  3D9D A;  4LQS B;  1PK0 A;  2YYK A;  2A1T A;  4G97 A;  3UU9 A;  3AFE A;  1XFW A;  3M9V A;  3MDD A;  2JIF A;  3MKH A;  3UBR A;  4KTO A;  3EOM A;  1Y8O A;  1FS8 A;  2XS1 A;  2BTZ A;  1SK6 A;  3D9E A;  4Q0T A;  3TZ4 A;  4X28 A;  2CJ5 A;  2ZDY A;  3BNG A;  1Y8N A;  2FP1 A;  2JBT A;  3F29 A;  1EGE A;  3MXL A;  2EBF X;  2RDZ A;  2OR0 A;  3D1I A;  3FO3 A;  3GNC A;  3GM6 A;  4HKS A;  4MP7 A;  4FF2 A;  3P4T A;  4V26 A;  4N5F A;  2AZE A;  3NF4 A;  4JIZ A;  3Q23 A;  2YYI A;  2VR0 A;  2PG0 A;  3BNH A;  3TZ2 A;  1JM6 A;  3C3L A;  4XVX A;  2Q8G A;  2C0U A;  2REH A;  3MPI A;  4H7Q A;  1XG2 B;  5B5W A;  5BRK A;  2YYJ A;  2WBI A;  4OO2 A;  1SIQ A;  2YGW A;  3D9G A;  4NXL A;  4LQQ B;  1W07 A;  4L3X A;  4J1V A;  4AI6 A;  1X91 A;  4F0X A;  1GJV A;  3HWC A;  1IS2 A;  1X8Z A;  2BU7 A;  2OEV A;  1S26 A;  1FS9 A;  2DDH A;  3SCE A;  2BU6 A;  2FON A;  2CJ6 A;  4H85 A;  4IV6 A;  4QIC A;  5K3H A;  2Q8I A;  3SF6 A;  2ZO5 A;  1UKW A;  2CJ8 A;  1SC5 A;  4ZYJ A;  3Q24 A;  1WS9 A;  2RFQ A;  3X29 A;  3C2P A;  3C46 A;  2F6L A;  4DOY A;  2EBA A;  4FF3 A;  5K3G A;  3LG1 A;  4L3Z A;  3Q22 A;  5GJV E;  4IRN A;  3GQT A;  4P79 A;  3RKH A;  1K90 A;  2BU2 A;  2YYM A;  2ZDX A;  3OIB A;  1X90 A;  2Q8F A;  5J71 A;  3SWO A;  3OWM A;  1EGC A;  2YYG A;  3BNJ A;  3L1T A;  5BRM A;  1QDB A;  2OJQ A;  2VIG A;  4KSF A;  1R3B A;  3TTB A;  4HKR A;  3VKH A;  2Q8H A;  2FP2 A;  3S7W A;  1XFZ A;  4G5E A;  3D6B A;  1Y0V A;  4L1F A;  3PFD A;  4MPN A;  5GJW E;  2AO2 A;  2E81 A;  1FS7 A;  2CJ7 A;  4L3Y A;  3TOR A;  4AKH A;  2PO4 A;  5M4P A;  3AFF A;  2XQR B;  2CX9 A;  1RX0 A;  4FF1 A;  1GKZ A;  4M9A A;  1XFV A;  2E80 A;  2R02 A;  4Q5B A;  1XFY A;  3VAD A;  2C12 A;  2EC5 A;  4JEK A;  1XFU A;  4MP2 A;  3N0R A;  4ZXV A;  1PI1 A;  4Q1O A;  1K93 A;  1SIR A;  1XFX A;  5B5V A;  4E02 A;  3D2R A;  4P13 A;  2R0M A;  2CJ4 A;  2HJN A;  1BUC A;  4H81 A;  3MMO A; 
#chains in the Genus database with same CATH homology
 1K8T A;  2QR4 A;  4KS9 A;  4KSF A;  3VKH A;  4HKR A;  1RP3 A;  2FP2 A;  2GBB A;  1XFZ A;  1Y0V A;  4FZ4 A;  5GJW E;  2AO2 A;  2YGW A;  4AKH A;  4AKG A;  2PO4 A;  4KSA A;  3KML A;  4AI6 A;  4F0X A;  1PK0 A;  4G97 A;  3Q0A A;  2EBH X;  1S26 A;  1XFW A;  1XFV A;  4FF1 A;  2LFW A;  1XFY A;  4QIC A;  4AKI A;  3Q24 A;  1SC5 A;  2EC5 A;  3X29 A;  1XFU A;  1SK6 A;  3C2P A;  2F6L A;  3C46 A;  3N0R A;  4FF3 A;  1LVC A;  2FP1 A;  3Q22 A;  5GJV E;  1K93 A;  2EBF X;  3VKG A;  1XFX A;  4P79 A;  1K90 A;  4HKS A;  4FF2 A;  2AZE A;  3CE2 A;  3Q23 A;  4FF4 A;  2VF1 A;  3C3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...