5BRKA

Pmob1-lats1 complex
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
203
structure length
192
Chain Sequence
SKFKPKKNIPEELLKHAEALGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in Hippo signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/signaling protein
molecule keywords MOB kinase activator 1A
total genus 53
structure length 192
sequence length 203
ec nomenclature
pdb deposition date 2015-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5brkA00
5BRKA 5B6BA 5B5WA 1PI1A 4JIZA 4J1VA 4LQQB 1R3BA 5BRMA 2HJNA 4LQSB 5B5VA
chains in the Genus database with same CATH superfamily
4NXLA 2XS1A 3MMOA 3LGQA 1SIQA 3MKHA 1PI1A 4Q17A 2BU5A 4OO2A 1W07A 3P4TA 4P13A 1SK6A 2R05A 1T9GA 2VF1A 2REHA 3CE2A 4KCFA 2BU2A 1XFYA 4Q0TA 4XVXA 2R0MA 3VKHA 1XFUA 3TZ4A 1LVCA 2OR0A 4AKIA 2CJ5A 2YYMA 4H7QA 4Q1OA 3D2RA 3TZ2A 2FP1A 2IX5A 3D9EA 3OWMA 2CX9A 4Q5CA 3B96A 4E00A 4JEKA 3BNGA 1BUCA 4MPNA 4Q4UA 2CJ7A 3GM6A 2J7AA 3TZ5A 1XFXA 5M4PA 3C2PA 2EBAA 1OAHA 1UDYA 3SXQA 1GU6A 1SC5A 1EGEA 2JBTA 3MDEA 3L1TA 5B6BA 2YYJA 4IV6A 5J6AA 3F29A 5GJWE 1JQIA 2ZO5A 4DOYA 3Q0AA 2BTZA 3HWCA 1XFZA 5J71A 3EOMA 2E0AA 3FO3A 4KSAA 2E81A 1R2JA 2YGWA 3X0XA 4AKGA 3D9FA 4Q5BA 5GJVE 4LQQB 3OWAA 4IRNA 1K90A 1X90A 4E01A 3C3LA 2C0UA 3VKGA 2Q8HA 1U8VA 4MP2A 4HKSA 5M4KA 2VIGA 2DDHA 5M4NA 4HKRA 2UXWA 2ZDYA 3CRLA 1GKXA 3Q24A 2WBIA 2ZDXA 4L38A 2XQRB 3KMLA 4FF4A 2VR0A 3GNCA 3UU9A 4RM7A 2FONA 4H81A 1XFVA 3FCJA 4U83A 3VADA 2HJNA 4L3XA 3D6BA 1K93A 1Y8PA 4WJYA 3S7WA 1RJ4A 2BU8A 1SIRA 1XFWA 2C12A 2RF7A 4FF3A 3RKHA 4DZYA 2JBSA 3SWOA 3SF6A 1R3BA 1PK0A 4LQSB 1WS9A 3Q23A 3TORA 2BU7A 1IS2A 1Y0VA 2LFWA 2R03A 2GBBA 2PO4A 3GQTA 5K3JA 3TZ0A 2D29A 1X91A 2OT4A 2RFQA 1XG2B 4J1VA 2YYIA 2XS8A 3X0YA 2A1TA 2YYKA 1FS9A 4HR3A 5B5VA 2ZKJA 4MP7A 5K3GA 4KS9A 2OJQA 1JM6A 4AI6A 4MPCA 3MPIA 3N0RA 2YYLA 2CJ6A 1S26A 4G5EA 3Q22A 5K3HA 3TTBA 4X28C 1IVHA 1RJ1A 3CRKA 4JIZA 3LG1A 1EGDA 3BNHA 2EC5A 4FZ4A 5BRMA 2JIFA 3OIBA 1X8ZA 4FF2A 2Z1QA 1QDBA 2RDZA 2ZAFA 3MDDA 3BNJA 3D1IA 4X28A 4AKHA 3C46A 2CJ4A 3M9VA 1EGCA 1Y8OA 1UKWA 1FS7A 2AZEA 4L1FA 2Q8IA 5BRKA 3AFFA 3AFEA 2Q8GA 1RX0A 2Q8FA 4L3ZA 2EBHX 4KTOA 4W9UA 3SCEA 2AO2A 2OEXA 4QICA 4JIOA 5B5WA 2PNRA 3R7KA 2F6LA 4ZYJA 4E02A 5M4MA 3PFDA 3MXLA 2EBFX 4M9AA 1Y8NA 4N5FA 1RP3A 4G97A 3NF4A 2R0NA 3II9A 1GKZA 3D9GA 1FS8A 3X29A 3BNFA 4F0XA 4H85A 1GJVA 1K8TA 2QR4A 4L3YA 4ZXVA 2FP2A 2BU6A 3EONA 5K3IA 3D9DA 3UBRA 2E80A 4MPEA 4V26A 2PG0A 2R02A 3MPJA 2OEVA 2YYGA 4FF1A 4O5MA 2CJ8A 2JBRA 2IX6A 4V25A 4KSFA 4P79A 2DVLA
chains in the Genus database with same CATH topology
5BRKA 5B6BA 5B5WA 1PI1A 4JIZA 4J1VA 4LQQB 1R3BA 5BRMA 2HJNA 4LQSB 5B5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BRK A;  5B6B A;  5B5W A;  1PI1 A;  4JIZ A;  4J1V A;  4LQQ B;  1R3B A;  5BRM A;  2HJN A;  4LQS B;  5B5V A; 
#chains in the Genus database with same CATH topology
 4NXL A;  2XS1 A;  3MMO A;  3LGQ A;  1SIQ A;  3MKH A;  1PI1 A;  4Q17 A;  2BU5 A;  4OO2 A;  1W07 A;  3P4T A;  4P13 A;  1SK6 A;  2R05 A;  1T9G A;  2VF1 A;  2REH A;  3CE2 A;  4KCF A;  2BU2 A;  1XFY A;  4Q0T A;  4XVX A;  2R0M A;  3VKH A;  1XFU A;  3TZ4 A;  1LVC A;  2OR0 A;  4AKI A;  2CJ5 A;  2YYM A;  4H7Q A;  4Q1O A;  3D2R A;  3TZ2 A;  2FP1 A;  2IX5 A;  3D9E A;  3OWM A;  2CX9 A;  4Q5C A;  3B96 A;  4E00 A;  4JEK A;  3BNG A;  1BUC A;  4MPN A;  4Q4U A;  2CJ7 A;  3GM6 A;  2J7A A;  3TZ5 A;  1XFX A;  5M4P A;  3C2P A;  2EBA A;  1OAH A;  1UDY A;  3SXQ A;  1GU6 A;  1SC5 A;  1EGE A;  2JBT A;  3MDE A;  3L1T A;  5B6B A;  2YYJ A;  4IV6 A;  5J6A A;  3F29 A;  5GJW E;  1JQI A;  2ZO5 A;  4DOY A;  3Q0A A;  2BTZ A;  3HWC A;  1XFZ A;  5J71 A;  3EOM A;  2E0A A;  3FO3 A;  4KSA A;  2E81 A;  1R2J A;  2YGW A;  3X0X A;  4AKG A;  3D9F A;  4Q5B A;  5GJV E;  4LQQ B;  3OWA A;  4IRN A;  1K90 A;  1X90 A;  4E01 A;  3C3L A;  2C0U A;  3VKG A;  2Q8H A;  1U8V A;  4MP2 A;  4HKS A;  5M4K A;  2VIG A;  2DDH A;  5M4N A;  4HKR A;  2UXW A;  2ZDY A;  3CRL A;  1GKX A;  3Q24 A;  2WBI A;  2ZDX A;  4L38 A;  2XQR B;  3KML A;  4FF4 A;  2VR0 A;  3GNC A;  3UU9 A;  4RM7 A;  2FON A;  4H81 A;  1XFV A;  3FCJ A;  4U83 A;  3VAD A;  2HJN A;  4L3X A;  3D6B A;  1K93 A;  1Y8P A;  4WJY A;  3S7W A;  1RJ4 A;  2BU8 A;  1SIR A;  1XFW A;  2C12 A;  2RF7 A;  4FF3 A;  3RKH A;  4DZY A;  2JBS A;  3SWO A;  3SF6 A;  1R3B A;  1PK0 A;  4LQS B;  1WS9 A;  3Q23 A;  3TOR A;  2BU7 A;  1IS2 A;  1Y0V A;  2LFW A;  2R03 A;  2GBB A;  2PO4 A;  3GQT A;  5K3J A;  3TZ0 A;  2D29 A;  1X91 A;  2OT4 A;  2RFQ A;  1XG2 B;  4J1V A;  2YYI A;  2XS8 A;  3X0Y A;  2A1T A;  2YYK A;  1FS9 A;  4HR3 A;  5B5V A;  2ZKJ A;  4MP7 A;  5K3G A;  4KS9 A;  2OJQ A;  1JM6 A;  4AI6 A;  4MPC A;  3MPI A;  3N0R A;  2YYL A;  2CJ6 A;  1S26 A;  4G5E A;  3Q22 A;  5K3H A;  3TTB A;  4X28 C;  1IVH A;  1RJ1 A;  3CRK A;  4JIZ A;  3LG1 A;  1EGD A;  3BNH A;  2EC5 A;  4FZ4 A;  5BRM A;  2JIF A;  3OIB A;  1X8Z A;  4FF2 A;  2Z1Q A;  1QDB A;  2RDZ A;  2ZAF A;  3MDD A;  3BNJ A;  3D1I A;  4X28 A;  4AKH A;  3C46 A;  2CJ4 A;  3M9V A;  1EGC A;  1Y8O A;  1UKW A;  1FS7 A;  2AZE A;  4L1F A;  2Q8I A;  5BRK A;  3AFF A;  3AFE A;  2Q8G A;  1RX0 A;  2Q8F A;  4L3Z A;  2EBH X;  4KTO A;  4W9U A;  3SCE A;  2AO2 A;  2OEX A;  4QIC A;  4JIO A;  5B5W A;  2PNR A;  3R7K A;  2F6L A;  4ZYJ A;  4E02 A;  5M4M A;  3PFD A;  3MXL A;  2EBF X;  4M9A A;  1Y8N A;  4N5F A;  1RP3 A;  4G97 A;  3NF4 A;  2R0N A;  3II9 A;  1GKZ A;  3D9G A;  1FS8 A;  3X29 A;  3BNF A;  4F0X A;  4H85 A;  1GJV A;  1K8T A;  2QR4 A;  4L3Y A;  4ZXV A;  2FP2 A;  2BU6 A;  3EON A;  5K3I A;  3D9D A;  3UBR A;  2E80 A;  4MPE A;  4V26 A;  2PG0 A;  2R02 A;  3MPJ A;  2OEV A;  2YYG A;  4FF1 A;  4O5M A;  2CJ8 A;  2JBR A;  2IX6 A;  4V25 A;  4KSF A;  4P79 A;  2DVL A; 
#chains in the Genus database with same CATH homology
 5BRK A;  5B6B A;  5B5W A;  1PI1 A;  4JIZ A;  4J1V A;  4LQQ B;  1R3B A;  5BRM A;  2HJN A;  4LQS B;  5B5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...