The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
147
|
structure length |
144
|
Chain Sequence |
NNLVETTCKNTPNYQLCLKTLLSDKRSATGDITTLALIMVDAIKAKANQAAVTISKLRHSNPPAAWKGPLKNCAFSYKVILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQECEEYFKSPFSALNIAVHELSDVGRAIVRNLL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Multiple Crystal Forms of the Cell-Wall Invertase Inhibitor from Tobacco Support High Conformational Rigidity Over a Broad Ph-Range
pubmed doi rcsb |
molecule tags |
Inhibitor
|
source organism |
Nicotiana tabacum
|
molecule keywords |
INVERTASE INHIBITOR
|
total genus |
65
|
structure length |
144
|
sequence length |
147
|
ec nomenclature | |
pdb deposition date | 2006-03-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04043 | PMEI | Plant invertase/pectin methylesterase inhibitor |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Butyryl-CoA Dehydrogenase, subunit A; domain 3 | Invertase/pectin methylesterase inhibitor family protein |
#chains in the Genus database with same CATH superfamily 1X91 A; 2CJ5 A; 2CJ8 A; 2XQR B; 2CJ6 A; 2CJ4 A; 2CJ7 A; 1XG2 B; 1RJ1 A; 1X8Z A; 1X90 A; 1RJ4 A; #chains in the Genus database with same CATH topology 1S26 A; 2UXW A; 4MPN A; 2VF1 A; 3BNG A; 2YYJ A; 2BU5 A; 2YGW A; 2FON A; 2EC5 A; 3AFF A; 4X28 C; 2IX5 A; 1K93 A; 3GQT A; 3R7K A; 2C12 A; 2QR4 A; 2YYI A; 4N5F A; 4MP2 A; 1PK0 A; 3SCE A; 1X90 A; 3LG1 A; 4IV6 A; 4H7Q A; 2JBT A; 4KSF A; 4X28 A; 3SXQ A; 1GKX A; 3II9 A; 1IVH A; 4JIO A; 2FP2 A; 3F29 A; 1FS7 A; 2DVL A; 5K3I A; 1R2J A; 4MPC A; 4Q17 A; 3PFD A; 4NXL A; 3EON A; 3TZ4 A; 4DOY A; 4Q4U A; 2CJ4 A; 4KTO A; 4G5E A; 1PI1 A; 2VR0 A; 1K90 A; 3OWA A; 2BU2 A; 2RDZ A; 4O5M A; 3OWM A; 3MDE A; 3Q22 A; 1SIR A; 4ZXV A; 1BUC A; 2BU6 A; 4L3Z A; 3CRK A; 1SIQ A; 1XFU A; 2BU8 A; 2CJ7 A; 3D9F A; 4Q0T A; 1WS9 A; 4E00 A; 2Q8H A; 2LFW A; 1X8Z A; 1Y8O A; 2HJN A; 2OEV A; 3L1T A; 3Q0A A; 3C3L A; 4FF2 A; 4DZY A; 2OT4 A; 1W07 A; 4OO2 A; 3LGQ A; 1OAH A; 4KSA A; 2BU7 A; 2R0N A; 4M9A A; 4E01 A; 4FF1 A; 4MPE A; 4L38 A; 2YYG A; 2CJ5 A; 1RX0 A; 2JBS A; 2IX6 A; 2EBF X; 2OR0 A; 1SC5 A; 3MPJ A; 1FS9 A; 1UDY A; 4LQQ B; 2OEX A; 1GJV A; 2ZDY A; 3S7W A; 5M4M A; 1QDB A; 3BNH A; 1R3B A; 5M4N A; 1Y0V A; 2AO2 A; 5GJW E; 3MPI A; 1GKZ A; 2CJ6 A; 2REH A; 3FCJ A; 4HR3 A; 1SK6 A; 2ZO5 A; 3VKG A; 2XS1 A; 3MMO A; 1EGC A; 2C0U A; 3MKH A; 3GM6 A; 3X29 A; 1IS2 A; 1RP3 A; 2VIG A; 5BRM A; 3X0X A; 5BRK A; 3P4T A; 5M4P A; 3Q24 A; 2EBA A; 3D6B A; 2RFQ A; 2J7A A; 4Q5C A; 5J71 A; 2R0M A; 3GNC A; 4MP7 A; 3D9E A; 3VKH A; 1Y8P A; 1JQI A; 4RM7 A; 2DDH A; 2E81 A; 3TOR A; 2F6L A; 1XFV A; 3CRL A; 1XFW A; 3MXL A; 2PO4 A; 2PG0 A; 4JIZ A; 4JEK A; 4XVX A; 5J6A A; 1JM6 A; 4L3X A; 4WJY A; 2R05 A; 2YYM A; 4FF4 A; 2XS8 A; 3OIB A; 1XFX A; 3TZ2 A; 5B6B A; 2R03 A; 3BNJ A; 3UU9 A; 3C2P A; 4E02 A; 2YYK A; 4HKS A; 4KS9 A; 3SF6 A; 3N0R A; 2CJ8 A; 4FZ4 A; 4V25 A; 2Q8F A; 4H81 A; 5M4K A; 2ZKJ A; 5K3G A; 4P79 A; 3X0Y A; 4Q5B A; 4V26 A; 4QIC A; 1XFZ A; 4J1V A; 4AKH A; 2D29 A; 2YYL A; 1FS8 A; 2ZDX A; 2CX9 A; 2RF7 A; 3D9D A; 3TZ0 A; 4LQS B; 4L1F A; 2WBI A; 2A1T A; 3M9V A; 1UKW A; 1EGD A; 3RKH A; 1U8V A; 3BNF A; 1LVC A; 3AFE A; 2AZE A; 1RJ1 A; 4U83 A; 3D9G A; 2Z1Q A; 2FP1 A; 3TTB A; 1K8T A; 3CE2 A; 2PNR A; 5K3J A; 3Q23 A; 4L3Y A; 1RJ4 A; 4ZYJ A; 4F0X A; 3C46 A; 1GU6 A; 1X91 A; 3TZ5 A; 4P13 A; 3UBR A; 5K3H A; 2ZAF A; 2Q8G A; 4G97 A; 2E80 A; 2JIF A; 3B96 A; 3KML A; 5B5V A; 1Y8N A; 3FO3 A; 5GJV E; 4AKI A; 1XFY A; 2XQR B; 2EBH X; 5B5W A; 4HKR A; 3VAD A; 2JBR A; 1EGE A; 1T9G A; 3MDD A; 2E0A A; 4KCF A; 4AI6 A; 3NF4 A; 3D1I A; 2R02 A; 4Q1O A; 3EOM A; 2BTZ A; 2OJQ A; 3HWC A; 4H85 A; 1XG2 B; 3SWO A; 4W9U A; 2GBB A; 3D2R A; 4AKG A; 2Q8I A; 4FF3 A; 4IRN A; #chains in the Genus database with same CATH homology 1X91 A; 2CJ5 A; 2CJ8 A; 2XQR B; 2CJ6 A; 2CJ4 A; 2CJ7 A; 1XG2 B; 1RJ1 A; 1X8Z A; 1X90 A; 1RJ4 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...