2OR0A

Structural genomics, the crystal structure of a putative hydroxylase from rhodococcus sp. rha1
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
390
structure length
385
Chain Sequence
GRVLDRIEVVAEEIRGQAVQSEADCRLTDAAAGLLRDSGAIRLLQPRLYGGYEVHPREFAETVMGVAALDGASGWVTGIVGVHPWELAFADPQVQEEIWGEDNDTWMASPYAPMGVATPVDGGYVLKGRWSFSSGTDHCQWAFLGAMVGDATPSSLHVILPRTDYQIVEDTWDVIGLRGTGSKDLIVDGAFVPGYRTLNAAKVMDGRAQKEAGRPEPLFNMPYSCMFPLGITAAVIGITEGALACHIAVQKDRVAITGQKIKEDPYVLSAIGESAAEINASRVSLIETADRFYDKVDAGKEITFEERAIGRRTQIAAAWRAVRAADEIFARAGGGALHYKTPMQRFWRDAHAGLAHAVHVPGPTNHASALTQLGGEPQGMMRAMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Hydroxylase
publication title The crystal structure of a putative hydroxylase from Rhodococcus sp. RHA1
rcsb
source organism Rhodococcus sp.
total genus 142
structure length 385
sequence length 390
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08028 Acyl-CoA_dh_2 Acyl-CoA dehydrogenase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.540.10 Mainly Alpha Orthogonal Bundle Butyryl-Coa Dehydrogenase, subunit A; domain 1 Acyl-CoA dehydrogenase/oxidase, N-terminal domain 2or0A01
1.20.140.10 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 Butyryl-CoA Dehydrogenase, subunit A, domain 3 2or0A03
2.40.110.10 Mainly Beta Beta Barrel Butyryl-CoA Dehydrogenase, subunit A; domain 2 Butyryl-CoA Dehydrogenase, subunit A, domain 2 2or0A02
2R0NA 2YYJA 4Q0TA 4HR3A 2C12A 3SCEA 3MDEA 2RFQA 3LG1A 2REHA 3BNJA 3TORA 1EGDA 2YYGA 3SWOA 3UU9A 4X28A 2OT4A 2WBIA 3F29A 3D9DA 5K3HA 2JIFA 3SXQA 1T9GA 3OWAA 4W9UA 4L38A 2J7AA 2YYLA 3MXLA 2CX9A 1SIQA 2DVLA 2IX6A 1QDBA 3GNCA 3AFEA 4Q17A 1W07A 1RX0A 1UDYA 4DOYA 1FS9A 3GM6A 3PFDA 3AFFA 3HWCA 3P4TA 2E80A 2RDZA 2E81A 4L3ZA 3OIBA 3D9EA 4RM7A 2IX5A 1EGEA 2R0MA 4P13A 2JBRA 4IV6A 5K3IA 2RF7A 4M9AA 3BNFA 2A1TA 3D9FA 1UKWA 2VIGA 2PG0A 2YYIA 2JBTA 4KCFA 4XVXA 1SIRA 3EONA 2ZAFA 3BNHA 1JQIA 4L1FA 4L3XA 3MKHA 3II9A 4Q5CA 1WS9A 4IRNA 3GQTA 3UBRA 4ZXVA 3D6BA 2C0UA 3OWMA 3TTBA 3R7KA 1BUCA 3B96A 3MPIA 4WJYA 4O5MA 5K3JA 5K3GA 4OO2A 2JBSA 4JEKA 2FONA 2EBAA 1R2JA 3NF4A 3EOMA 3X0YA 3S7WA 3SF6A 3BNGA 3MMOA 4Q4UA 2DDHA 3MDDA 4X28C 1FS8A 4G5EA 1IVHA 2D29A 3L1TA 2YYMA 3FO3A 4L3YA 3FCJA 3D1IA 2UXWA 3MPJA 1EGCA 4ZYJA 4NXLA 1GU6A 3M9VA 4Q5BA 4Q1OA 1FS7A 2YYKA 2Z1QA 2ZO5A 1U8VA 4U83A 3RKHA 3D9GA 1OAHA 3X0XA 2VR0A 4KTOA 1IS2A 3LGQA 2OR0A 4N5FA
chains in the Genus database with same CATH superfamily
4AKHA 2R0NA 4FF3A 2BU7A 1XFXA 2YYJA 4Q0TA 4E01A 3C3LA 4P79A 2OEXA 4HR3A 2C12A 3TZ4A 3U33A 1K93A 2ZDYA 2CJ4A 3CRKA 3SCEA 4JIZA 4F0XA 3VKGA 3DJLA 2XQRB 3MDEA 2RFQA 3LG1A 2BU6A 2CJ6A 2REHA 4MPEA 3BNJA 4KS9A 1GKZA 3TORA 1EGDA 2YYGA 3C46A 3SWOA 3CE2A 3KMLA 4G97A 4X28A 3UU9A 1XG2B 1X90A 2OT4A 2WBIA 4HKSA 3F29A 3D9DA 5K3HA 2R05A 1Y8PA 4H85A 1PK0A 2JIFA 3SXQA 1T9GA 3OWAA 4W9UA 4L38A 2EBFX 1R3BA 1JM6A 2J7AA 2YYLA 2Q8IA 3CRLA 3MXLA 3Q0AA 2CX9A 1Y8OA 1SIQA 2DVLA 4FF4A 2IX6A 1QDBA 3GNCA 2CJ8A 4H7QA 2EC5A 2AO2A 3AFEA 1RJ4A 4Q17A 1W07A 1RX0A 1UDYA 4DOYA 1FS9A 2PO4A 3GM6A 3PFDA 5M4MA 3AFFA 2E0AA 3HWCA 3N0RA 3P4TA 2E80A 2RDZA 1SK6A 2E81A 4LQSB 1S26A 4L3ZA 2LFWA 3OIBA 2QR4A 3D9EA 4RM7A 2IX5A 1LVCA 4MP2A 1EGEA 3X29A 2VF1A 2R0MA 1PI1A 4P13A 2JBRA 4IV6A 5K3IA 2RF7A 4M9AA 3BNFA 2R02A 4FF1A 2A1TA 3D9FA 1UKWA 2VIGA 1K90A 2PG0A 2YYIA 3TZ2A 2JBTA 2BU5A 3C2PA 4KCFA 4XVXA 2HJNA 5B5VA 1SIRA 3EONA 2ZAFA 3BNHA 1JQIA 4L1FA 1XFUA 4L3XA 2Q8FA 3MKHA 1SC5A 4MPNA 3II9A 2Q8GA 5BRKA 2CJ5A 4AI6A 4Q5CA 2BU2A 4E00A 4MP7A 1WS9A 1K8TA 4IRNA 1XFWA 3GQTA 3UBRA 1Y8NA 4ZXVA 5BRMA 4E02A 3D6BA 2C0UA 3OWMA 4J1VA 3TTBA 3R7KA 3Q24A 1BUCA 3B96A 3MPIA 2BTZA 4WJYA 4AKGA 4O5MA 5K3JA 5K3GA 3D2RA 4KSAA 2JBSA 4OO2A 4V25A 2FP1A 1RP3A 4JEKA 1GKXA 2FONA 5GJWE 3Q22A 2EBAA 1GJVA 3VKHA 1R2JA 5GJVE 3NF4A 2R03A 3EOMA 3X0YA 4MPCA 2ZKJA 3S7WA 5M4NA 3VADA 3SF6A 4JIOA 3TZ0A 4AKIA 4KSFA 3BNGA 4V26A 2OJQA 3MMOA 2F6LA 2DDHA 3MDDA 4X28C 4Q4UA 5B6BA 5M4PA 1FS8A 4G5EA 1XFYA 1IVHA 2D29A 3L1TA 2YYMA 1Y0VA 3FO3A 4FF2A 4FZ4A 4L3YA 3FCJA 2OEVA 2FP2A 5J71A 3D1IA 1RJ1A 2UXWA 3MPJA 1EGCA 2PNRA 2EBHX 2ZDXA 4ZYJA 4H81A 2Q8HA 1XFVA 4NXLA 1GU6A 1X91A 1XFZA 3M9VA 4QICA 5EZ3A 1X8ZA 2BU8A 4Q5BA 4Q1OA 2XS8A 4DZYA 1FS7A 2AZEA 5B5WA 3Q23A 2YYKA 2Z1QA 2ZO5A 5J6AA 2XS1A 1U8VA 4U83A 2CJ7A 4LQQB 4HKRA 3RKHA 3D9GA 1OAHA 3X0XA 5M4KA 2GBBA 4KTOA 2VR0A 1IS2A 2YGWA 3TZ5A 3LGQA 2OR0A 4N5FA
chains in the Genus database with same CATH topology
2R0NA 2YYJA 4Q0TA 4HR3A 2C12A 3SCEA 3MDEA 2RFQA 3LG1A 2REHA 3BNJA 3TORA 1EGDA 2YYGA 3SWOA 3UU9A 4X28A 2OT4A 2WBIA 3F29A 3D9DA 5K3HA 2JIFA 3SXQA 1T9GA 3OWAA 4W9UA 4L38A 2J7AA 2YYLA 3MXLA 2CX9A 1SIQA 2DVLA 2IX6A 1QDBA 3GNCA 3AFEA 4Q17A 1W07A 1RX0A 1UDYA 4DOYA 1FS9A 3GM6A 3PFDA 3AFFA 3HWCA 3P4TA 2E80A 2RDZA 2E81A 4L3ZA 3OIBA 3D9EA 4RM7A 2IX5A 1EGEA 2R0MA 4P13A 2JBRA 4IV6A 5K3IA 2RF7A 4M9AA 3BNFA 2A1TA 3D9FA 1UKWA 2VIGA 2PG0A 2YYIA 2JBTA 4KCFA 4XVXA 1SIRA 3EONA 2ZAFA 3BNHA 1JQIA 4L1FA 4L3XA 3MKHA 3II9A 4Q5CA 1WS9A 4IRNA 3GQTA 3UBRA 4ZXVA 3D6BA 2C0UA 3OWMA 3TTBA 3R7KA 1BUCA 3B96A 3MPIA 4WJYA 4O5MA 5K3JA 5K3GA 4OO2A 2JBSA 4JEKA 2FONA 2EBAA 1R2JA 3NF4A 3EOMA 3X0YA 3S7WA 3SF6A 3BNGA 3MMOA 4Q4UA 2DDHA 3MDDA 4X28C 1FS8A 4G5EA 1IVHA 2D29A 3L1TA 2YYMA 3FO3A 4L3YA 3FCJA 3D1IA 2UXWA 3MPJA 1EGCA 4ZYJA 4NXLA 1GU6A 3M9VA 4Q5BA 4Q1OA 1FS7A 2YYKA 2Z1QA 2ZO5A 1U8VA 4U83A 3RKHA 3D9GA 1OAHA 3X0XA 2VR0A 4KTOA 1IS2A 3LGQA 2OR0A 4N5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R0N A;  2YYJ A;  4Q0T A;  4HR3 A;  2C12 A;  3SCE A;  3MDE A;  2RFQ A;  3LG1 A;  2REH A;  3BNJ A;  3TOR A;  1EGD A;  2YYG A;  3SWO A;  3UU9 A;  4X28 A;  2OT4 A;  2WBI A;  3F29 A;  3D9D A;  5K3H A;  2JIF A;  3SXQ A;  1T9G A;  3OWA A;  4W9U A;  4L38 A;  2J7A A;  2YYL A;  3MXL A;  2CX9 A;  1SIQ A;  2DVL A;  2IX6 A;  1QDB A;  3GNC A;  3AFE A;  4Q17 A;  1W07 A;  1RX0 A;  1UDY A;  4DOY A;  1FS9 A;  3GM6 A;  3PFD A;  3AFF A;  3HWC A;  3P4T A;  2E80 A;  2RDZ A;  2E81 A;  4L3Z A;  3OIB A;  3D9E A;  4RM7 A;  2IX5 A;  1EGE A;  2R0M A;  4P13 A;  2JBR A;  4IV6 A;  5K3I A;  2RF7 A;  4M9A A;  3BNF A;  2A1T A;  3D9F A;  1UKW A;  2VIG A;  2PG0 A;  2YYI A;  2JBT A;  4KCF A;  4XVX A;  1SIR A;  3EON A;  2ZAF A;  3BNH A;  1JQI A;  4L1F A;  4L3X A;  3MKH A;  3II9 A;  4Q5C A;  1WS9 A;  4IRN A;  3GQT A;  3UBR A;  4ZXV A;  3D6B A;  2C0U A;  3OWM A;  3TTB A;  3R7K A;  1BUC A;  3B96 A;  3MPI A;  4WJY A;  4O5M A;  5K3J A;  5K3G A;  4OO2 A;  2JBS A;  4JEK A;  2FON A;  2EBA A;  1R2J A;  3NF4 A;  3EOM A;  3X0Y A;  3S7W A;  3SF6 A;  3BNG A;  3MMO A;  4Q4U A;  2DDH A;  3MDD A;  4X28 C;  1FS8 A;  4G5E A;  1IVH A;  2D29 A;  3L1T A;  2YYM A;  3FO3 A;  4L3Y A;  3FCJ A;  3D1I A;  2UXW A;  3MPJ A;  1EGC A;  4ZYJ A;  4NXL A;  1GU6 A;  3M9V A;  4Q5B A;  4Q1O A;  1FS7 A;  2YYK A;  2Z1Q A;  2ZO5 A;  1U8V A;  4U83 A;  3RKH A;  3D9G A;  1OAH A;  3X0X A;  2VR0 A;  4KTO A;  1IS2 A;  3LGQ A;  2OR0 A;  4N5F A; 
#chains in the Genus database with same CATH topology
 4AKH A;  2R0N A;  4FF3 A;  2BU7 A;  1XFX A;  2YYJ A;  4Q0T A;  4E01 A;  3C3L A;  4P79 A;  2OEX A;  4HR3 A;  2C12 A;  3TZ4 A;  3U33 A;  1K93 A;  2ZDY A;  2CJ4 A;  3CRK A;  3SCE A;  4JIZ A;  4F0X A;  3VKG A;  3DJL A;  2XQR B;  3MDE A;  2RFQ A;  3LG1 A;  2BU6 A;  2CJ6 A;  2REH A;  4MPE A;  3BNJ A;  4KS9 A;  1GKZ A;  3TOR A;  1EGD A;  2YYG A;  3C46 A;  3SWO A;  3CE2 A;  3KML A;  4G97 A;  4X28 A;  3UU9 A;  1XG2 B;  1X90 A;  2OT4 A;  2WBI A;  4HKS A;  3F29 A;  3D9D A;  5K3H A;  2R05 A;  1Y8P A;  4H85 A;  1PK0 A;  2JIF A;  3SXQ A;  1T9G A;  3OWA A;  4W9U A;  4L38 A;  2EBF X;  1R3B A;  1JM6 A;  2J7A A;  2YYL A;  2Q8I A;  3CRL A;  3MXL A;  3Q0A A;  2CX9 A;  1Y8O A;  1SIQ A;  2DVL A;  4FF4 A;  2IX6 A;  1QDB A;  3GNC A;  2CJ8 A;  4H7Q A;  2EC5 A;  2AO2 A;  3AFE A;  1RJ4 A;  4Q17 A;  1W07 A;  1RX0 A;  1UDY A;  4DOY A;  1FS9 A;  2PO4 A;  3GM6 A;  3PFD A;  5M4M A;  3AFF A;  2E0A A;  3HWC A;  3N0R A;  3P4T A;  2E80 A;  2RDZ A;  1SK6 A;  2E81 A;  4LQS B;  1S26 A;  4L3Z A;  2LFW A;  3OIB A;  2QR4 A;  3D9E A;  4RM7 A;  2IX5 A;  1LVC A;  4MP2 A;  1EGE A;  3X29 A;  2VF1 A;  2R0M A;  1PI1 A;  4P13 A;  2JBR A;  4IV6 A;  5K3I A;  2RF7 A;  4M9A A;  3BNF A;  2R02 A;  4FF1 A;  2A1T A;  3D9F A;  1UKW A;  2VIG A;  1K90 A;  2PG0 A;  2YYI A;  3TZ2 A;  2JBT A;  2BU5 A;  3C2P A;  4KCF A;  4XVX A;  2HJN A;  5B5V A;  1SIR A;  3EON A;  2ZAF A;  3BNH A;  1JQI A;  4L1F A;  1XFU A;  4L3X A;  2Q8F A;  3MKH A;  1SC5 A;  4MPN A;  3II9 A;  2Q8G A;  5BRK A;  2CJ5 A;  4AI6 A;  4Q5C A;  2BU2 A;  4E00 A;  4MP7 A;  1WS9 A;  1K8T A;  4IRN A;  1XFW A;  3GQT A;  3UBR A;  1Y8N A;  4ZXV A;  5BRM A;  4E02 A;  3D6B A;  2C0U A;  3OWM A;  4J1V A;  3TTB A;  3R7K A;  3Q24 A;  1BUC A;  3B96 A;  3MPI A;  2BTZ A;  4WJY A;  4AKG A;  4O5M A;  5K3J A;  5K3G A;  3D2R A;  4KSA A;  2JBS A;  4OO2 A;  4V25 A;  2FP1 A;  1RP3 A;  4JEK A;  1GKX A;  2FON A;  5GJW E;  3Q22 A;  2EBA A;  1GJV A;  3VKH A;  1R2J A;  5GJV E;  3NF4 A;  2R03 A;  3EOM A;  3X0Y A;  4MPC A;  2ZKJ A;  3S7W A;  5M4N A;  3VAD A;  3SF6 A;  4JIO A;  3TZ0 A;  4AKI A;  4KSF A;  3BNG A;  4V26 A;  2OJQ A;  3MMO A;  2F6L A;  2DDH A;  3MDD A;  4X28 C;  4Q4U A;  5B6B A;  5M4P A;  1FS8 A;  4G5E A;  1XFY A;  1IVH A;  2D29 A;  3L1T A;  2YYM A;  1Y0V A;  3FO3 A;  4FF2 A;  4FZ4 A;  4L3Y A;  3FCJ A;  2OEV A;  2FP2 A;  5J71 A;  3D1I A;  1RJ1 A;  2UXW A;  3MPJ A;  1EGC A;  2PNR A;  2EBH X;  2ZDX A;  4ZYJ A;  4H81 A;  2Q8H A;  1XFV A;  4NXL A;  1GU6 A;  1X91 A;  1XFZ A;  3M9V A;  4QIC A;  5EZ3 A;  1X8Z A;  2BU8 A;  4Q5B A;  4Q1O A;  2XS8 A;  4DZY A;  1FS7 A;  2AZE A;  5B5W A;  3Q23 A;  2YYK A;  2Z1Q A;  2ZO5 A;  5J6A A;  2XS1 A;  1U8V A;  4U83 A;  2CJ7 A;  4LQQ B;  4HKR A;  3RKH A;  3D9G A;  1OAH A;  3X0X A;  5M4K A;  2GBB A;  4KTO A;  2VR0 A;  1IS2 A;  2YGW A;  3TZ5 A;  3LGQ A;  2OR0 A;  4N5F A; 
#chains in the Genus database with same CATH homology
 2R0N A;  2YYJ A;  4Q0T A;  4HR3 A;  2C12 A;  3SCE A;  3MDE A;  2RFQ A;  3LG1 A;  2REH A;  3BNJ A;  3TOR A;  1EGD A;  2YYG A;  3SWO A;  3UU9 A;  4X28 A;  2OT4 A;  2WBI A;  3F29 A;  3D9D A;  5K3H A;  2JIF A;  3SXQ A;  1T9G A;  3OWA A;  4W9U A;  4L38 A;  2J7A A;  2YYL A;  3MXL A;  2CX9 A;  1SIQ A;  2DVL A;  2IX6 A;  1QDB A;  3GNC A;  3AFE A;  4Q17 A;  1W07 A;  1RX0 A;  1UDY A;  4DOY A;  1FS9 A;  3GM6 A;  3PFD A;  3AFF A;  3HWC A;  3P4T A;  2E80 A;  2RDZ A;  2E81 A;  4L3Z A;  3OIB A;  3D9E A;  4RM7 A;  2IX5 A;  1EGE A;  2R0M A;  4P13 A;  2JBR A;  4IV6 A;  5K3I A;  2RF7 A;  4M9A A;  3BNF A;  2A1T A;  3D9F A;  1UKW A;  2VIG A;  2PG0 A;  2YYI A;  2JBT A;  4KCF A;  4XVX A;  1SIR A;  3EON A;  2ZAF A;  3BNH A;  1JQI A;  4L1F A;  4L3X A;  3MKH A;  3II9 A;  4Q5C A;  1WS9 A;  4IRN A;  3GQT A;  3UBR A;  4ZXV A;  3D6B A;  2C0U A;  3OWM A;  3TTB A;  3R7K A;  1BUC A;  3B96 A;  3MPI A;  4WJY A;  4O5M A;  5K3J A;  5K3G A;  4OO2 A;  2JBS A;  4JEK A;  2FON A;  2EBA A;  1R2J A;  3NF4 A;  3EOM A;  3X0Y A;  3S7W A;  3SF6 A;  3BNG A;  3MMO A;  4Q4U A;  2DDH A;  3MDD A;  4X28 C;  1FS8 A;  4G5E A;  1IVH A;  2D29 A;  3L1T A;  2YYM A;  3FO3 A;  4L3Y A;  3FCJ A;  3D1I A;  2UXW A;  3MPJ A;  1EGC A;  4ZYJ A;  4NXL A;  1GU6 A;  3M9V A;  4Q5B A;  4Q1O A;  1FS7 A;  2YYK A;  2Z1Q A;  2ZO5 A;  1U8V A;  4U83 A;  3RKH A;  3D9G A;  1OAH A;  3X0X A;  2VR0 A;  4KTO A;  1IS2 A;  3LGQ A;  2OR0 A;  4N5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...