2CJ5A

Crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0)
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
147
structure length
147
Chain Sequence
NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKGSKSPFSALNIAVHELSDVGRAIVRNLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Inhibitor
molecule keywords INVERTASE INHIBITOR
publication title Multiple Crystal Forms of the Cell-Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb
source organism Nicotiana tabacum
total genus 60
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2006-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.40 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Invertase/pectin methylesterase inhibitor family protein 2cj5A00
1X8ZA 2CJ4A 2CJ6A 2XQRB 1X91A 2CJ8A 1RJ1A 1XG2B 2CJ7A 1X90A 1RJ4A 2CJ5A
chains in the Genus database with same CATH superfamily
2Q8IA 2ZDXA 3EONA 2XQRB 2Q8HA 2EBHX 5B5VA 2PG0A 3GM6A 2CJ5A 4M9AA 1W07A 3N0RA 1Y8PA 2HJNA 3D9DA 4J1VA 1EGEA 1PK0A 2AZEA 4LQSB 3II9A 4MPEA 5K3HA 1GJVA 1SIQA 3D2RA 1XG2B 3X29A 1K90A 2BU2A 3GQTA 4JEKA 3MKHA 3MMOA 3CRLA 3LGQA 3GNCA 2E80A 1SIRA 1SK6A 4L1FA 5B5WA 3Q23A 1U8VA 1IS2A 2R05A 1RJ4A 1XFZA 2CJ6A 3UBRA 3L1TA 1QDBA 1Y8OA 3P4TA 3M9VA 2BU5A 3X0XA 3F29A 2YYGA 4H85A 3Q22A 3EOMA 2VF1A 3BNHA 1XFVA 4DOYA 3D9FA 2BU8A 3VKHA 2JBSA 3MPIA 1IVHA 2JBRA 4MPNA 1XFUA 3C2PA 1XFWA 2OT4A 2YYMA 2FONA 4O5MA 2ZKJA 1LVCA 1EGCA 1R3BA 1UKWA 3CRKA 3D9EA 4G97A 4E00A 3C46A 5B6BA 4KCFA 3PFDA 4IV6A 3BNFA 4F0XA 5M4MA 2EBFX 2OEVA 2PNRA 4KSFA 2OEXA 2JBTA 2QR4A 3B96A 4P79A 5J71A 4ZYJA 1R2JA 2EBAA 2EC5A 2YYKA 4Q4UA 3TORA 2UXWA 4Q5CA 2PO4A 1FS7A 5M4PA 2WBIA 3OWAA 4X28C 2JIFA 5K3JA 3FCJA 4DZYA 1SC5A 4RM7A 2A1TA 2AO2A 4HR3A 4FF4A 2VIGA 4KSAA 2RFQA 4U83A 3TTBA 4XVXA 4MP7A 1FS8A 1X8ZA 4H7QA 2IX5A 2D29A 1UDYA 2FP1A 2XS1A 4MPCA 1K8TA 5K3IA 2RF7A 4OO2A 2BU7A 1RJ1A 2IX6A 2OJQA 4L3ZA 5GJVE 1XFYA 2ZO5A 2R02A 3KMLA 1RX0A 2OR0A 4V26A 3VKGA 2XS8A 4FZ4A 4KTOA 3SCEA 2VR0A 4X28A 1XFXA 4G5EA 2DDHA 2RDZA 3AFEA 3BNGA 1BUCA 2Z1QA 5M4NA 2C12A 3C3LA 3TZ5A 1JM6A 3RKHA 5M4KA 1PI1A 2CX9A 3UU9A 2REHA 2E0AA 4LQQB 1X91A 3CE2A 4L3XA 2FP2A 1WS9A 3MPJA 5J6AA 3Q0AA 3HWCA 2YYJA 4W9UA 2YGWA 4KS9A 5GJWE 4FF2A 4N5FA 2C0UA 4HKRA 2GBBA 3D1IA 1GKZA 2ZAFA 2ZDYA 4MP2A 1X90A 4Q5BA 4P13A 3MDDA 3SF6A 3S7WA 3SXQA 2F6LA 2YYLA 3MXLA 4JIOA 3D6BA 2CJ8A 2R0MA 2R0NA 4ZXVA 3AFFA 4JIZA 4AKHA 5K3GA 3X0YA 3VADA 2CJ7A 3TZ2A 4H81A 3D9GA 4NXLA 4AI6A 1Y0VA 3OWMA 4HKSA 4FF3A 4IRNA 1Y8NA 3NF4A 4FF1A 4L3YA 2Q8GA 4AKIA 1GU6A 3BNJA 3TZ4A 3LG1A 2YYIA 2DVLA 4E02A 2CJ4A 1K93A 1EGDA 4L38A 4V25A 5BRKA 4AKGA 3MDEA 2LFWA 5BRMA 2R03A 3FO3A 4E01A 2BTZA 2BU6A 2Q8FA 3TZ0A 4QICA 2E81A 1JQIA 1RP3A 1S26A 4Q1OA 4Q17A 4WJYA 1OAHA 1FS9A 3OIBA 1T9GA 2J7AA 3SWOA 3R7KA 3Q24A 4Q0TA 1GKXA
chains in the Genus database with same CATH topology
1X8ZA 2CJ4A 2CJ6A 2XQRB 1X91A 2CJ8A 1RJ1A 1XG2B 2CJ7A 1X90A 1RJ4A 2CJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Z A;  2CJ4 A;  2CJ6 A;  2XQR B;  1X91 A;  2CJ8 A;  1RJ1 A;  1XG2 B;  2CJ7 A;  1X90 A;  1RJ4 A;  2CJ5 A; 
#chains in the Genus database with same CATH topology
 2Q8I A;  2ZDX A;  3EON A;  2XQR B;  2Q8H A;  2EBH X;  5B5V A;  2PG0 A;  3GM6 A;  2CJ5 A;  4M9A A;  1W07 A;  3N0R A;  1Y8P A;  2HJN A;  3D9D A;  4J1V A;  1EGE A;  1PK0 A;  2AZE A;  4LQS B;  3II9 A;  4MPE A;  5K3H A;  1GJV A;  1SIQ A;  3D2R A;  1XG2 B;  3X29 A;  1K90 A;  2BU2 A;  3GQT A;  4JEK A;  3MKH A;  3MMO A;  3CRL A;  3LGQ A;  3GNC A;  2E80 A;  1SIR A;  1SK6 A;  4L1F A;  5B5W A;  3Q23 A;  1U8V A;  1IS2 A;  2R05 A;  1RJ4 A;  1XFZ A;  2CJ6 A;  3UBR A;  3L1T A;  1QDB A;  1Y8O A;  3P4T A;  3M9V A;  2BU5 A;  3X0X A;  3F29 A;  2YYG A;  4H85 A;  3Q22 A;  3EOM A;  2VF1 A;  3BNH A;  1XFV A;  4DOY A;  3D9F A;  2BU8 A;  3VKH A;  2JBS A;  3MPI A;  1IVH A;  2JBR A;  4MPN A;  1XFU A;  3C2P A;  1XFW A;  2OT4 A;  2YYM A;  2FON A;  4O5M A;  2ZKJ A;  1LVC A;  1EGC A;  1R3B A;  1UKW A;  3CRK A;  3D9E A;  4G97 A;  4E00 A;  3C46 A;  5B6B A;  4KCF A;  3PFD A;  4IV6 A;  3BNF A;  4F0X A;  5M4M A;  2EBF X;  2OEV A;  2PNR A;  4KSF A;  2OEX A;  2JBT A;  2QR4 A;  3B96 A;  4P79 A;  5J71 A;  4ZYJ A;  1R2J A;  2EBA A;  2EC5 A;  2YYK A;  4Q4U A;  3TOR A;  2UXW A;  4Q5C A;  2PO4 A;  1FS7 A;  5M4P A;  2WBI A;  3OWA A;  4X28 C;  2JIF A;  5K3J A;  3FCJ A;  4DZY A;  1SC5 A;  4RM7 A;  2A1T A;  2AO2 A;  4HR3 A;  4FF4 A;  2VIG A;  4KSA A;  2RFQ A;  4U83 A;  3TTB A;  4XVX A;  4MP7 A;  1FS8 A;  1X8Z A;  4H7Q A;  2IX5 A;  2D29 A;  1UDY A;  2FP1 A;  2XS1 A;  4MPC A;  1K8T A;  5K3I A;  2RF7 A;  4OO2 A;  2BU7 A;  1RJ1 A;  2IX6 A;  2OJQ A;  4L3Z A;  5GJV E;  1XFY A;  2ZO5 A;  2R02 A;  3KML A;  1RX0 A;  2OR0 A;  4V26 A;  3VKG A;  2XS8 A;  4FZ4 A;  4KTO A;  3SCE A;  2VR0 A;  4X28 A;  1XFX A;  4G5E A;  2DDH A;  2RDZ A;  3AFE A;  3BNG A;  1BUC A;  2Z1Q A;  5M4N A;  2C12 A;  3C3L A;  3TZ5 A;  1JM6 A;  3RKH A;  5M4K A;  1PI1 A;  2CX9 A;  3UU9 A;  2REH A;  2E0A A;  4LQQ B;  1X91 A;  3CE2 A;  4L3X A;  2FP2 A;  1WS9 A;  3MPJ A;  5J6A A;  3Q0A A;  3HWC A;  2YYJ A;  4W9U A;  2YGW A;  4KS9 A;  5GJW E;  4FF2 A;  4N5F A;  2C0U A;  4HKR A;  2GBB A;  3D1I A;  1GKZ A;  2ZAF A;  2ZDY A;  4MP2 A;  1X90 A;  4Q5B A;  4P13 A;  3MDD A;  3SF6 A;  3S7W A;  3SXQ A;  2F6L A;  2YYL A;  3MXL A;  4JIO A;  3D6B A;  2CJ8 A;  2R0M A;  2R0N A;  4ZXV A;  3AFF A;  4JIZ A;  4AKH A;  5K3G A;  3X0Y A;  3VAD A;  2CJ7 A;  3TZ2 A;  4H81 A;  3D9G A;  4NXL A;  4AI6 A;  1Y0V A;  3OWM A;  4HKS A;  4FF3 A;  4IRN A;  1Y8N A;  3NF4 A;  4FF1 A;  4L3Y A;  2Q8G A;  4AKI A;  1GU6 A;  3BNJ A;  3TZ4 A;  3LG1 A;  2YYI A;  2DVL A;  4E02 A;  2CJ4 A;  1K93 A;  1EGD A;  4L38 A;  4V25 A;  5BRK A;  4AKG A;  3MDE A;  2LFW A;  5BRM A;  2R03 A;  3FO3 A;  4E01 A;  2BTZ A;  2BU6 A;  2Q8F A;  3TZ0 A;  4QIC A;  2E81 A;  1JQI A;  1RP3 A;  1S26 A;  4Q1O A;  4Q17 A;  4WJY A;  1OAH A;  1FS9 A;  3OIB A;  1T9G A;  2J7A A;  3SWO A;  3R7K A;  3Q24 A;  4Q0T A;  1GKX A; 
#chains in the Genus database with same CATH homology
 1X8Z A;  2CJ4 A;  2CJ6 A;  2XQR B;  1X91 A;  2CJ8 A;  1RJ1 A;  1XG2 B;  2CJ7 A;  1X90 A;  1RJ4 A;  2CJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...