2CJ5A

Crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
147
structure length
147
Chain Sequence
NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell-Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Inhibitor
total genus 60
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj5A00
2CJ7A 1X8ZA 1X91A 2CJ8A 1RJ1A 1XG2B 2CJ5A 1X90A 2XQRB 1RJ4A 2CJ4A 2CJ6A
chains in the Genus database with same CATH superfamily
2PO4A 1IVHA 2ZAFA 3BNHA 4L3ZA 4U83A 2BU7A 2Q8IA 1T9GA 3NF4A 5J6AA 3C46A 3BNFA 4E00A 1GKXA 4RM7A 4V25A 4AKIA 5M4KA 4Q4UA 2VR0A 1X8ZA 2F6LA 1FS7A 2XS8A 3D2RA 2C0UA 3CE2A 3OWMA 2OEVA 2BU6A 5K3JA 3II9A 5K3HA 1X90A 3B96A 3MPIA 2R0MA 4IV6A 4Q5BA 2FP1A 4AKHA 2REHA 2Q8HA 4P13A 1PI1A 4E02A 1RX0A 3GM6A 2UXWA 4JEKA 1RP3A 1GU6A 3MPJA 4HR3A 4JIZA 3FO3A 2WBIA 3BNGA 1BUCA 1XG2B 3GNCA 4Q5CA 4DOYA 1GKZA 4XVXA 2JBSA 3SXQA 3D9GA 3MDEA 2E81A 2OJQA 3CRKA 4LQSB 2XQRB 1EGEA 3SF6A 3SWOA 4WJYA 3UBRA 2OEXA 3EONA 4H7QA 4ZXVA 3X0YA 5J71A 1K90A 5M4NA 1UKWA 3TZ5A 5K3IA 1LVCA 1XFUA 3D1IA 4HKSA 4MP2A 2E0AA 3VKGA 2CJ6A 2AZEA 1K8TA 2PG0A 3MDDA 3TORA 2RDZA 3CRLA 3HWCA 3P4TA 4W9UA 2D29A 2EBFX 3OWAA 4X28A 3C2PA 1Y8PA 3VKHA 5GJWE 3L1TA 4L1FA 1SIQA 2R0NA 3X0XA 4AI6A 3OIBA 2EC5A 4KSFA 3AFEA 2BU5A 2CJ5A 2IX6A 3BNJA 3N0RA 4G5EA 1SIRA 4KCFA 2BU8A 4MP7A 1EGDA 4L38A 4E01A 1X91A 1EGCA 1JM6A 1RJ1A 2DDHA 2YYIA 2HJNA 2FP2A 4FZ4A 1XFYA 4DZYA 2ZDXA 5K3GA 3TZ2A 2PNRA 4HKRA 4MPEA 2VF1A 2CJ7A 4J1VA 4L3XA 3RKHA 1PK0A 5B6BA 4MPCA 1SK6A 1UDYA 2YYJA 4L3YA 4QICA 3SCEA 4M9AA 3Q24A 2YYLA 3F29A 4FF2A 3S7WA 4FF4A 1XFXA 2CJ8A 1W07A 2FONA 2VIGA 3UU9A 2Z1QA 3D9FA 2A1TA 3LGQA 4H81A 3X29A 4F0XA 4IRNA 4X28C 2Q8GA 1R3BA 1Y0VA 2EBHX 3MKHA 3Q22A 4JIOA 2JIFA 3M9VA 4AKGA 2OR0A 2YGWA 1R2JA 3PFDA 4NXLA 3FCJA 4KTOA 2BU2A 4G97A 1S26A 4FF1A 3MMOA 4Q17A 2R03A 2BTZA 1IS2A 3Q23A 1U8VA 2CJ4A 4N5FA 4V26A 4P79A 5B5VA 4O5MA 4H85A 1XFVA 5BRMA 1JQIA 5M4MA 3VADA 2RF7A 1Y8OA 2ZO5A 1Y8NA 2DVLA 4MPNA 2OT4A 3D6BA 3D9DA 4Q0TA 2XS1A 4ZYJA 2IX5A 3TZ0A 2C12A 2AO2A 1RJ4A 2QR4A 2R05A 3KMLA 1FS9A 4LQQB 5GJVE 2JBTA 1SC5A 2CX9A 3GQTA 1WS9A 2R02A 1OAHA 3LG1A 4OO2A 2GBBA 3MXLA 1XFZA 3C3LA 3EOMA 2YYKA 1XFWA 2EBAA 2ZKJA 1QDBA 3TTBA 4KS9A 3Q0AA 3D9EA 1GJVA 2LFWA 2YYMA 3AFFA 3TZ4A 4Q1OA 2RFQA 2J7AA 2YYGA 2Q8FA 5BRKA 4KSAA 5M4PA 3R7KA 5B5WA 1K93A 4FF3A 2ZDYA 2JBRA 1FS8A 2E80A
chains in the Genus database with same CATH topology
2CJ7A 1X8ZA 1X91A 2CJ8A 1RJ1A 1XG2B 2CJ5A 1X90A 2XQRB 1RJ4A 2CJ4A 2CJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJ7 A;  1X8Z A;  1X91 A;  2CJ8 A;  1RJ1 A;  1XG2 B;  2CJ5 A;  1X90 A;  2XQR B;  1RJ4 A;  2CJ4 A;  2CJ6 A; 
#chains in the Genus database with same CATH topology
 2PO4 A;  1IVH A;  2ZAF A;  3BNH A;  4L3Z A;  4U83 A;  2BU7 A;  2Q8I A;  1T9G A;  3NF4 A;  5J6A A;  3C46 A;  3BNF A;  4E00 A;  1GKX A;  4RM7 A;  4V25 A;  4AKI A;  5M4K A;  4Q4U A;  2VR0 A;  1X8Z A;  2F6L A;  1FS7 A;  2XS8 A;  3D2R A;  2C0U A;  3CE2 A;  3OWM A;  2OEV A;  2BU6 A;  5K3J A;  3II9 A;  5K3H A;  1X90 A;  3B96 A;  3MPI A;  2R0M A;  4IV6 A;  4Q5B A;  2FP1 A;  4AKH A;  2REH A;  2Q8H A;  4P13 A;  1PI1 A;  4E02 A;  1RX0 A;  3GM6 A;  2UXW A;  4JEK A;  1RP3 A;  1GU6 A;  3MPJ A;  4HR3 A;  4JIZ A;  3FO3 A;  2WBI A;  3BNG A;  1BUC A;  1XG2 B;  3GNC A;  4Q5C A;  4DOY A;  1GKZ A;  4XVX A;  2JBS A;  3SXQ A;  3D9G A;  3MDE A;  2E81 A;  2OJQ A;  3CRK A;  4LQS B;  2XQR B;  1EGE A;  3SF6 A;  3SWO A;  4WJY A;  3UBR A;  2OEX A;  3EON A;  4H7Q A;  4ZXV A;  3X0Y A;  5J71 A;  1K90 A;  5M4N A;  1UKW A;  3TZ5 A;  5K3I A;  1LVC A;  1XFU A;  3D1I A;  4HKS A;  4MP2 A;  2E0A A;  3VKG A;  2CJ6 A;  2AZE A;  1K8T A;  2PG0 A;  3MDD A;  3TOR A;  2RDZ A;  3CRL A;  3HWC A;  3P4T A;  4W9U A;  2D29 A;  2EBF X;  3OWA A;  4X28 A;  3C2P A;  1Y8P A;  3VKH A;  5GJW E;  3L1T A;  4L1F A;  1SIQ A;  2R0N A;  3X0X A;  4AI6 A;  3OIB A;  2EC5 A;  4KSF A;  3AFE A;  2BU5 A;  2CJ5 A;  2IX6 A;  3BNJ A;  3N0R A;  4G5E A;  1SIR A;  4KCF A;  2BU8 A;  4MP7 A;  1EGD A;  4L38 A;  4E01 A;  1X91 A;  1EGC A;  1JM6 A;  1RJ1 A;  2DDH A;  2YYI A;  2HJN A;  2FP2 A;  4FZ4 A;  1XFY A;  4DZY A;  2ZDX A;  5K3G A;  3TZ2 A;  2PNR A;  4HKR A;  4MPE A;  2VF1 A;  2CJ7 A;  4J1V A;  4L3X A;  3RKH A;  1PK0 A;  5B6B A;  4MPC A;  1SK6 A;  1UDY A;  2YYJ A;  4L3Y A;  4QIC A;  3SCE A;  4M9A A;  3Q24 A;  2YYL A;  3F29 A;  4FF2 A;  3S7W A;  4FF4 A;  1XFX A;  2CJ8 A;  1W07 A;  2FON A;  2VIG A;  3UU9 A;  2Z1Q A;  3D9F A;  2A1T A;  3LGQ A;  4H81 A;  3X29 A;  4F0X A;  4IRN A;  4X28 C;  2Q8G A;  1R3B A;  1Y0V A;  2EBH X;  3MKH A;  3Q22 A;  4JIO A;  2JIF A;  3M9V A;  4AKG A;  2OR0 A;  2YGW A;  1R2J A;  3PFD A;  4NXL A;  3FCJ A;  4KTO A;  2BU2 A;  4G97 A;  1S26 A;  4FF1 A;  3MMO A;  4Q17 A;  2R03 A;  2BTZ A;  1IS2 A;  3Q23 A;  1U8V A;  2CJ4 A;  4N5F A;  4V26 A;  4P79 A;  5B5V A;  4O5M A;  4H85 A;  1XFV A;  5BRM A;  1JQI A;  5M4M A;  3VAD A;  2RF7 A;  1Y8O A;  2ZO5 A;  1Y8N A;  2DVL A;  4MPN A;  2OT4 A;  3D6B A;  3D9D A;  4Q0T A;  2XS1 A;  4ZYJ A;  2IX5 A;  3TZ0 A;  2C12 A;  2AO2 A;  1RJ4 A;  2QR4 A;  2R05 A;  3KML A;  1FS9 A;  4LQQ B;  5GJV E;  2JBT A;  1SC5 A;  2CX9 A;  3GQT A;  1WS9 A;  2R02 A;  1OAH A;  3LG1 A;  4OO2 A;  2GBB A;  3MXL A;  1XFZ A;  3C3L A;  3EOM A;  2YYK A;  1XFW A;  2EBA A;  2ZKJ A;  1QDB A;  3TTB A;  4KS9 A;  3Q0A A;  3D9E A;  1GJV A;  2LFW A;  2YYM A;  3AFF A;  3TZ4 A;  4Q1O A;  2RFQ A;  2J7A A;  2YYG A;  2Q8F A;  5BRK A;  4KSA A;  5M4P A;  3R7K A;  5B5W A;  1K93 A;  4FF3 A;  2ZDY A;  2JBR A;  1FS8 A;  2E80 A; 
#chains in the Genus database with same CATH homology
 2CJ7 A;  1X8Z A;  1X91 A;  2CJ8 A;  1RJ1 A;  1XG2 B;  2CJ5 A;  1X90 A;  2XQR B;  1RJ4 A;  2CJ4 A;  2CJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...