1CVMA

Cadmium inhibited crystal structure of phytase from bacillus amyloliquefaciens
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
353
structure length
353
Chain Sequence
KLSDPYHFTVNAAAETEPVDTAGDAADDPAIWLDPKNPQNSKLITTNKKSGLAVYSLEGKMLHSYHTGKLNNVDIRYDFPLNGKKVDIAAASNRSEGKNTIEIYAIDGKNGTLQSITDPNRPIASAIDEVYGFSLYHSQKTGKYYAMVTGKEGEFEQYELNADKNGYISGKKVRAFKMNSQTEGMAADDEYGSLYIAEEDEAIWKFSAEPDGGSNGTVIDRADGRHLTPDIEGLTIYYAADGKGYLLASSQGNSSYAIYERQGQNKYVADFQITDGPETDGTSDTDGIDVLGFGLGPEYPFGLFVAQNGENIDHGQKANQNFKMVPWERIADKIGFHPQVNKQVDPRKMTDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PHYTASE
publication title Crystal structures of a novel, thermostable phytase in partially and fully calcium-loaded states.
pubmed doi rcsb
total genus 87
structure length 353
sequence length 353
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 1999-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 1cvmA00
3O4PA 3Q6PA 3Q6KA 3U0SA 3SRGA 2GHSA 1QLGA 2IAVA 2IAOA 4GN9A 3LI5A 5D9CA 4GNCA 3SOQA 4GNAA 5GX2A 3SOBB 5GX4A 4GNBA 2GVVA 3V65B 2FPBA 2IAXA 4JMLA 4O5SA 1Q7FA 3AMRA 2ISMA 5GX1A 2DG0A 3G4HA 3G4EA 2FP8A 2DSOA 3V1SA 2IATA 3TC9A 4PWZA 2GVXA 2G8SA 3DASA 1IJQA 3FW0A 4HHQA 3Q6TA 3BYCA 1H6LA 1V04A 3V64C 2FPCA 3LI4A 4Q1UA 3A9GA 2GVUA 1CRZA 3KGGA 1E1AA 2OJHA 1RWIA 2HQSA 5GX5A 3SREA 4DG6A 3HRPA 1N7DA 4O5TA 1C5KA 3WW9A 5EX7A 2V91A 3AMSA 4R40A 2POOA 2IAPA 4ZLRA 3FVZA 5FWWA 2VAQA 3S94A 4IMBA 1QBIA 4HW6A 3DR2A 1RWLA 1POOA 3E5ZA 4HHOA 2DG1A 2IVZA 2P4OA 2IAQA 5GTQA 2IARA 5D9DA 2W8BA 3S2KA 2QE8A 1PJXA 1CQ1A 3HLIA 3I1CA 2FP9A 1NPEA 3LI3A 1CRUA 1C9UA 2GVWA 5GX3A 1CVMA 3WWAA 2IASA 3IAXA 5D9BA 3KYAA 3A9HA 2IAWA 3SOVA 3S8ZA 3S8VA 4GN7A 4GN8A 3P5BL 2IAUA 2W8BB 3HLHA 4A0PA 4IYGA
chains in the Genus database with same CATH superfamily
2AH2A 3O9KA 4J9TA 4MC7A 4B7RA 2YDPA 1S1DA 3Q6KA 2RKCA 1NCDN 5FZJA 2Z32A 3TI6A 4QN4A 1IVFA 2F29A 4YW4A 4MWVA 3H72A 3LI5A 3L6VA 4YW2A 3UC1A 5GX2A 5HUNA 1NNAA 4GNBA 4XILA 4KS1A 2GVVA 3V65B 2FPBA 4M4VA 2VSKA 2WOZA 1NNCA 1E8TA 4GZPA 2B8HA 4YZ2A 3A72A 2H2NA 2IATA 4L7CA 4QNPA 3K3AA 1IJQA 5NN9A 4HHQA 4XJAA 2HTVA 2F24A 5HUKA 4KS5A 4YY8A 2SILA 2QWKA 3K38A 2VW1A 1MR5A 4Q1UA 4M4NA 4CPYA 2HTUA 3TI5A 1S0JA 2OJHA 2HQSA 1Z4XA 1NNBA 3JU4A 4Q6KA 3H73A 1N6DA 1W8NA 2BZDA 1N7DA 1X2JA 4GZSA 1C5KA 4HZYA 3WW9A 1NN2A 1VCUA 2IAPA 3S94A 1NSDA 3TI8A 4GZQA 4CPNA 3SILA 2VWDA 1N1TA 2IVZA 1USRA 4FPLA 1F8CA 5D9DA 2CMLA 4AGIA 7NN9A 2W8BA 4SLIA 1ZGKA 2QE8A 3INBA 3CL2A 1CQ1A 3TI3A 4FQ4A 3HLIA 4FPKA 3NO0A 4K3YA 1OFZA 2QWAA 4M3MA 3WWAA 5EO7A 1W21A 2BF6A 4FOVA 3IAXA 1MS9A 2YDTA 3KYAA 2A75A 3SOVA 1K32A 1MS4A 1MWEA 2VK7A 1Z50A 4GN7A 1MS5A 4CPMA 2IAUA 4KS2A 3HLHA 4X6KA 1B9TA 2YA4A 4GZOA 2C4LA 5FNUA 1MS1A 1MS3A 3O4PA 4FPYA 4XJ8A 4NCSA 1Z4ZA 1V3CA 4MWXA 1XOGA 1S18A 2QWIA 1QLGA 1V0EA 1Z4WA 3SOQA 2QWHA 4XJ9A 1N6FA 2HTWA 2IAXA 2ISMA 4GZWA 2DG0A 3G4HA 1WCQA 1MS0A 1SLIA 3G4EA 2DSOA 5JYYA 3V1SA 4WA3A 4G3NA 4WA5A 3TC9A 4PWZA 2HU4A 2ZB6A 1B9SA 4HZVA 3DASA 3FW0A 1V3EA 2VVZA 4H52A 1A14N 2QWFA 1NCAN 1V04A 3V64C 2HT5A 3II7A 3WDZA 1SLLA 4X49A 5EO8A 3A9GA 3KGGA 1E1AA 1RWIA 5GX5A 4K1KA 4H53A 4XJQA 1N6EA 4D4UA 4FVKA 4L7BA 5F72C 2F12A 4MWQA 5EX7A 5FZNA 2QWCA 4X4AA 4CPZA 1NMCA 3D11A 2SLIA 4QN6A 4ZLRA 4I00A 1NSCA 5FWWA 1DILA 4MWJA 4DGRA 1QBIA 2QWJA 1MZ5A 4IN4A 3DR2A 1NCBN 4B7JA 2IAQA 5GTQA 1F8DA 4XJRA 1MZ6A 4BBWA 1SUUA 4FZHA 4YZ4A 1IUCA 4CPLA 4FPEA 4QN5A 1NMAN 2FP9A 1S0IA 3TIAA 3T1EA 5GX3A 3OPZA 4IQKA 4AHAA 1V2IA 2XN4A 2IAWA 3D12A 4MZAA 2ZZKA 1IUBA 3P5BL 6NN9A 2QWBA 2QWDA 4FP2A 1L7FA 4MWRA 5FNSA 4FP3A 4XMBA 2F10A 3Q6PA 2AGSA 2W38A 4YW1A 3SRGA 4L7DA 1DIMA 1IVGA 4YW5A 3K37A 4ZY3A 2IAVA 2IAOA 1F8EA 4K1HA 3K39A 1V0ZA 2QWGA 2XZJA 4FPCA 2YA6A 4GNAA 5GX4A 5HUGA 1IVDA 3TICA 4WEGA 4JMLA 4O5SA 2AEPA 1W1XA 3TIBA 1Q7FA 1EUUA 5GX1A 1INYA 4FPJA 2AEQA 4CSDA 4XMIA 1MS8A 5H47A 2FP8A 2HT7A 4B7MA 3ALWA 4K1JA 2GVXA 4IFLX 4MZEA 2G8SA 1V0FA 2XZKA 2YA5A 5FNTA 1L7GA 3Q6TA 3SALA 3BYCA 1W0PA 4UF7A 1H6LA 1N1SA 3LI4A 2FLUX 2GVUA 1N1YA 1CRZA 1EUTA 4NC5A 4GDIA 4FOWA 4D52B 3GVKA 4O5TA 4JF7A 4YZ3A 2V91A 3AMSA 4FPGA 1IVCA 3O9JA 4FOYA 4HZWA 1E8UA 2VAQA 1XOEA 4M4UA 1INGA 3NN9A 4ZGCA 4HW6A 1EUSA 1RWLA 1NCCN 2YA8A 2DG1A 4AH4A 5HX0A 4HZXA 4XIKA 4D52C 2ZB5A 4YZ1A 1USXA 3S2KA 3GVJA 1PJXA 2VSMA 3I1CA 1NPEA 3LI3A 1C9UA 2W5NA 1W0OA 4XJZA 2F28A 2GVWA 2VW2A 3SLIA 4CPOA 3CYEA 4GDJA 2HT8A 2X9MA 4AGTA 3ADEA 3K36A 5D9BA 4X47A 3PJQA 1X2RA 2F11A 4GZXA 3S8VA 2F25A 4FPFA 4UOUA 4GN8A 5B2DA 4HZZA 2HTYA 1BJIA 4C1YB 2W20A 4B7QA 2HTRA 2F13A 5HUMA 1INWA 4IYGA 4B7NA 4FPOB 5FNRA 3U0SA 2GHSA 4FOQA 4XHBA 4GJTA 4HIZA 2W5OA 1V3DA 3GVLA 4GN9A 2JKBA 4K1IA 5D9CA 4GNCA 3ALXA 3SOBB 3VNGA 3VNHA 1A4GA 4XHXA 4ASCA 2XZIA 2VK6A 3AMRA 4MWUA 4WA4A 3SANA 3H71A 4QN3A 1EURA 3A71A 4MWYA 2HTQA 4KS4A 4MWLA 1NMBN 1V3BA 1A4QA 4XOGA 2DYHA 4D52A 1WP5A 4IFNX 2SIMA 1Z4YA 1INVA 4YZ5A 4XYXA 2C4AA 1W20A 1F8BA 1SO7A 4CH9A 2VW0A 2FPCA 3H6JA 1WCSA 4N1BA 4GZTA 1W8OA 4KS3A 4XJWA 1U6DX 4NN9A 3SREA 4DG6A 4GB1A 3HRPA 1INXA 2XCYA 1IVEA 4GEZA 2VPJA 3NSSA 4IFJA 3ZGCA 4R40A 2H2UA 2POOA 5M1ZA 3FVZA 5B2CA 4IMBA 4MJVA 2YA7A 4MWWA 4YW3A 4FPHA 3ZGDA 2BERA 2ZWAA 3CKZA 2FHRA 5CGJA 1E8VA 2F27A 1POOA 3BEQA 3E5ZA 4HHOA 4XIOA 2BATA 1INHA 1INFA 2P4OA 1KITA 3TI4A 2IARA 1IVBA 1ZI0A 2QWEA 3B7EA 4D8SA 4WEFA 1VCJA 4XJUA 4CHBA 1B9VA 4XMAA 4C1YA 2VK5A 4FJ6A 3WN7A 1CRUA 4MX0A 4XE9A 1SNTA 1CVMA 2F26A 2IASA 2ZW9A 2HU0A 1Z4VA 4QN7A 1L7HA 3A9HA 5F9TA 5FNQA 3S8ZA 2F0ZA 1N1VA 4MJUA 3B69A 2W8BB 1NSBA 4A0PA 3CL0A 3W09A
chains in the Genus database with same CATH topology
3O4PA 3Q6PA 3Q6KA 3U0SA 3SRGA 2GHSA 1QLGA 2IAVA 2IAOA 4GN9A 3LI5A 5D9CA 4GNCA 3SOQA 4GNAA 5GX2A 3SOBB 5GX4A 4GNBA 2GVVA 3V65B 2FPBA 2IAXA 4JMLA 4O5SA 1Q7FA 3AMRA 2ISMA 5GX1A 2DG0A 3G4HA 3G4EA 2FP8A 2DSOA 3V1SA 2IATA 3TC9A 4PWZA 2GVXA 2G8SA 3DASA 1IJQA 3FW0A 4HHQA 3Q6TA 3BYCA 1H6LA 1V04A 3V64C 2FPCA 3LI4A 4Q1UA 3A9GA 2GVUA 1CRZA 3KGGA 1E1AA 2OJHA 1RWIA 2HQSA 5GX5A 3SREA 4DG6A 3HRPA 1N7DA 4O5TA 1C5KA 3WW9A 5EX7A 2V91A 3AMSA 4R40A 2POOA 2IAPA 4ZLRA 3FVZA 5FWWA 2VAQA 3S94A 4IMBA 1QBIA 4HW6A 3DR2A 1RWLA 1POOA 3E5ZA 4HHOA 2DG1A 2IVZA 2P4OA 2IAQA 5GTQA 2IARA 5D9DA 2W8BA 3S2KA 2QE8A 1PJXA 1CQ1A 3HLIA 3I1CA 2FP9A 1NPEA 3LI3A 1CRUA 1C9UA 2GVWA 5GX3A 1CVMA 3WWAA 2IASA 3IAXA 5D9BA 3KYAA 3A9HA 2IAWA 3SOVA 3S8ZA 3S8VA 4GN7A 4GN8A 3P5BL 2IAUA 2W8BB 3HLHA 4A0PA 4IYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O4P A;  3Q6P A;  3Q6K A;  3U0S A;  3SRG A;  2GHS A;  1QLG A;  2IAV A;  2IAO A;  4GN9 A;  3LI5 A;  5D9C A;  4GNC A;  3SOQ A;  4GNA A;  5GX2 A;  3SOB B;  5GX4 A;  4GNB A;  2GVV A;  3V65 B;  2FPB A;  2IAX A;  4JML A;  4O5S A;  1Q7F A;  3AMR A;  2ISM A;  5GX1 A;  2DG0 A;  3G4H A;  3G4E A;  2FP8 A;  2DSO A;  3V1S A;  2IAT A;  3TC9 A;  4PWZ A;  2GVX A;  2G8S A;  3DAS A;  1IJQ A;  3FW0 A;  4HHQ A;  3Q6T A;  3BYC A;  1H6L A;  1V04 A;  3V64 C;  2FPC A;  3LI4 A;  4Q1U A;  3A9G A;  2GVU A;  1CRZ A;  3KGG A;  1E1A A;  2OJH A;  1RWI A;  2HQS A;  5GX5 A;  3SRE A;  4DG6 A;  3HRP A;  1N7D A;  4O5T A;  1C5K A;  3WW9 A;  5EX7 A;  2V91 A;  3AMS A;  4R40 A;  2POO A;  2IAP A;  4ZLR A;  3FVZ A;  5FWW A;  2VAQ A;  3S94 A;  4IMB A;  1QBI A;  4HW6 A;  3DR2 A;  1RWL A;  1POO A;  3E5Z A;  4HHO A;  2DG1 A;  2IVZ A;  2P4O A;  2IAQ A;  5GTQ A;  2IAR A;  5D9D A;  2W8B A;  3S2K A;  2QE8 A;  1PJX A;  1CQ1 A;  3HLI A;  3I1C A;  2FP9 A;  1NPE A;  3LI3 A;  1CRU A;  1C9U A;  2GVW A;  5GX3 A;  1CVM A;  3WWA A;  2IAS A;  3IAX A;  5D9B A;  3KYA A;  3A9H A;  2IAW A;  3SOV A;  3S8Z A;  3S8V A;  4GN7 A;  4GN8 A;  3P5B L;  2IAU A;  2W8B B;  3HLH A;  4A0P A;  4IYG A; 
#chains in the Genus database with same CATH topology
 2AH2 A;  3O9K A;  4J9T A;  4MC7 A;  4B7R A;  2YDP A;  1S1D A;  3Q6K A;  2RKC A;  1NCD N;  5FZJ A;  2Z32 A;  3TI6 A;  4QN4 A;  1IVF A;  2F29 A;  4YW4 A;  4MWV A;  3H72 A;  3LI5 A;  3L6V A;  4YW2 A;  3UC1 A;  5GX2 A;  5HUN A;  1NNA A;  4GNB A;  4XIL A;  4KS1 A;  2GVV A;  3V65 B;  2FPB A;  4M4V A;  2VSK A;  2WOZ A;  1NNC A;  1E8T A;  4GZP A;  2B8H A;  4YZ2 A;  3A72 A;  2H2N A;  2IAT A;  4L7C A;  4QNP A;  3K3A A;  1IJQ A;  5NN9 A;  4HHQ A;  4XJA A;  2HTV A;  2F24 A;  5HUK A;  4KS5 A;  4YY8 A;  2SIL A;  2QWK A;  3K38 A;  2VW1 A;  1MR5 A;  4Q1U A;  4M4N A;  4CPY A;  2HTU A;  3TI5 A;  1S0J A;  2OJH A;  2HQS A;  1Z4X A;  1NNB A;  3JU4 A;  4Q6K A;  3H73 A;  1N6D A;  1W8N A;  2BZD A;  1N7D A;  1X2J A;  4GZS A;  1C5K A;  4HZY A;  3WW9 A;  1NN2 A;  1VCU A;  2IAP A;  3S94 A;  1NSD A;  3TI8 A;  4GZQ A;  4CPN A;  3SIL A;  2VWD A;  1N1T A;  2IVZ A;  1USR A;  4FPL A;  1F8C A;  5D9D A;  2CML A;  4AGI A;  7NN9 A;  2W8B A;  4SLI A;  1ZGK A;  2QE8 A;  3INB A;  3CL2 A;  1CQ1 A;  3TI3 A;  4FQ4 A;  3HLI A;  4FPK A;  3NO0 A;  4K3Y A;  1OFZ A;  2QWA A;  4M3M A;  3WWA A;  5EO7 A;  1W21 A;  2BF6 A;  4FOV A;  3IAX A;  1MS9 A;  2YDT A;  3KYA A;  2A75 A;  3SOV A;  1K32 A;  1MS4 A;  1MWE A;  2VK7 A;  1Z50 A;  4GN7 A;  1MS5 A;  4CPM A;  2IAU A;  4KS2 A;  3HLH A;  4X6K A;  1B9T A;  2YA4 A;  4GZO A;  2C4L A;  5FNU A;  1MS1 A;  1MS3 A;  3O4P A;  4FPY A;  4XJ8 A;  4NCS A;  1Z4Z A;  1V3C A;  4MWX A;  1XOG A;  1S18 A;  2QWI A;  1QLG A;  1V0E A;  1Z4W A;  3SOQ A;  2QWH A;  4XJ9 A;  1N6F A;  2HTW A;  2IAX A;  2ISM A;  4GZW A;  2DG0 A;  3G4H A;  1WCQ A;  1MS0 A;  1SLI A;  3G4E A;  2DSO A;  5JYY A;  3V1S A;  4WA3 A;  4G3N A;  4WA5 A;  3TC9 A;  4PWZ A;  2HU4 A;  2ZB6 A;  1B9S A;  4HZV A;  3DAS A;  3FW0 A;  1V3E A;  2VVZ A;  4H52 A;  1A14 N;  2QWF A;  1NCA N;  1V04 A;  3V64 C;  2HT5 A;  3II7 A;  3WDZ A;  1SLL A;  4X49 A;  5EO8 A;  3A9G A;  3KGG A;  1E1A A;  1RWI A;  5GX5 A;  4K1K A;  4H53 A;  4XJQ A;  1N6E A;  4D4U A;  4FVK A;  4L7B A;  5F72 C;  2F12 A;  4MWQ A;  5EX7 A;  5FZN A;  2QWC A;  4X4A A;  4CPZ A;  1NMC A;  3D11 A;  2SLI A;  4QN6 A;  4ZLR A;  4I00 A;  1NSC A;  5FWW A;  1DIL A;  4MWJ A;  4DGR A;  1QBI A;  2QWJ A;  1MZ5 A;  4IN4 A;  3DR2 A;  1NCB N;  4B7J A;  2IAQ A;  5GTQ A;  1F8D A;  4XJR A;  1MZ6 A;  4BBW A;  1SUU A;  4FZH A;  4YZ4 A;  1IUC A;  4CPL A;  4FPE A;  4QN5 A;  1NMA N;  2FP9 A;  1S0I A;  3TIA A;  3T1E A;  5GX3 A;  3OPZ A;  4IQK A;  4AHA A;  1V2I A;  2XN4 A;  2IAW A;  3D12 A;  4MZA A;  2ZZK A;  1IUB A;  3P5B L;  6NN9 A;  2QWB A;  2QWD A;  4FP2 A;  1L7F A;  4MWR A;  5FNS A;  4FP3 A;  4XMB A;  2F10 A;  3Q6P A;  2AGS A;  2W38 A;  4YW1 A;  3SRG A;  4L7D A;  1DIM A;  1IVG A;  4YW5 A;  3K37 A;  4ZY3 A;  2IAV A;  2IAO A;  1F8E A;  4K1H A;  3K39 A;  1V0Z A;  2QWG A;  2XZJ A;  4FPC A;  2YA6 A;  4GNA A;  5GX4 A;  5HUG A;  1IVD A;  3TIC A;  4WEG A;  4JML A;  4O5S A;  2AEP A;  1W1X A;  3TIB A;  1Q7F A;  1EUU A;  5GX1 A;  1INY A;  4FPJ A;  2AEQ A;  4CSD A;  4XMI A;  1MS8 A;  5H47 A;  2FP8 A;  2HT7 A;  4B7M A;  3ALW A;  4K1J A;  2GVX A;  4IFL X;  4MZE A;  2G8S A;  1V0F A;  2XZK A;  2YA5 A;  5FNT A;  1L7G A;  3Q6T A;  3SAL A;  3BYC A;  1W0P A;  4UF7 A;  1H6L A;  1N1S A;  3LI4 A;  2FLU X;  2GVU A;  1N1Y A;  1CRZ A;  1EUT A;  4NC5 A;  4GDI A;  4FOW A;  4D52 B;  3GVK A;  4O5T A;  4JF7 A;  4YZ3 A;  2V91 A;  3AMS A;  4FPG A;  1IVC A;  3O9J A;  4FOY A;  4HZW A;  1E8U A;  2VAQ A;  1XOE A;  4M4U A;  1ING A;  3NN9 A;  4ZGC A;  4HW6 A;  1EUS A;  1RWL A;  1NCC N;  2YA8 A;  2DG1 A;  4AH4 A;  5HX0 A;  4HZX A;  4XIK A;  4D52 C;  2ZB5 A;  4YZ1 A;  1USX A;  3S2K A;  3GVJ A;  1PJX A;  2VSM A;  3I1C A;  1NPE A;  3LI3 A;  1C9U A;  2W5N A;  1W0O A;  4XJZ A;  2F28 A;  2GVW A;  2VW2 A;  3SLI A;  4CPO A;  3CYE A;  4GDJ A;  2HT8 A;  2X9M A;  4AGT A;  3ADE A;  3K36 A;  5D9B A;  4X47 A;  3PJQ A;  1X2R A;  2F11 A;  4GZX A;  3S8V A;  2F25 A;  4FPF A;  4UOU A;  4GN8 A;  5B2D A;  4HZZ A;  2HTY A;  1BJI A;  4C1Y B;  2W20 A;  4B7Q A;  2HTR A;  2F13 A;  5HUM A;  1INW A;  4IYG A;  4B7N A;  4FPO B;  5FNR A;  3U0S A;  2GHS A;  4FOQ A;  4XHB A;  4GJT A;  4HIZ A;  2W5O A;  1V3D A;  3GVL A;  4GN9 A;  2JKB A;  4K1I A;  5D9C A;  4GNC A;  3ALX A;  3SOB B;  3VNG A;  3VNH A;  1A4G A;  4XHX A;  4ASC A;  2XZI A;  2VK6 A;  3AMR A;  4MWU A;  4WA4 A;  3SAN A;  3H71 A;  4QN3 A;  1EUR A;  3A71 A;  4MWY A;  2HTQ A;  4KS4 A;  4MWL A;  1NMB N;  1V3B A;  1A4Q A;  4XOG A;  2DYH A;  4D52 A;  1WP5 A;  4IFN X;  2SIM A;  1Z4Y A;  1INV A;  4YZ5 A;  4XYX A;  2C4A A;  1W20 A;  1F8B A;  1SO7 A;  4CH9 A;  2VW0 A;  2FPC A;  3H6J A;  1WCS A;  4N1B A;  4GZT A;  1W8O A;  4KS3 A;  4XJW A;  1U6D X;  4NN9 A;  3SRE A;  4DG6 A;  4GB1 A;  3HRP A;  1INX A;  2XCY A;  1IVE A;  4GEZ A;  2VPJ A;  3NSS A;  4IFJ A;  3ZGC A;  4R40 A;  2H2U A;  2POO A;  5M1Z A;  3FVZ A;  5B2C A;  4IMB A;  4MJV A;  2YA7 A;  4MWW A;  4YW3 A;  4FPH A;  3ZGD A;  2BER A;  2ZWA A;  3CKZ A;  2FHR A;  5CGJ A;  1E8V A;  2F27 A;  1POO A;  3BEQ A;  3E5Z A;  4HHO A;  4XIO A;  2BAT A;  1INH A;  1INF A;  2P4O A;  1KIT A;  3TI4 A;  2IAR A;  1IVB A;  1ZI0 A;  2QWE A;  3B7E A;  4D8S A;  4WEF A;  1VCJ A;  4XJU A;  4CHB A;  1B9V A;  4XMA A;  4C1Y A;  2VK5 A;  4FJ6 A;  3WN7 A;  1CRU A;  4MX0 A;  4XE9 A;  1SNT A;  1CVM A;  2F26 A;  2IAS A;  2ZW9 A;  2HU0 A;  1Z4V A;  4QN7 A;  1L7H A;  3A9H A;  5F9T A;  5FNQ A;  3S8Z A;  2F0Z A;  1N1V A;  4MJU A;  3B69 A;  2W8B B;  1NSB A;  4A0P A;  3CL0 A;  3W09 A; 
#chains in the Genus database with same CATH homology
 3O4P A;  3Q6P A;  3Q6K A;  3U0S A;  3SRG A;  2GHS A;  1QLG A;  2IAV A;  2IAO A;  4GN9 A;  3LI5 A;  5D9C A;  4GNC A;  3SOQ A;  4GNA A;  5GX2 A;  3SOB B;  5GX4 A;  4GNB A;  2GVV A;  3V65 B;  2FPB A;  2IAX A;  4JML A;  4O5S A;  1Q7F A;  3AMR A;  2ISM A;  5GX1 A;  2DG0 A;  3G4H A;  3G4E A;  2FP8 A;  2DSO A;  3V1S A;  2IAT A;  3TC9 A;  4PWZ A;  2GVX A;  2G8S A;  3DAS A;  1IJQ A;  3FW0 A;  4HHQ A;  3Q6T A;  3BYC A;  1H6L A;  1V04 A;  3V64 C;  2FPC A;  3LI4 A;  4Q1U A;  3A9G A;  2GVU A;  1CRZ A;  3KGG A;  1E1A A;  2OJH A;  1RWI A;  2HQS A;  5GX5 A;  3SRE A;  4DG6 A;  3HRP A;  1N7D A;  4O5T A;  1C5K A;  3WW9 A;  5EX7 A;  2V91 A;  3AMS A;  4R40 A;  2POO A;  2IAP A;  4ZLR A;  3FVZ A;  5FWW A;  2VAQ A;  3S94 A;  4IMB A;  1QBI A;  4HW6 A;  3DR2 A;  1RWL A;  1POO A;  3E5Z A;  4HHO A;  2DG1 A;  2IVZ A;  2P4O A;  2IAQ A;  5GTQ A;  2IAR A;  5D9D A;  2W8B A;  3S2K A;  2QE8 A;  1PJX A;  1CQ1 A;  3HLI A;  3I1C A;  2FP9 A;  1NPE A;  3LI3 A;  1CRU A;  1C9U A;  2GVW A;  5GX3 A;  1CVM A;  3WWA A;  2IAS A;  3IAX A;  5D9B A;  3KYA A;  3A9H A;  2IAW A;  3SOV A;  3S8Z A;  3S8V A;  4GN7 A;  4GN8 A;  3P5B L;  2IAU A;  2W8B B;  3HLH A;  4A0P A;  4IYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...