4HZWA

Crystal structure of influenza a neuraminidase n3 complexed with laninamivir
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
388
structure length
388
Chain Sequence
FRPFKSPLPLCPFRGFFPFHKDNAIRLGENKDVIVTREPYVSCDNDNCWSFALAQGALLGTKHSNGTIKDRTPYRSLIRFPIGTAPVLGNYKEICIAWSSSSCFDGKEWMHVCMTGNDNDASAQIIYGGRMTDSIKSWRKDILRTQESECQCIDGTCVVAVTDGPAANSADYRVYWIREGKIIKYENVPKTKIQHLEECSCYVDIDVYCICRDNWKGSNRPWMRINNETILETGYVCSKFHSDTPRPADPSTMSCDSPSNVNGGPGVKGFGFKAGDDVWLGRTVSTSGRSGFEIIKVTEGWINSPNHVKSITQTLVSNNDWSGYSGSFIVKAKDCFQPCFYVELIRGRPNKNDDVSWTSNSIVTFCGLDNEPGSGNWPDGSNIGFMPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional and structural analysis of influenza virus neuraminidase N3 offers further insight into the mechanisms of oseltamivir resistance.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Neuraminidase
total genus 108
structure length 388
sequence length 388
ec nomenclature
pdb deposition date 2012-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 4hzwA00
2AGSA 4B7QA 1IVCA 1DILA 1MS4A 3W09A 1MS8A 3GVLA 1A14N 2QWDA 4KS3A 2HTVA 3SILA 2QWGA 4YW3A 4X47A 1V0ZA 4GZSA 4KS1A 1USRA 2HT7A 2HT5A 4M4UA 3GVKA 2VWDA 4J9TA 7NN9A 4FJ6A 5B2CA 4XHBA 2F27A 4GZTA 4YZ1A 4YZ2A 3OPZA 2YA6A 1Z4YA 3CYEA 4KS2A 2HT8A 2VK6A 1B9TA 4SLIA 4WA4A 3T1EA 1MS0A 4WA3A 4UF7A 1SO7A 3PJQA 4YW5A 3H6JA 4NN9A 1NNBA 1L7HA 2F12A 3JU4A 5NN9A 4BBWA 4XOGA 4FPYA 1INXA 1V3DA 1DIMA 1V3CA 1NMBN 4MZEA 1NNAA 1EURA 1W8OA 4I00A 4QN5A 3H72A 1VCJA 4XJQA 2XCYA 2QWAA 1W1XA 5JYYA 3CL0A 2VSKA 3TIBA 3K36A 4FPJA 1NCBN 1V3BA 2YA4A 2BF6A 4K1HA 1XOGA 2YA7A 4XILA 2X9MA 1MS5A 4NCSA 4KS5A 1F8CA 2HTQA 1USXA 1N1VA 4YZ5A 5M1ZA 4H52A 2QWIA 1EUSA 2JKBA 4D8SA 1F8EA 1INHA 4FOWA 4GZOA 1NSBA 3SALA 2BATA 4XMIA 1IVGA 4XJRA 1E8UA 4XHXA 4H53A 1NNCA 3D11A 2FHRA 3ALXA 2C4AA 4MWRA 2AEQA 2VVZA 4Q6KA 4M4NA 1F8BA 4NC5A 1MS1A 2AEPA 1MZ5A 3B69A 4GZQA 3D12A 3TI4A 2HTUA 2VW2A 4MWYA 4YZ3A 1S0JA 4X49A 3B7EA 2ZB5A 4FPGA 3CL2A 2SILA 1W8NA 4HZXA 4MWQA 2YA5A 1KITA 1V0FA 3SANA 4YW4A 1E8VA 4GB1A 4WA5A 5B2DA 1SLLA 3BEQA 1MS9A 1SLIA 2CMLA 4FZHA 1NCDN 1Z4XA 4MWUA 3INBA 4XJUA 1B9VA 3K38A 2VSMA 2QWJA 2XZIA 3K3AA 4HZWA 4FPEA 4HZZA 1MWEA 4MWJA 2HTRA 2F29A 1IVFA 4YZ4A 2SLIA 1B9SA 4M3MA 4HZVA 4XJZA 1INYA 3TI8A 4KS4A 5HUMA 1NCCN 2QWFA 1WCSA 4CPYA 2HTWA 4QN3A 4B7JA 2VK5A 1E8TA 1BJIA 2QWCA 1NSCA 3TI3A 1INWA 1EUTA 4XJ8A 4WEFA 1NMAN 1A4GA 2W5NA 1N1SA 3K39A 4QN4A 4FPKA 4CPZA 2BZDA 1W0OA 2F28A 3TICA 1IVEA 4FPFA 4FPOB 4GEZA 2RKCA 2XZJA 1MR5A 2HTYA 2XZKA 4XJ9A 2F26A 4FPHA 4FPLA 1L7FA 4K1JA 1Z4WA 3TIAA 5HX0A 4X6KA 4HIZA 4QN6A 3NSSA 1A4QA 4YW1A 4MWLA 3TI5A 4B7MA 4CPNA 4YW2A 2W5OA 4K1KA 1VCUA 2QWKA 3H71A 4JF7A 1NMCA 1XOEA 2F24A 1IVDA 3SLIA 2VW1A 4FVKA 3K37A 4FOVA 1MZ6A 4CPLA 1Z50A 3NN9A 2W20A 2A75A 2F25A 1EUUA 1F8DA 1N1YA 4GDJA 4GZWA 1NN2A 3O9JA 4FOYA 2C4LA 1MS3A 4CPMA 2ZB6A 1INGA 4XYXA 4FQ4A 4MJVA 4CPOA 2F10A 4FP3A 4XJAA 4WEGA 2VW0A 4GJTA 5F9TA 4MZAA 4FOQA 6NN9A 4XIOA 3A72A 1IVBA 2HU4A 5HUGA 2B8HA 1W0PA 2YA8A 2BERA 4GZPA 4B7NA 4XIKA 1S0IA 2QWHA 1V2IA 1NSDA 2YDPA 5HUNA 4QN7A 1V3EA 2HU0A 1NCAN 3A71A 2F0ZA 4MWXA 2W38A 4MX0A 1W21A 2YDTA 4HZYA 3ALWA 2SIMA 1Z4VA 4B7RA 2AH2A 2F11A 4MJUA 4XE9A 1N1TA 4FP2A 2VK7A 1INFA 1Z4ZA 4MC7A 4X4AA 2QWEA 3H73A 5HUKA 1WCQA 1SNTA 1INVA 4QNPA 3O9KA 4MWVA 1V0EA 1W20A 3TI6A 4K3YA 4DGRA 4XMAA 4FPCA 2QWBA 4MWWA 3CKZA 3GVJA 4XJWA 4GZXA 4GDIA 1L7GA 4K1IA 2F13A 4M4VA
chains in the Genus database with same CATH superfamily
2AGSA 4B7QA 1IVCA 1DILA 1MS4A 3ZGCA 3W09A 1MS8A 3GVLA 1A14N 2QWDA 3TC9A 4KS3A 2HTVA 4HW6A 2G8SA 3SILA 1H6LA 2QWGA 4YW3A 2IAUA 4X47A 1V0ZA 4GZSA 3AMRA 4KS1A 2IVZA 1USRA 2HT7A 4IFJA 2HT5A 4M4UA 3S8VA 4CH9A 3GVKA 2DSOA 5GTQA 2VWDA 3AMSA 4J9TA 7NN9A 4FJ6A 4C1YB 4GNCA 3LI4A 5B2CA 2VAQA 4XHBA 1CRUA 2F27A 5H47A 1C5KA 4GZTA 4YZ1A 5GX4A 4YZ2A 2DG1A 3OPZA 4ASCA 2YA6A 1Z4YA 4CHBA 3CYEA 5EO7A 1PJXA 4GNBA 4KS2A 2HT8A 4JMLA 2VK6A 3A9HA 1B9TA 4SLIA 1X2RA 1OFZA 3WWAA 4WA4A 3T1EA 1MS0A 1S1DA 4WA3A 4UF7A 1SO7A 3PJQA 4O5SA 3H6JA 4YW5A 4NN9A 1NNBA 1L7HA 2F12A 3JU4A 5NN9A 4BBWA 4XOGA 4FPYA 1INXA 1V3DA 1DIMA 5FZJA 1V3CA 5EX7A 1NMBN 4MZEA 1NNAA 4HHQA 1EURA 1RWLA 1IJQA 1W8OA 4I00A 5D9CA 5GX3A 4QN5A 3H72A 1VCJA 2GVUA 4XJQA 2XCYA 2QWAA 1W1XA 2ZZKA 5JYYA 2FP8A 3CL0A 2VSKA 3TIBA 2ZWAA 3K36A 4FPJA 3V1SA 4CSDA 1N6DA 4IMBA 2IAXA 1NCBN 2GHSA 1V3BA 1S18A 2YA4A 4ZGCA 3NO0A 2BF6A 4K1HA 1XOGA 2YA7A 4XILA 3DR2A 3HLHA 2X9MA 1MS5A 4KS5A 4NCSA 1K32A 5EO8A 1F8CA 2IASA 2HTQA 1USXA 1N1VA 4YZ5A 5M1ZA 4H52A 1QLGA 2QWIA 1EUSA 2JKBA 2IAQA 3G4HA 4D8SA 1F8EA 1INHA 4FOWA 2W8BB 1E1AA 4GZOA 1N7DA 2FPBA 1NSBA 3SALA 2BATA 4XMIA 1IVGA 4XJRA 1E8UA 4XHXA 4H53A 1NNCA 3D11A 2FHRA 3ALXA 2C4AA 4C1YA 4MWRA 3L6VA 2AEQA 2VVZA 4Q6KA 4M4NA 4L7BA 3G4EA 1F8BA 4NC5A 1MS1A 2ISMA 2AEPA 3U0SA 3SOBB 1IUCA 1MZ5A 4GN7A 3B69A 4GNAA 4GZQA 1N6FA 5FNTA 2IAOA 3D12A 4IQKA 3P5BL 3ADEA 4XMBA 3TI4A 2DYHA 2HTUA 2VW2A 4MWYA 4ZY3A 4YZ3A 1S0JA 1SUUA 4L7CA 4GN8A 2QE8A 4X49A 3B7EA 2IAPA 2ZB5A 4FPGA 4Q1UA 3CL2A 1CRZA 3SOQA 3SOVA 2SILA 5FNSA 1W8NA 4AGIA 5GX2A 4HZXA 4MWQA 3Q6TA 3S8ZA 2YA5A 1KITA 4PWZA 4AH4A 5FWWA 1V0FA 4YY8A 3SANA 2H2NA 4YW4A 1E8VA 4GB1A 2HQSA 4WA5A 5B2DA 1SLLA 3IAXA 3BEQA 1MS9A 1SLIA 2CMLA 4FZHA 1NCDN 1Z4XA 4MWUA 5D9BA 3INBA 4XJUA 1B9VA 3K38A 3LI5A 2VSMA 2QWJA 4L7DA 2XZIA 3I1CA 3K3AA 2WOZA 4HZWA 4FPEA 4HZZA 1MWEA 5GX1A 4MWJA 2HTRA 2F29A 4ZLRA 1IVFA 4YZ4A 2SLIA 1B9SA 3Q6KA 4M3MA 4HZVA 4XJZA 1INYA 3TI8A 2Z32A 4KS4A 3Q6PA 5HUMA 1NCCN 2QWFA 1WCSA 4CPYA 2HTWA 4QN3A 4B7JA 1C9UA 2VK5A 2W8BA 3HRPA 4IN4A 1E8TA 2POOA 2ZW9A 1X2JA 1BJIA 2QWCA 1U6DX 1NSCA 3TI3A 1INWA 1EUTA 4XJ8A 5FZNA 4WEFA 1NMAN 3KGGA 1A4GA 2W5NA 1N1SA 3K39A 4QN4A 4FPKA 4CPZA 1ZGKA 2BZDA 3WW9A 4DG6A 1W0OA 2F28A 3TICA 1IVEA 4FPFA 4FPOB 4GEZA 2RKCA 2XZJA 4O5TA 2VPJA 5FNRA 1MR5A 2HTYA 2XZKA 4XJ9A 2F26A 4FPHA 4FPLA 1L7FA 4K1JA 1Z4WA 3TIAA 5HX0A 4X6KA 4HIZA 2H2UA 4QN6A 3NSSA 1A4QA 1CQ1A 4YW1A 1POOA 4MWLA 3TI5A 2DG0A 4A0PA 4B7MA 4YW2A 3WDZA 4CPNA 2W5OA 4K1KA 1VCUA 1WP5A 2QWKA 3H71A 4JF7A 3ZGDA 1NMCA 3O4PA 1XOEA 2F24A 1IVDA 2V91A 3SLIA 2VW1A 4FVKA 3K37A 4IFNX 4FOVA 1MZ6A 5D9DA 4CPLA 1Z50A 1V04A 3NN9A 1IUBA 3S94A 2IATA 4G3NA 2W20A 2FPCA 2A75A 2F25A 2P4OA 1EUUA 1F8DA 1N1YA 5FNQA 4GDJA 4GZWA 4D4UA 1NN2A 3II7A 3O9JA 4FOYA 2C4LA 1MS3A 4CPMA 3E5ZA 2ZB6A 1INGA 4XYXA 4FQ4A 4MJVA 3SREA 4CPOA 2F10A 4FP3A 4XJAA 4WEGA 2VW0A 4GJTA 5F9TA 4MZAA 4FOQA 6NN9A 4XIOA 3A72A 1IVBA 2HU4A 5HUGA 2B8HA 1W0PA 2YA8A 2BERA 4GZPA 4B7NA 3BYCA 4XIKA 1N6EA 1S0IA 2QWHA 3V65B 1V2IA 1NSDA 2YDPA 4IFLX 5HUNA 4QN7A 5GX5A 1V3EA 2FLUX 1CVMA 2HU0A 2XN4A 1NCAN 3A71A 2F0ZA 4MWXA 4UOUA 2W38A 4N1BA 3SRGA 4MX0A 1W21A 5F72C 2YDTA 1Q7FA 3LI3A 4HZYA 4AHAA 1ZI0A 2GVWA 3ALWA 2GVXA 2SIMA 1Z4VA 3A9GA 4IYGA 3UC1A 2AH2A 4B7RA 2F11A 4MJUA 4XE9A 3S2KA 4R40A 1N1TA 1RWIA 4FP2A 2VK7A 4AGTA 1INFA 1Z4ZA 4MC7A 4HHOA 4X4AA 1NPEA 2QWEA 3H73A 5HUKA 3WN7A 1WCQA 1SNTA 1INVA 5FNUA 3HLIA 2IAVA 4QNPA 2OJHA 3O9KA 4MWVA 1V0EA 1W20A 2IAWA 2FP9A 3TI6A 3KYAA 3FW0A 4K3YA 4DGRA 4XMAA 4FPCA 3DASA 3V64C 2QWBA 4MWWA 3CKZA 3GVJA 1QBIA 3FVZA 5CGJA 4XJWA 4GZXA 3VNGA 2GVVA 2IARA 4GDIA 4D52C 1L7GA 4K1IA 2F13A 4M4VA 4D52A 4GN9A 3VNHA 4D52B
chains in the Genus database with same CATH topology
2AGSA 4B7QA 1IVCA 1DILA 1MS4A 3W09A 1MS8A 3GVLA 1A14N 2QWDA 4KS3A 2HTVA 3SILA 2QWGA 4YW3A 4X47A 1V0ZA 4GZSA 4KS1A 1USRA 2HT7A 2HT5A 4M4UA 3GVKA 2VWDA 4J9TA 7NN9A 4FJ6A 5B2CA 4XHBA 2F27A 4GZTA 4YZ1A 4YZ2A 3OPZA 2YA6A 1Z4YA 3CYEA 4KS2A 2HT8A 2VK6A 1B9TA 4SLIA 4WA4A 3T1EA 1MS0A 1S1DA 4WA3A 4UF7A 1SO7A 3PJQA 4YW5A 3H6JA 4NN9A 1NNBA 1L7HA 2F12A 3JU4A 5NN9A 4BBWA 4XOGA 4FPYA 1INXA 1V3DA 1DIMA 1V3CA 1NMBN 4MZEA 1NNAA 1EURA 1W8OA 4I00A 4QN5A 3H72A 1VCJA 4XJQA 2XCYA 2QWAA 1W1XA 5JYYA 3CL0A 2VSKA 3TIBA 3K36A 4FPJA 1NCBN 1V3BA 1S18A 2YA4A 2BF6A 4K1HA 1XOGA 2YA7A 4XILA 2X9MA 1MS5A 4NCSA 4KS5A 1F8CA 2HTQA 1USXA 1N1VA 4YZ5A 5M1ZA 4H52A 2QWIA 1EUSA 2JKBA 4D8SA 1F8EA 1INHA 4FOWA 4GZOA 1NSBA 3SALA 2BATA 4XMIA 1IVGA 4XJRA 1E8UA 4XHXA 4H53A 1NNCA 3D11A 2FHRA 3ALXA 2C4AA 4MWRA 2AEQA 2VVZA 4Q6KA 4M4NA 1F8BA 4NC5A 1MS1A 2AEPA 1MZ5A 3B69A 4GZQA 3D12A 3TI4A 2HTUA 2VW2A 4MWYA 4YZ3A 1S0JA 4X49A 3B7EA 2ZB5A 4FPGA 3CL2A 2SILA 1W8NA 4HZXA 4MWQA 2YA5A 1KITA 1V0FA 3SANA 2H2NA 4YW4A 1E8VA 4GB1A 4WA5A 5B2DA 1SLLA 3BEQA 1MS9A 1SLIA 2CMLA 4FZHA 1NCDN 1Z4XA 4MWUA 3INBA 4XJUA 1B9VA 3K38A 2VSMA 2QWJA 2XZIA 3K3AA 4HZWA 4FPEA 4HZZA 1MWEA 4MWJA 2HTRA 2F29A 1IVFA 4YZ4A 2SLIA 1B9SA 4M3MA 4HZVA 4XJZA 1INYA 3TI8A 4KS4A 5HUMA 1NCCN 2QWFA 1WCSA 4CPYA 2HTWA 4QN3A 4B7JA 2VK5A 1E8TA 1BJIA 2QWCA 1NSCA 3TI3A 1INWA 1EUTA 4XJ8A 4WEFA 1NMAN 1A4GA 2W5NA 1N1SA 3K39A 4QN4A 4FPKA 4CPZA 2BZDA 1W0OA 2F28A 3TICA 1IVEA 4FPFA 4FPOB 4GEZA 2RKCA 2XZJA 1MR5A 2HTYA 2XZKA 4XJ9A 2F26A 4FPHA 4FPLA 1L7FA 4K1JA 1Z4WA 3TIAA 5HX0A 4X6KA 4HIZA 2H2UA 4QN6A 3NSSA 1A4QA 4YW1A 4MWLA 3TI5A 4B7MA 4CPNA 4YW2A 2W5OA 4K1KA 1VCUA 2QWKA 3H71A 4JF7A 1NMCA 1XOEA 2F24A 1IVDA 3SLIA 2VW1A 4FVKA 3K37A 4FOVA 1MZ6A 4CPLA 1Z50A 3NN9A 2W20A 2A75A 2F25A 1EUUA 1F8DA 1N1YA 4GDJA 4GZWA 1NN2A 3O9JA 4FOYA 2C4LA 1MS3A 4CPMA 2ZB6A 1INGA 4XYXA 4FQ4A 4MJVA 4CPOA 2F10A 4FP3A 4XJAA 4WEGA 2VW0A 4GJTA 5F9TA 4MZAA 4FOQA 6NN9A 4XIOA 3A72A 1IVBA 2HU4A 5HUGA 2B8HA 1W0PA 2YA8A 2BERA 4GZPA 4B7NA 4XIKA 1S0IA 2QWHA 1V2IA 1NSDA 2YDPA 5HUNA 4QN7A 1V3EA 2HU0A 1NCAN 3A71A 2F0ZA 4MWXA 2W38A 4MX0A 1W21A 2YDTA 4HZYA 3ALWA 2SIMA 1Z4VA 4B7RA 2AH2A 2F11A 4MJUA 4XE9A 1N1TA 4FP2A 2VK7A 1INFA 1Z4ZA 4MC7A 4X4AA 2QWEA 3H73A 5HUKA 1WCQA 1SNTA 1INVA 4QNPA 3O9KA 4MWVA 1V0EA 1W20A 3TI6A 4K3YA 4DGRA 4XMAA 4FPCA 2QWBA 4MWWA 3CKZA 3GVJA 4XJWA 4GZXA 4GDIA 1L7GA 4K1IA 2F13A 4M4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGS A;  4B7Q A;  1IVC A;  1DIL A;  1MS4 A;  3W09 A;  1MS8 A;  3GVL A;  1A14 N;  2QWD A;  4KS3 A;  2HTV A;  3SIL A;  2QWG A;  4YW3 A;  4X47 A;  1V0Z A;  4GZS A;  4KS1 A;  1USR A;  2HT7 A;  2HT5 A;  4M4U A;  3GVK A;  2VWD A;  4J9T A;  7NN9 A;  4FJ6 A;  5B2C A;  4XHB A;  2F27 A;  4GZT A;  4YZ1 A;  4YZ2 A;  3OPZ A;  2YA6 A;  1Z4Y A;  3CYE A;  4KS2 A;  2HT8 A;  2VK6 A;  1B9T A;  4SLI A;  4WA4 A;  3T1E A;  1MS0 A;  4WA3 A;  4UF7 A;  1SO7 A;  3PJQ A;  4YW5 A;  3H6J A;  4NN9 A;  1NNB A;  1L7H A;  2F12 A;  3JU4 A;  5NN9 A;  4BBW A;  4XOG A;  4FPY A;  1INX A;  1V3D A;  1DIM A;  1V3C A;  1NMB N;  4MZE A;  1NNA A;  1EUR A;  1W8O A;  4I00 A;  4QN5 A;  3H72 A;  1VCJ A;  4XJQ A;  2XCY A;  2QWA A;  1W1X A;  5JYY A;  3CL0 A;  2VSK A;  3TIB A;  3K36 A;  4FPJ A;  1NCB N;  1V3B A;  2YA4 A;  2BF6 A;  4K1H A;  1XOG A;  2YA7 A;  4XIL A;  2X9M A;  1MS5 A;  4NCS A;  4KS5 A;  1F8C A;  2HTQ A;  1USX A;  1N1V A;  4YZ5 A;  5M1Z A;  4H52 A;  2QWI A;  1EUS A;  2JKB A;  4D8S A;  1F8E A;  1INH A;  4FOW A;  4GZO A;  1NSB A;  3SAL A;  2BAT A;  4XMI A;  1IVG A;  4XJR A;  1E8U A;  4XHX A;  4H53 A;  1NNC A;  3D11 A;  2FHR A;  3ALX A;  2C4A A;  4MWR A;  2AEQ A;  2VVZ A;  4Q6K A;  4M4N A;  1F8B A;  4NC5 A;  1MS1 A;  2AEP A;  1MZ5 A;  3B69 A;  4GZQ A;  3D12 A;  3TI4 A;  2HTU A;  2VW2 A;  4MWY A;  4YZ3 A;  1S0J A;  4X49 A;  3B7E A;  2ZB5 A;  4FPG A;  3CL2 A;  2SIL A;  1W8N A;  4HZX A;  4MWQ A;  2YA5 A;  1KIT A;  1V0F A;  3SAN A;  4YW4 A;  1E8V A;  4GB1 A;  4WA5 A;  5B2D A;  1SLL A;  3BEQ A;  1MS9 A;  1SLI A;  2CML A;  4FZH A;  1NCD N;  1Z4X A;  4MWU A;  3INB A;  4XJU A;  1B9V A;  3K38 A;  2VSM A;  2QWJ A;  2XZI A;  3K3A A;  4HZW A;  4FPE A;  4HZZ A;  1MWE A;  4MWJ A;  2HTR A;  2F29 A;  1IVF A;  4YZ4 A;  2SLI A;  1B9S A;  4M3M A;  4HZV A;  4XJZ A;  1INY A;  3TI8 A;  4KS4 A;  5HUM A;  1NCC N;  2QWF A;  1WCS A;  4CPY A;  2HTW A;  4QN3 A;  4B7J A;  2VK5 A;  1E8T A;  1BJI A;  2QWC A;  1NSC A;  3TI3 A;  1INW A;  1EUT A;  4XJ8 A;  4WEF A;  1NMA N;  1A4G A;  2W5N A;  1N1S A;  3K39 A;  4QN4 A;  4FPK A;  4CPZ A;  2BZD A;  1W0O A;  2F28 A;  3TIC A;  1IVE A;  4FPF A;  4FPO B;  4GEZ A;  2RKC A;  2XZJ A;  1MR5 A;  2HTY A;  2XZK A;  4XJ9 A;  2F26 A;  4FPH A;  4FPL A;  1L7F A;  4K1J A;  1Z4W A;  3TIA A;  5HX0 A;  4X6K A;  4HIZ A;  4QN6 A;  3NSS A;  1A4Q A;  4YW1 A;  4MWL A;  3TI5 A;  4B7M A;  4CPN A;  4YW2 A;  2W5O A;  4K1K A;  1VCU A;  2QWK A;  3H71 A;  4JF7 A;  1NMC A;  1XOE A;  2F24 A;  1IVD A;  3SLI A;  2VW1 A;  4FVK A;  3K37 A;  4FOV A;  1MZ6 A;  4CPL A;  1Z50 A;  3NN9 A;  2W20 A;  2A75 A;  2F25 A;  1EUU A;  1F8D A;  1N1Y A;  4GDJ A;  4GZW A;  1NN2 A;  3O9J A;  4FOY A;  2C4L A;  1MS3 A;  4CPM A;  2ZB6 A;  1ING A;  4XYX A;  4FQ4 A;  4MJV A;  4CPO A;  2F10 A;  4FP3 A;  4XJA A;  4WEG A;  2VW0 A;  4GJT A;  5F9T A;  4MZA A;  4FOQ A;  6NN9 A;  4XIO A;  3A72 A;  1IVB A;  2HU4 A;  5HUG A;  2B8H A;  1W0P A;  2YA8 A;  2BER A;  4GZP A;  4B7N A;  4XIK A;  1S0I A;  2QWH A;  1V2I A;  1NSD A;  2YDP A;  5HUN A;  4QN7 A;  1V3E A;  2HU0 A;  1NCA N;  3A71 A;  2F0Z A;  4MWX A;  2W38 A;  4MX0 A;  1W21 A;  2YDT A;  4HZY A;  3ALW A;  2SIM A;  1Z4V A;  4B7R A;  2AH2 A;  2F11 A;  4MJU A;  4XE9 A;  1N1T A;  4FP2 A;  2VK7 A;  1INF A;  1Z4Z A;  4MC7 A;  4X4A A;  2QWE A;  3H73 A;  5HUK A;  1WCQ A;  1SNT A;  1INV A;  4QNP A;  3O9K A;  4MWV A;  1V0E A;  1W20 A;  3TI6 A;  4K3Y A;  4DGR A;  4XMA A;  4FPC A;  2QWB A;  4MWW A;  3CKZ A;  3GVJ A;  4XJW A;  4GZX A;  4GDI A;  1L7G A;  4K1I A;  2F13 A;  4M4V A; 
#chains in the Genus database with same CATH topology
 2AGS A;  4B7Q A;  1IVC A;  1DIL A;  1MS4 A;  3ZGC A;  3W09 A;  1MS8 A;  3GVL A;  1A14 N;  2QWD A;  3TC9 A;  4KS3 A;  2HTV A;  4HW6 A;  2G8S A;  3SIL A;  1H6L A;  2QWG A;  4YW3 A;  2IAU A;  4X47 A;  1V0Z A;  4GZS A;  3AMR A;  4KS1 A;  2IVZ A;  1USR A;  2HT7 A;  4IFJ A;  2HT5 A;  4M4U A;  3S8V A;  4CH9 A;  3GVK A;  2DSO A;  5GTQ A;  2VWD A;  3AMS A;  4J9T A;  7NN9 A;  4FJ6 A;  4C1Y B;  4GNC A;  3LI4 A;  5B2C A;  2VAQ A;  4XHB A;  1CRU A;  2F27 A;  5H47 A;  1C5K A;  4GZT A;  4YZ1 A;  5GX4 A;  4YZ2 A;  2DG1 A;  3OPZ A;  4ASC A;  2YA6 A;  1Z4Y A;  4CHB A;  3CYE A;  5EO7 A;  1PJX A;  4GNB A;  4KS2 A;  2HT8 A;  4JML A;  2VK6 A;  3A9H A;  1B9T A;  4SLI A;  1X2R A;  1OFZ A;  3WWA A;  4WA4 A;  3T1E A;  1MS0 A;  1S1D A;  4WA3 A;  4UF7 A;  1SO7 A;  3PJQ A;  4O5S A;  3H6J A;  4YW5 A;  4NN9 A;  1NNB A;  1L7H A;  2F12 A;  3JU4 A;  5NN9 A;  4BBW A;  4XOG A;  4FPY A;  1INX A;  1V3D A;  1DIM A;  5FZJ A;  1V3C A;  5EX7 A;  1NMB N;  4MZE A;  1NNA A;  4HHQ A;  1EUR A;  1RWL A;  1IJQ A;  1W8O A;  4I00 A;  5D9C A;  5GX3 A;  4QN5 A;  3H72 A;  1VCJ A;  2GVU A;  4XJQ A;  2XCY A;  2QWA A;  1W1X A;  2ZZK A;  5JYY A;  2FP8 A;  3CL0 A;  2VSK A;  3TIB A;  2ZWA A;  3K36 A;  4FPJ A;  3V1S A;  4CSD A;  1N6D A;  4IMB A;  2IAX A;  1NCB N;  2GHS A;  1V3B A;  1S18 A;  2YA4 A;  4ZGC A;  3NO0 A;  2BF6 A;  4K1H A;  1XOG A;  2YA7 A;  4XIL A;  3DR2 A;  3HLH A;  2X9M A;  1MS5 A;  4KS5 A;  4NCS A;  1K32 A;  5EO8 A;  1F8C A;  2IAS A;  2HTQ A;  1USX A;  1N1V A;  4YZ5 A;  5M1Z A;  4H52 A;  1QLG A;  2QWI A;  1EUS A;  2JKB A;  2IAQ A;  3G4H A;  4D8S A;  1F8E A;  1INH A;  4FOW A;  2W8B B;  1E1A A;  4GZO A;  1N7D A;  2FPB A;  1NSB A;  3SAL A;  2BAT A;  4XMI A;  1IVG A;  4XJR A;  1E8U A;  4XHX A;  4H53 A;  1NNC A;  3D11 A;  2FHR A;  3ALX A;  2C4A A;  4C1Y A;  4MWR A;  3L6V A;  2AEQ A;  2VVZ A;  4Q6K A;  4M4N A;  4L7B A;  3G4E A;  1F8B A;  4NC5 A;  1MS1 A;  2ISM A;  2AEP A;  3U0S A;  3SOB B;  1IUC A;  1MZ5 A;  4GN7 A;  3B69 A;  4GNA A;  4GZQ A;  1N6F A;  5FNT A;  2IAO A;  3D12 A;  4IQK A;  3P5B L;  3ADE A;  4XMB A;  3TI4 A;  2DYH A;  2HTU A;  2VW2 A;  4MWY A;  4ZY3 A;  4YZ3 A;  1S0J A;  1SUU A;  4L7C A;  4GN8 A;  2QE8 A;  4X49 A;  3B7E A;  2IAP A;  2ZB5 A;  4FPG A;  4Q1U A;  3CL2 A;  1CRZ A;  3SOQ A;  3SOV A;  2SIL A;  5FNS A;  1W8N A;  4AGI A;  5GX2 A;  4HZX A;  4MWQ A;  3Q6T A;  3S8Z A;  2YA5 A;  1KIT A;  4PWZ A;  4AH4 A;  5FWW A;  1V0F A;  4YY8 A;  3SAN A;  2H2N A;  4YW4 A;  1E8V A;  4GB1 A;  2HQS A;  4WA5 A;  5B2D A;  1SLL A;  3IAX A;  3BEQ A;  1MS9 A;  1SLI A;  2CML A;  4FZH A;  1NCD N;  1Z4X A;  4MWU A;  5D9B A;  3INB A;  4XJU A;  1B9V A;  3K38 A;  3LI5 A;  2VSM A;  2QWJ A;  4L7D A;  2XZI A;  3I1C A;  3K3A A;  2WOZ A;  4HZW A;  4FPE A;  4HZZ A;  1MWE A;  5GX1 A;  4MWJ A;  2HTR A;  2F29 A;  4ZLR A;  1IVF A;  4YZ4 A;  2SLI A;  1B9S A;  3Q6K A;  4M3M A;  4HZV A;  4XJZ A;  1INY A;  3TI8 A;  2Z32 A;  4KS4 A;  3Q6P A;  5HUM A;  1NCC N;  2QWF A;  1WCS A;  4CPY A;  2HTW A;  4QN3 A;  4B7J A;  1C9U A;  2VK5 A;  2W8B A;  3HRP A;  4IN4 A;  1E8T A;  2POO A;  2ZW9 A;  1X2J A;  1BJI A;  2QWC A;  1U6D X;  1NSC A;  3TI3 A;  1INW A;  1EUT A;  4XJ8 A;  5FZN A;  4WEF A;  1NMA N;  3KGG A;  1A4G A;  2W5N A;  1N1S A;  3K39 A;  4QN4 A;  4FPK A;  4CPZ A;  1ZGK A;  2BZD A;  3WW9 A;  4DG6 A;  1W0O A;  2F28 A;  3TIC A;  1IVE A;  4FPF A;  4FPO B;  4GEZ A;  2RKC A;  2XZJ A;  4O5T A;  2VPJ A;  5FNR A;  1MR5 A;  2HTY A;  2XZK A;  4XJ9 A;  2F26 A;  4FPH A;  4FPL A;  1L7F A;  4K1J A;  1Z4W A;  3TIA A;  5HX0 A;  4X6K A;  4HIZ A;  2H2U A;  4QN6 A;  3NSS A;  1A4Q A;  1CQ1 A;  4YW1 A;  1POO A;  4MWL A;  3TI5 A;  2DG0 A;  4A0P A;  4B7M A;  4YW2 A;  3WDZ A;  4CPN A;  2W5O A;  4K1K A;  1VCU A;  1WP5 A;  2QWK A;  3H71 A;  4JF7 A;  3ZGD A;  1NMC A;  3O4P A;  1XOE A;  2F24 A;  1IVD A;  2V91 A;  3SLI A;  2VW1 A;  4FVK A;  3K37 A;  4IFN X;  4FOV A;  1MZ6 A;  5D9D A;  4CPL A;  1Z50 A;  1V04 A;  3NN9 A;  1IUB A;  3S94 A;  2IAT A;  4G3N A;  2W20 A;  2FPC A;  2A75 A;  2F25 A;  2P4O A;  1EUU A;  1F8D A;  1N1Y A;  5FNQ A;  4GDJ A;  4GZW A;  4D4U A;  1NN2 A;  3II7 A;  3O9J A;  4FOY A;  2C4L A;  1MS3 A;  4CPM A;  3E5Z A;  2ZB6 A;  1ING A;  4XYX A;  4FQ4 A;  4MJV A;  3SRE A;  4CPO A;  2F10 A;  4FP3 A;  4XJA A;  4WEG A;  2VW0 A;  4GJT A;  5F9T A;  4MZA A;  4FOQ A;  6NN9 A;  4XIO A;  3A72 A;  1IVB A;  2HU4 A;  5HUG A;  2B8H A;  1W0P A;  2YA8 A;  2BER A;  4GZP A;  4B7N A;  3BYC A;  4XIK A;  1N6E A;  1S0I A;  2QWH A;  3V65 B;  1V2I A;  1NSD A;  2YDP A;  4IFL X;  5HUN A;  4QN7 A;  5GX5 A;  1V3E A;  2FLU X;  1CVM A;  2HU0 A;  2XN4 A;  1NCA N;  3A71 A;  2F0Z A;  4MWX A;  4UOU A;  2W38 A;  4N1B A;  3SRG A;  4MX0 A;  1W21 A;  5F72 C;  2YDT A;  1Q7F A;  3LI3 A;  4HZY A;  4AHA A;  1ZI0 A;  2GVW A;  3ALW A;  2GVX A;  2SIM A;  1Z4V A;  3A9G A;  4IYG A;  3UC1 A;  2AH2 A;  4B7R A;  2F11 A;  4MJU A;  4XE9 A;  3S2K A;  4R40 A;  1N1T A;  1RWI A;  4FP2 A;  2VK7 A;  4AGT A;  1INF A;  1Z4Z A;  4MC7 A;  4HHO A;  4X4A A;  1NPE A;  2QWE A;  3H73 A;  5HUK A;  3WN7 A;  1WCQ A;  1SNT A;  1INV A;  5FNU A;  3HLI A;  2IAV A;  4QNP A;  2OJH A;  3O9K A;  4MWV A;  1V0E A;  1W20 A;  2IAW A;  2FP9 A;  3TI6 A;  3KYA A;  3FW0 A;  4K3Y A;  4DGR A;  4XMA A;  4FPC A;  3DAS A;  3V64 C;  2QWB A;  4MWW A;  3CKZ A;  3GVJ A;  1QBI A;  3FVZ A;  5CGJ A;  4XJW A;  4GZX A;  3VNG A;  2GVV A;  2IAR A;  4GDI A;  4D52 C;  1L7G A;  4K1I A;  2F13 A;  4M4V A;  4D52 A;  4GN9 A;  3VNH A;  4D52 B; 
#chains in the Genus database with same CATH homology
 2AGS A;  4B7Q A;  1IVC A;  1DIL A;  1MS4 A;  3W09 A;  1MS8 A;  3GVL A;  1A14 N;  2QWD A;  4KS3 A;  2HTV A;  3SIL A;  2QWG A;  4YW3 A;  4X47 A;  1V0Z A;  4GZS A;  4KS1 A;  1USR A;  2HT7 A;  2HT5 A;  4M4U A;  3GVK A;  2VWD A;  4J9T A;  7NN9 A;  4FJ6 A;  5B2C A;  4XHB A;  2F27 A;  4GZT A;  4YZ1 A;  4YZ2 A;  3OPZ A;  2YA6 A;  1Z4Y A;  3CYE A;  4KS2 A;  2HT8 A;  2VK6 A;  1B9T A;  4SLI A;  4WA4 A;  3T1E A;  1MS0 A;  1S1D A;  4WA3 A;  4UF7 A;  1SO7 A;  3PJQ A;  4YW5 A;  3H6J A;  4NN9 A;  1NNB A;  1L7H A;  2F12 A;  3JU4 A;  5NN9 A;  4BBW A;  4XOG A;  4FPY A;  1INX A;  1V3D A;  1DIM A;  1V3C A;  1NMB N;  4MZE A;  1NNA A;  1EUR A;  1W8O A;  4I00 A;  4QN5 A;  3H72 A;  1VCJ A;  4XJQ A;  2XCY A;  2QWA A;  1W1X A;  5JYY A;  3CL0 A;  2VSK A;  3TIB A;  3K36 A;  4FPJ A;  1NCB N;  1V3B A;  1S18 A;  2YA4 A;  2BF6 A;  4K1H A;  1XOG A;  2YA7 A;  4XIL A;  2X9M A;  1MS5 A;  4NCS A;  4KS5 A;  1F8C A;  2HTQ A;  1USX A;  1N1V A;  4YZ5 A;  5M1Z A;  4H52 A;  2QWI A;  1EUS A;  2JKB A;  4D8S A;  1F8E A;  1INH A;  4FOW A;  4GZO A;  1NSB A;  3SAL A;  2BAT A;  4XMI A;  1IVG A;  4XJR A;  1E8U A;  4XHX A;  4H53 A;  1NNC A;  3D11 A;  2FHR A;  3ALX A;  2C4A A;  4MWR A;  2AEQ A;  2VVZ A;  4Q6K A;  4M4N A;  1F8B A;  4NC5 A;  1MS1 A;  2AEP A;  1MZ5 A;  3B69 A;  4GZQ A;  3D12 A;  3TI4 A;  2HTU A;  2VW2 A;  4MWY A;  4YZ3 A;  1S0J A;  4X49 A;  3B7E A;  2ZB5 A;  4FPG A;  3CL2 A;  2SIL A;  1W8N A;  4HZX A;  4MWQ A;  2YA5 A;  1KIT A;  1V0F A;  3SAN A;  2H2N A;  4YW4 A;  1E8V A;  4GB1 A;  4WA5 A;  5B2D A;  1SLL A;  3BEQ A;  1MS9 A;  1SLI A;  2CML A;  4FZH A;  1NCD N;  1Z4X A;  4MWU A;  3INB A;  4XJU A;  1B9V A;  3K38 A;  2VSM A;  2QWJ A;  2XZI A;  3K3A A;  4HZW A;  4FPE A;  4HZZ A;  1MWE A;  4MWJ A;  2HTR A;  2F29 A;  1IVF A;  4YZ4 A;  2SLI A;  1B9S A;  4M3M A;  4HZV A;  4XJZ A;  1INY A;  3TI8 A;  4KS4 A;  5HUM A;  1NCC N;  2QWF A;  1WCS A;  4CPY A;  2HTW A;  4QN3 A;  4B7J A;  2VK5 A;  1E8T A;  1BJI A;  2QWC A;  1NSC A;  3TI3 A;  1INW A;  1EUT A;  4XJ8 A;  4WEF A;  1NMA N;  1A4G A;  2W5N A;  1N1S A;  3K39 A;  4QN4 A;  4FPK A;  4CPZ A;  2BZD A;  1W0O A;  2F28 A;  3TIC A;  1IVE A;  4FPF A;  4FPO B;  4GEZ A;  2RKC A;  2XZJ A;  1MR5 A;  2HTY A;  2XZK A;  4XJ9 A;  2F26 A;  4FPH A;  4FPL A;  1L7F A;  4K1J A;  1Z4W A;  3TIA A;  5HX0 A;  4X6K A;  4HIZ A;  2H2U A;  4QN6 A;  3NSS A;  1A4Q A;  4YW1 A;  4MWL A;  3TI5 A;  4B7M A;  4CPN A;  4YW2 A;  2W5O A;  4K1K A;  1VCU A;  2QWK A;  3H71 A;  4JF7 A;  1NMC A;  1XOE A;  2F24 A;  1IVD A;  3SLI A;  2VW1 A;  4FVK A;  3K37 A;  4FOV A;  1MZ6 A;  4CPL A;  1Z50 A;  3NN9 A;  2W20 A;  2A75 A;  2F25 A;  1EUU A;  1F8D A;  1N1Y A;  4GDJ A;  4GZW A;  1NN2 A;  3O9J A;  4FOY A;  2C4L A;  1MS3 A;  4CPM A;  2ZB6 A;  1ING A;  4XYX A;  4FQ4 A;  4MJV A;  4CPO A;  2F10 A;  4FP3 A;  4XJA A;  4WEG A;  2VW0 A;  4GJT A;  5F9T A;  4MZA A;  4FOQ A;  6NN9 A;  4XIO A;  3A72 A;  1IVB A;  2HU4 A;  5HUG A;  2B8H A;  1W0P A;  2YA8 A;  2BER A;  4GZP A;  4B7N A;  4XIK A;  1S0I A;  2QWH A;  1V2I A;  1NSD A;  2YDP A;  5HUN A;  4QN7 A;  1V3E A;  2HU0 A;  1NCA N;  3A71 A;  2F0Z A;  4MWX A;  2W38 A;  4MX0 A;  1W21 A;  2YDT A;  4HZY A;  3ALW A;  2SIM A;  1Z4V A;  4B7R A;  2AH2 A;  2F11 A;  4MJU A;  4XE9 A;  1N1T A;  4FP2 A;  2VK7 A;  1INF A;  1Z4Z A;  4MC7 A;  4X4A A;  2QWE A;  3H73 A;  5HUK A;  1WCQ A;  1SNT A;  1INV A;  4QNP A;  3O9K A;  4MWV A;  1V0E A;  1W20 A;  3TI6 A;  4K3Y A;  4DGR A;  4XMA A;  4FPC A;  2QWB A;  4MWW A;  3CKZ A;  3GVJ A;  4XJW A;  4GZX A;  4GDI A;  1L7G A;  4K1I A;  2F13 A;  4M4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...